1JK1A

Zif268 d20a mutant bound to wt dna site
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
85
structure length
85
Chain Sequence
b'RPYACPVESCDRRFSRSAELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*CP*GP*G)-3'
publication title Rearrangement of side-chains in a Zif268 mutant highlights the complexities of zinc finger-DNA recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 26
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2001-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1jk1A02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1jk1A01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1jk1A03
5KL3A 2EOHA 2YTDA 4FK5C 1AAYA 2EM3A 2EM2A 2ADRA 3MHSC 4X9JA 2YTOA 1Z1BA 2J7JA 1DGCA 2EOYA 2YSOA 2EOIA 1NCSA 2EL5A 2RPCA 2EM6A 2EMAA 2YSPA 2GHFA 2EMIA 2MKNA 2YRHA 2YTQA 1ZR9A 1B69A 2JPAA 2EMGA 1A1HA 2EPZA 2EL4A 2EMWA 1A1JA 2EM7A 5KL5A 2EN7A 2CSHA 2LV2A 1ZU1A 2EOQA 2EOSA 2YTGA 2HGHA 3EPHA 2LT7A 1JK2A 1UN6B 2ELYA 1KJKA 2EPUA 5KL6A 2YTPA 2I13A 2YRMA 2EMYA 2E72A 2EMHA 2MDGA 1MEYC 1LLMC 2YTJA 1TF3A 1A1GA 2EPXA 2EN6A 2EM0A 1BB8A 5KL2A 3UK3C 2EJ4A 2EP3A 2EMLA 2DLQA 1A1KA 5KL7A 2D9HA 4F6MA 2EN8A 2EL6A 2EMXA 2LVHA 4GZNC 4R2EA 2BB8A 2EMFA 2EM8A 2LCEA 2R1FA 2EOFA 2EOEA 2WBSA 2JP9A 1P47A 1TN9A 2EOOA 2LO3A 2EOXA 2MKDA 2YU8A 1ZAAC 2VRDA 2EMKA 2EM5A 2CT1A 2EN2A 3MHHC 2EN3A 4R2RA 2PRTA 2GLIA 2EMBA 1X5WA 1YUIA 2WCC3 4R2QA 1X6EA 1TF6A 4IS1C 1A1IA 2ELZA 1X6FA 2RSIA 4IJDA 1A1LA 1F2IG 1RMDA 2EMCA 2EPAA 2YTFA 3VHTB 1UBDC 4M9VC 2EQ1A 2A25A 2ENCA 2YTNA 2EN4A 4F2JC 2EOMA 4F6NA 1WJPA 2NABA 2EMZA 4R2SA 1BBOA 2YRKA 2EOJA 2EPPA 2EM9A 5KL4A 2WBUA 2DRPA 1X6HA 2EM4A 2EOZA 1G2DC 4R2AA 1G2FC 4R2PA 2DGCA 2DLKA 2YTEA 2EE8A 3EPJA 2EN1A 1JK1A 1YSAC 1X3CA 2EPRA 2EORA 3EPLA 3EPKA 2M9AA 2ENAA 1A1FA 1YUJA 2YTIA 2WBTA 2EQ0A 2YU5A 3M99B 4R2DA 2CTDA 4WSGA 4R2CA 2EPCA 2ENHA 2EQ3A 2DMIA
chains in the Genus database with same CATH superfamily
