1JK1A

Zif268 d20a mutant bound to wt dna site
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
85
structure length
85
Chain Sequence
RPYACPVESCDRRFSRSAELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*CP*GP*G)-3'
publication title Rearrangement of side-chains in a Zif268 mutant highlights the complexities of zinc finger-DNA recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 26
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2001-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1jk1A02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1jk1A01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1jk1A03
4R2PA 2EOXA 2GLIA 2WBUA 2EMAA 2EMYA 2EN2A 1UBDC 1X6HA 2EQ1A 1X6EA 5KL5A 4F2JC 2EJ4A 1A1IA 1Z1BA 2CSHA 2HGHA 2EN6A 2EORA 2JPAA 1MEYC 2EMKA 2A25A 5KL4A 1X5WA 1RMDA 2DLQA 2EM2A 5KL2A 2EQ3A 2EOZA 2ENCA 2ENAA 4R2EA 2YU8A 2EM5A 2YU5A 1DGCA 2EM3A 2YTIA 2