3J7AG 2EOHA 4GEQB 3JU0A 2ADRA 4Q35B 1YPNA 2LRSA 4WSPA 2YTOA 2LTSA 3C6KA 4OOGC 4M2ZA 1XMQE 3ECRA 2EL5A 2RTXA 2V8QB 2YSPA 5DNYA 2EMAA 2MKNA 4JV5E 4J8ZA 2RS6A 4WXDA 2EMWA 1T39A 2CSHA 2LV2A 2HGHA 2EOSA 3EPHA 4YHHE 1AH5A 2KOUA 2FTXB 1UN6B 4B3TE 2EPUA 5FLXC 5KL6A 4DR4E 1DI2A 4X66E 2YTPA 3C6MA 1STUA 2I13A 1XNRE 2EMYA 2EMHA 2MDGA 2YTJA 1GTKA 2EPXA 5KL2A 3KZZA 2EMLA 3THOB 2LVHA 4LF9E 2EMFA 2R1FA 5TSEA 5AC5A 5BR8E 2VRDA 2NUEA 3HQ1A 2EMKA 1GQEA 3MHHC 1PJQA 2EMBA 1X5WA 2DIXA 4F54A 2VF1A 4DKKA 5T6JA 4P78A 1TF6A 4L5NC 3AV0A 2RSMA 1RMDA 3J7Yp 1T4OA 5AE3A 4DR2E 2A25A 3QG5C 4F2JC 2EN4A 4F6NA 4MLQA 2F4VE 4OX9E 2NABA 5A6KA 4TUIA 2JOXA 2EOJA 2EM9A 3IWCA 2B7TA 2EOZA 2G7HA 4R2PA 4DR6E 3VYXA 2EPKX 3MSWA 4P7DA 2LMZA 2GPIA 2L8TA 2B7VA 3EPKA 2V88A 1A1FA 2JY9A 2N8XA 1YUJA 4BCAA 4BMJA 2ODRD 2R76A 2VQFE 2EPMX 4R2CA 2PRTA 4WFTA 2NA2A 2UXCE 2DB2A 3DJWA 3ADIA 2YTDA 4ZYDA 4FK5C 4DV2E 1YFHA 5A2QC 1RC7A 3OMLA 1O0WA 2KHXA 1EH7A 1N3GA 1PDAA 2YSOA 4O4KA 4M30A 1NCSA 4LF5E 4DUZE 2EM6A 2GHFA 3HPZA 1RQ0A 3ADGA 1WXRA 3HPSA 1A1HA 1WHQA 2L6MA 4B3SE 2EM7A 2LUQA 4HTGA 3LMLA 2EN7A 5KL5A 2BBGA 2L92A 2UUBE 1DQ3A 1ZU1A 2YTGA 3KZYA 4BBYA 2LUPB 2YWQA 4I8OA 4NXNE 2M1SA 5AE2A 1L4SA 1SR9A 1YYKA 2YRMA 4JI2E 2HHHE 1MEYC 1UILA 4LF8E 1IQSA 4ZYEA 1BB8A 3KWRA 4X62E 4JI1E 2EJ4A 4TUGA 2D9HA 2UUAE 1XNQE 3F6HA 3BBGA 2UUCE 2EMXA 2FV4B 5IV8B 3HTXA 2BB8A 3JTZA 5IWAE 2EOFA 2IHR1 2WBSA 3THNA 4BC9A 2L3JA 2LO3A 2V87A 2MKDA 5A6BD 3BGHA 2EN3A 2YT4A 2CPNA 1YUIA 2WCC3 4R2QA 1FKAE 1X6EA 1A1IA 4R03A 1F2IG 3VHTB 5IXMB 2UU9E 4B3ME 4M9VC 2EQ1A 2ENCA 2MC6A 4ZYHA 5LMNE 2DMYA 2EOMA 1N34E 2EMZA 1X47A 2UXBE 2YRKA 2Q8UA 1BBOA 4DV0E 4DV4E 3IWBA 4LTYA 4L8NA 4DR3E 2EPPA 4O5GA 1X6HA 1KYQA 1G2DC 4R2AA 3K6QA 4F9BB 2DGCA 1WRJA 1IBME 2DLKA 3C4TA 5ADZA 3EPJA 1T38A 2B9DA 3P1XA 2EPRA 2EORA 2M9AA 4BS9A 4LFAE 1FJGE 2YTIA 3L00A 1ZBTA 3DF6A 2UXDE 3ADLA 4R2DA 2EWLA 2CTDA 2M7QA 2FGGA 1T4LB 1X49A 2V89A 4WX9A 2EQ3A 2LJHA 2DMIA 2YZTA 5KL3A 3VK6A 2N3HA 3FIGA 2EM3A 2EM2A 3T1HE 4X9JA 1IQOA 4KZSA 1Z1BA 1IBKE 2J7JA 2KONA 4LFBE 2JWOA 4NXME 3RMPA 4K0KE 2EOYA 2LE2A 4BHCA 2HJJA 5CFFE 5LL6R 2RS7A 5F3WA 4WPYA 2YTQA 1ZR9A 4AQYE 2JXPA 4R8OA 2JPAA 2RQLA 1BBGA 2EPZA 4RH8A 2EPLX 4O43A 2EL4A 1A1JA 4DV7E 1XMOE 4BHBA 2LT7A 2ELYA 2YPNA 3LLHA 4JI7E 1N36E 4WXCA 2JYAA 1YYOA 4WYQB 1GZ6A 1LLMC 3BIDA 1TF3A 2H36X 2EM0A 2JVAA 2LTRA 1N32E 2EP3A 2DLQA 4X64E 4DV6E 4F6MA 4DV3E 4R2EA 3T1YE 2V83A 1QU6A 2LCEA 2NUFA 4JI8E 4F9CB 2JP9A 4X65E 5A69A 4DR5E 3VYYA 2EM5A 2CT1A 2EN2A 4Q28A 1EKZA 3ZOQB 4R2RA 2N3GA 1HR0E 2MDRA 4JI0E 2EZ6A 5AE1A 2L33A 1X48A 2M4IA 2ZM6E 2K7IA 4IJDA 2WZOA 4LF7E 1HNWE 2YTNA 1WJPA 4R2SA 2ODRC 4ZYGA 2DRPA 1YYWA 2E1MA 1HNXE 1QNTA 4HEIA 2YTEA 2EN1A 1YSAC 1X3CA 5LMUE 3EPLA 3J81C 2WBTA 2EQ0A 2YU5A 5LLQA 4N4RB 3IWDA 4KWYA 4BC7A 3F6GA 4WSGA 1T4NA 2L3CA 4JI5E 4O24A 1AAYA 3MHSC 4DR7E 4GKKE 2VQEE 1UHZA 2VE7C 1IBLE 3AUZA 4LFCE 1DGCA 5AC4A 2EOIA 1WHNA 2V85A 2RPCA 1PKPA 2F8BA 2JR1A 2EMIA 4NZVA 2YRHA 4GKJE 3H09A 4DV5E 1B69A 2EMGA 4KHPE 2EPOA 5A6JA 3JAMC 4DMIA 1PJTA 3BF2A 2EOQA 2LBSB 1ZBQA 1JK2A 1KJKA 5AASA 4F9AB 2EPNA 3TQMA 4DR1E 2E72A 1J5EE 2DSYA 5A6BA 4JI3E 4JYAE 1A1GA 4LF6E 4JI6E 2EN6A 4JI4E 1NEIA 1MGTA 3UK3C 1YZ9A 1A1KA 5KL7A 4RHBB 2EN8A 2EL6A 2E5LE 2HC5A 3J80C 1EH6A 2JOBA 5A6AA 2L2MA 4GZNC 2EM8A 2EOEA 2V86A 1P47A 1TN9A 2L2KB 2EOOA 1J26A 4B3RE 2L2NA 4X8WA 2MC5A 2EOXA 4DUYE 2YU8A 1ZAAC 1HNZE 2GLIA 4NHRA 4IS1C 1N33E 5IT9C 2ELZA 1X6FA 2RSIA 1A1LA 2EMCA 2EPAA 2YTFA 2I9IA 1UBDC 4MLVA 4DV1E 3C4BA 1PJSA 4LF4E 2LJUA 1IMUA 2NUGA 5KL4A 2WBUA 2EM4A 3EQ1A 1G2FC 2EE8A 1JK1A 4M0VA 4LU9A 1EH8A 1SFEA 2ENAA 3OTOE 3HXLA 3M99B 4YY3E 1I94E 2B3TB 2K4VA 3ADJA 2EPCA 2ENHA
chains in the Genus database with same CATH topology
5KL3A 2EOHA 2YTDA 4FK5C 1AAYA 2EM3A 2EM2A 2ADRA 3MHSC 4X9JA 2YTOA 1Z1BA 2J7JA 1DGCA 2EOYA 2YSOA 2EOIA 1NCSA 2EL5A 2RPCA 2EM6A 2EMAA 2YSPA 2GHFA 2EMIA 2MKNA 2YRHA 2YTQA 1ZR9A 1B69A 2JPAA 2EMGA 1A1HA 2EPZA 2EL4A 2EMWA 1A1JA 2EM7A 5KL5A 2EN7A 2CSHA 2LV2A 1ZU1A 2EOQA 2EOSA 2YTGA 2HGHA 3EPHA 2LT7A 1JK2A 1UN6B 2ELYA 1KJKA 2EPUA 5KL6A 2YTPA 2I13A 2YRMA 2EMYA 2E72A 2EMHA 2MDGA 1MEYC 1LLMC 2YTJA 1TF3A 1A1GA 2EPXA 2EN6A 2EM0A 1BB8A 5KL2A 3UK3C 2EJ4A 2EP3A 2EMLA 2DLQA 1A1KA 5KL7A 2D9HA 4F6MA 2EN8A 2EL6A 2EMXA 2LVHA 4GZNC 4R2EA 2BB8A 2EMFA 2EM8A 2LCEA 2R1FA 2EOFA 2EOEA 2WBSA 2JP9A 1P47A 1TN9A 2EOOA 2LO3A 2EOXA 2MKDA 2YU8A 1ZAAC 2VRDA 2EMKA 2EM5A 2CT1A 2EN2A 3MHHC 2EN3A 4R2RA 2PRTA 2GLIA 2EMBA 1X5WA 1YUIA 2WCC3 4R2QA 1X6EA 1TF6A 4IS1C 1A1IA 2ELZA 1X6FA 2RSIA 4IJDA 1A1LA 1F2IG 1RMDA 2EMCA 2EPAA 2YTFA 3VHTB 1UBDC 4M9VC 2EQ1A 2A25A 2ENCA 2YTNA 2EN4A 4F2JC 2EOMA 4F6NA 1WJPA 2NABA 2EMZA 4R2SA 1BBOA 2YRKA 2EOJA 2EPPA 2EM9A 5KL4A 2WBUA 2DRPA 1X6HA 2EM4A 2EOZA 1G2DC 4R2AA 1G2FC 4R2PA 2DGCA 2DLKA 2YTEA 2EE8A 3EPJA 2EN1A 1JK1A 1YSAC 1X3CA 2EPRA 2EORA 3EPLA 3EPKA 2M9AA 2ENAA 1A1FA 1YUJA 2YTIA 2WBTA 2EQ0A 2YU5A 3M99B 4R2DA 2CTDA 4WSGA 4R2CA 2EPCA 2ENHA 2EQ3A 2DMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KL3 A;  2EOH A;  2YTD A;  4FK5 C;  1AAY A;  2EM3 A;  2EM2 A;  2ADR A;  3MHS C;  4X9J A;  2YTO A;  1Z1B A;  2J7J A;  1DGC A;  2EOY A;  2YSO A;  2EOI A;  1NCS A;  2EL5 A;  2RPC A;  2EM6 A;  2EMA A;  2YSP A;  2GHF A;  2EMI A;  2MKN A;  2YRH A;  2YTQ A;  1ZR9 A;  1B69 A;  2JPA A;  2EMG A;  1A1H A;  2EPZ A;  2EL4 A;  2EMW A;  1A1J A;  2EM7 A;  5KL5 A;  2EN7 A;  2CSH A;  2LV2 A;  1ZU1 A;  2EOQ A;  2EOS A;  2YTG A;  2HGH A;  3EPH A;  2LT7 A;  1JK2 A;  1UN6 B;  2ELY A;  1KJK A;  2EPU A;  5KL6 A;  2YTP A;  2I13 A;  2YRM A;  2EMY A;  2E72 A;  2EMH A;  2MDG A;  1MEY C;  1LLM C;  2YTJ A;  1TF3 A;  1A1G A;  2EPX A;  2EN6 A;  2EM0 A;  1BB8 A;  5KL2 A;  3UK3 C;  2EJ4 A;  2EP3 A;  2EML A;  2DLQ A;  1A1K A;  5KL7 A;  2D9H A;  4F6M A;  2EN8 A;  2EL6 A;  2EMX A;  2LVH A;  4GZN C;  4R2E A;  2BB8 A;  2EMF A;  2EM8 A;  2LCE A;  2R1F A;  2EOF A;  2EOE A;  2WBS A;  2JP9 A;  1P47 A;  1TN9 A;  2EOO A;  2LO3 A;  2EOX A;  2MKD A;  2YU8 A;  1ZAA C;  2VRD A;  2EMK A;  2EM5 A;  2CT1 A;  2EN2 A;  3MHH C;  2EN3 A;  4R2R A;  2PRT A;  2GLI A;  2EMB A;  1X5W A;  1YUI A;  2WCC 3;  4R2Q A;  1X6E A;  1TF6 A;  4IS1 C;  1A1I A;  2ELZ A;  1X6F A;  2RSI A;  4IJD A;  1A1L A;  1F2I G;  1RMD A;  2EMC A;  2EPA A;  2YTF A;  3VHT B;  1UBD C;  4M9V C;  2EQ1 A;  2A25 A;  2ENC A;  2YTN A;  2EN4 A;  4F2J C;  2EOM A;  4F6N A;  1WJP A;  2NAB A;  2EMZ A;  4R2S A;  1BBO A;  2YRK A;  2EOJ A;  2EPP A;  2EM9 A;  5KL4 A;  2WBU A;  2DRP A;  1X6H A;  2EM4 A;  2EOZ A;  1G2D C;  4R2A A;  1G2F C;  4R2P A;  2DGC A;  2DLK A;  2YTE A;  2EE8 A;  3EPJ A;  2EN1 A;  1JK1 A;  1YSA C;  1X3C A;  2EPR A;  2EOR A;  3EPL A;  3EPK A;  2M9A A;  2ENA A;  1A1F A;  1YUJ A;  2YTI A;  2WBT A;  2EQ0 A;  2YU5 A;  3M99 B;  4R2D A;  2CTD A;  4WSG A;  4R2C A;  2EPC A;  2ENH A;  2EQ3 A;  2DMI A; 
#chains in the Genus database with same CATH topology
 3J7A G;  2EOH A;  4GEQ B;  3JU0 A;  2ADR A;  4Q35 B;  1YPN A;  2LRS A;  4WSP A;  2YTO A;  2LTS A;  3C6K A;  4OOG C;  4M2Z A;  1XMQ E;  3ECR A;  2EL5 A;  2RTX A;  2V8Q B;  2YSP A;  5DNY A;  2EMA A;  2MKN A;  4JV5 E;  4J8Z A;  2RS6 A;  4WXD A;  2EMW A;  1T39 A;  2CSH A;  2LV2 A;  2HGH A;  2EOS A;  3EPH A;  4YHH E;  1AH5 A;  2KOU A;  2FTX B;  1UN6 B;  4B3T E;  2EPU A;  5FLX C;  5KL6 A;  4DR4 E;  1DI2 A;  4X66 E;  2YTP A;  3C6M A;  1STU A;  2I13 A;  1XNR E;  2EMY A;  2EMH A;  2MDG A;  2YTJ A;  1GTK A;  2EPX A;  5KL2 A;  3KZZ A;  2EML A;  3THO B;  2LVH A;  4LF9 E;  2EMF A;  2R1F A;  5TSE A;  5AC5 A;  5BR8 E;  2VRD A;  2NUE A;  3HQ1 A;  2EMK A;  1GQE A;  3MHH C;  1PJQ A;  2EMB A;  1X5W A;  2DIX A;  4F54 A;  2VF1 A;  4DKK A;  5T6J A;  4P78 A;  1TF6 A;  4L5N C;  3AV0 A;  2RSM A;  1RMD A;  3J7Y p;  1T4O A;  5AE3 A;  4DR2 E;  2A25 A;  3QG5 C;  4F2J C;  2EN4 A;  4F6N A;  4MLQ A;  2F4V E;  4OX9 E;  2NAB A;  5A6K A;  4TUI A;  2JOX A;  2EOJ A;  2EM9 A;  3IWC A;  2B7T A;  2EOZ A;  2G7H A;  4R2P A;  4DR6 E;  3VYX A;  2EPK X;  3MSW A;  4P7D A;  2LMZ A;  2GPI A;  2L8T A;  2B7V A;  3EPK A;  2V88 A;  1A1F A;  2JY9 A;  2N8X A;  1YUJ A;  4BCA A;  4BMJ A;  2ODR D;  2R76 A;  2VQF E;  2EPM X;  4R2C A;  2PRT A;  4WFT A;  2NA2 A;  2UXC E;  2DB2 A;  3DJW A;  3ADI A;  2YTD A;  4ZYD A;  4FK5 C;  4DV2 E;  1YFH A;  5A2Q C;  1RC7 A;  3OML A;  1O0W A;  2KHX A;  1EH7 A;  1N3G A;  1PDA A;  2YSO A;  4O4K A;  4M30 A;  1NCS A;  4LF5 E;  4DUZ E;  2EM6 A;  2GHF A;  3HPZ A;  1RQ0 A;  3ADG A;  1WXR A;  3HPS A;  1A1H A;  1WHQ A;  2L6M A;  4B3S E;  2EM7 A;  2LUQ A;  4HTG A;  3LML A;  2EN7 A;  5KL5 A;  2BBG A;  2L92 A;  2UUB E;  1DQ3 A;  1ZU1 A;  2YTG A;  3KZY A;  4BBY A;  2LUP B;  2YWQ A;  4I8O A;  4NXN E;  2M1S A;  5AE2 A;  1L4S A;  1SR9 A;  1YYK A;  2YRM A;  4JI2 E;  2HHH E;  1MEY C;  1UIL A;  4LF8 E;  1IQS A;  4ZYE A;  1BB8 A;  3KWR A;  4X62 E;  4JI1 E;  2EJ4 A;  4TUG A;  2D9H A;  2UUA E;  1XNQ E;  3F6H A;  3BBG A;  2UUC E;  2EMX A;  2FV4 B;  5IV8 B;  3HTX A;  2BB8 A;  3JTZ A;  5IWA E;  2EOF A;  2IHR 1;  2WBS A;  3THN A;  4BC9 A;  2L3J A;  2LO3 A;  2V87 A;  2MKD A;  5A6B D;  3BGH A;  2EN3 A;  2YT4 A;  2CPN A;  1YUI A;  2WCC 3;  4R2Q A;  1FKA E;  1X6E A;  1A1I A;  4R03 A;  1F2I G;  3VHT B;  5IXM B;  2UU9 E;  4B3M E;  4M9V C;  2EQ1 A;  2ENC A;  2MC6 A;  4ZYH A;  5LMN E;  2DMY A;  2EOM A;  1N34 E;  2EMZ A;  1X47 A;  2UXB E;  2YRK A;  2Q8U A;  1BBO A;  4DV0 E;  4DV4 E;  3IWB A;  4LTY A;  4L8N A;  4DR3 E;  2EPP A;  4O5G A;  1X6H A;  1KYQ A;  1G2D C;  4R2A A;  3K6Q A;  4F9B B;  2DGC A;  1WRJ A;  1IBM E;  2DLK A;  3C4T A;  5ADZ A;  3EPJ A;  1T38 A;  2B9D A;  3P1X A;  2EPR A;  2EOR A;  2M9A A;  4BS9 A;  4LFA E;  1FJG E;  2YTI A;  3L00 A;  1ZBT A;  3DF6 A;  2UXD E;  3ADL A;  4R2D A;  2EWL A;  2CTD A;  2M7Q A;  2FGG A;  1T4L B;  1X49 A;  2V89 A;  4WX9 A;  2EQ3 A;  2LJH A;  2DMI A;  2YZT A;  5KL3 A;  3VK6 A;  2N3H A;  3FIG A;  2EM3 A;  2EM2 A;  3T1H E;  4X9J A;  1IQO A;  4KZS A;  1Z1B A;  1IBK E;  2J7J A;  2KON A;  4LFB E;  2JWO A;  4NXM E;  3RMP A;  4K0K E;  2EOY A;  2LE2 A;  4BHC A;  2HJJ A;  5CFF E;  5LL6 R;  2RS7 A;  5F3W A;  4WPY A;  2YTQ A;  1ZR9 A;  4AQY E;  2JXP A;  4R8O A;  2JPA A;  2RQL A;  1BBG A;  2EPZ A;  4RH8 A;  2EPL X;  4O43 A;  2EL4 A;  1A1J A;  4DV7 E;  1XMO E;  4BHB A;  2LT7 A;  2ELY A;  2YPN A;  3LLH A;  4JI7 E;  1N36 E;  4WXC A;  2JYA A;  1YYO A;  4WYQ B;  1GZ6 A;  1LLM C;  3BID A;  1TF3 A;  2H36 X;  2EM0 A;  2JVA A;  2LTR A;  1N32 E;  2EP3 A;  2DLQ A;  4X64 E;  4DV6 E;  4F6M A;  4DV3 E;  4R2E A;  3T1Y E;  2V83 A;  1QU6 A;  2LCE A;  2NUF A;  4JI8 E;  4F9C B;  2JP9 A;  4X65 E;  5A69 A;  4DR5 E;  3VYY A;  2EM5 A;  2CT1 A;  2EN2 A;  4Q28 A;  1EKZ A;  3ZOQ B;  4R2R A;  2N3G A;  1HR0 E;  2MDR A;  4JI0 E;  2EZ6 A;  5AE1 A;  2L33 A;  1X48 A;  2M4I A;  2ZM6 E;  2K7I A;  4IJD A;  2WZO A;  4LF7 E;  1HNW E;  2YTN A;  1WJP A;  4R2S A;  2ODR C;  4ZYG A;  2DRP A;  1YYW A;  2E1M A;  1HNX E;  1QNT A;  4HEI A;  2YTE A;  2EN1 A;  1YSA C;  1X3C A;  5LMU E;  3EPL A;  3J81 C;  2WBT A;  2EQ0 A;  2YU5 A;  5LLQ A;  4N4R B;  3IWD A;  4KWY A;  4BC7 A;  3F6G A;  4WSG A;  1T4N A;  2L3C A;  4JI5 E;  4O24 A;  1AAY A;  3MHS C;  4DR7 E;  4GKK E;  2VQE E;  1UHZ A;  2VE7 C;  1IBL E;  3AUZ A;  4LFC E;  1DGC A;  5AC4 A;  2EOI A;  1WHN A;  2V85 A;  2RPC A;  1PKP A;  2F8B A;  2JR1 A;  2EMI A;  4NZV A;  2YRH A;  4GKJ E;  3H09 A;  4DV5 E;  1B69 A;  2EMG A;  4KHP E;  2EPO A;  5A6J A;  3JAM C;  4DMI A;  1PJT A;  3BF2 A;  2EOQ A;  2LBS B;  1ZBQ A;  1JK2 A;  1KJK A;  5AAS A;  4F9A B;  2EPN A;  3TQM A;  4DR1 E;  2E72 A;  1J5E E;  2DSY A;  5A6B A;  4JI3 E;  4JYA E;  1A1G A;  4LF6 E;  4JI6 E;  2EN6 A;  4JI4 E;  1NEI A;  1MGT A;  3UK3 C;  1YZ9 A;  1A1K A;  5KL7 A;  4RHB B;  2EN8 A;  2EL6 A;  2E5L E;  2HC5 A;  3J80 C;  1EH6 A;  2JOB A;  5A6A A;  2L2M A;  4GZN C;  2EM8 A;  2EOE A;  2V86 A;  1P47 A;  1TN9 A;  2L2K B;  2EOO A;  1J26 A;  4B3R E;  2L2N A;  4X8W A;  2MC5 A;  2EOX A;  4DUY E;  2YU8 A;  1ZAA C;  1HNZ E;  2GLI A;  4NHR A;  4IS1 C;  1N33 E;  5IT9 C;  2ELZ A;  1X6F A;  2RSI A;  1A1L A;  2EMC A;  2EPA A;  2YTF A;  2I9I A;  1UBD C;  4MLV A;  4DV1 E;  3C4B A;  1PJS A;  4LF4 E;  2LJU A;  1IMU A;  2NUG A;  5KL4 A;  2WBU A;  2EM4 A;  3EQ1 A;  1G2F C;  2EE8 A;  1JK1 A;  4M0V A;  4LU9 A;  1EH8 A;  1SFE A;  2ENA A;  3OTO E;  3HXL A;  3M99 B;  4YY3 E;  1I94 E;  2B3T B;  2K4V A;  3ADJ A;  2EPC A;  2ENH A; 
#chains in the Genus database with same CATH homology
 5KL3 A;  2EOH A;  2YTD A;  4FK5 C;  1AAY A;  2EM3 A;  2EM2 A;  2ADR A;  3MHS C;  4X9J A;  2YTO A;  1Z1B A;  2J7J A;  1DGC A;  2EOY A;  2YSO A;  2EOI A;  1NCS A;  2EL5 A;  2RPC A;  2EM6 A;  2EMA A;  2YSP A;  2GHF A;  2EMI A;  2MKN A;  2YRH A;  2YTQ A;  1ZR9 A;  1B69 A;  2JPA A;  2EMG A;  1A1H A;  2EPZ A;  2EL4 A;  2EMW A;  1A1J A;  2EM7 A;  5KL5 A;  2EN7 A;  2CSH A;  2LV2 A;  1ZU1 A;  2EOQ A;  2EOS A;  2YTG A;  2HGH A;  3EPH A;  2LT7 A;  1JK2 A;  1UN6 B;  2ELY A;  1KJK A;  2EPU A;  5KL6 A;  2YTP A;  2I13 A;  2YRM A;  2EMY A;  2E72 A;  2EMH A;  2MDG A;  1MEY C;  1LLM C;  2YTJ A;  1TF3 A;  1A1G A;  2EPX A;  2EN6 A;  2EM0 A;  1BB8 A;  5KL2 A;  3UK3 C;  2EJ4 A;  2EP3 A;  2EML A;  2DLQ A;  1A1K A;  5KL7 A;  2D9H A;  4F6M A;  2EN8 A;  2EL6 A;  2EMX A;  2LVH A;  4GZN C;  4R2E A;  2BB8 A;  2EMF A;  2EM8 A;  2LCE A;  2R1F A;  2EOF A;  2EOE A;  2WBS A;  2JP9 A;  1P47 A;  1TN9 A;  2EOO A;  2LO3 A;  2EOX A;  2MKD A;  2YU8 A;  1ZAA C;  2VRD A;  2EMK A;  2EM5 A;  2CT1 A;  2EN2 A;  3MHH C;  2EN3 A;  4R2R A;  2PRT A;  2GLI A;  2EMB A;  1X5W A;  1YUI A;  2WCC 3;  4R2Q A;  1X6E A;  1TF6 A;  4IS1 C;  1A1I A;  2ELZ A;  1X6F A;  2RSI A;  4IJD A;  1A1L A;  1F2I G;  1RMD A;  2EMC A;  2EPA A;  2YTF A;  3VHT B;  1UBD C;  4M9V C;  2EQ1 A;  2A25 A;  2ENC A;  2YTN A;  2EN4 A;  4F2J C;  2EOM A;  4F6N A;  1WJP A;  2NAB A;  2EMZ A;  4R2S A;  1BBO A;  2YRK A;  2EOJ A;  2EPP A;  2EM9 A;  5KL4 A;  2WBU A;  2DRP A;  1X6H A;  2EM4 A;  2EOZ A;  1G2D C;  4R2A A;  1G2F C;  4R2P A;  2DGC A;  2DLK A;  2YTE A;  2EE8 A;  3EPJ A;  2EN1 A;  1JK1 A;  1YSA C;  1X3C A;  2EPR A;  2EOR A;  3EPL A;  3EPK A;  2M9A A;  2ENA A;  1A1F A;  1YUJ A;  2YTI A;  2WBT A;  2EQ0 A;  2YU5 A;  3M99 B;  4R2D A;  2CTD A;  4WSG A;  4R2C A;  2EPC A;  2ENH A;  2EQ3 A;  2DMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...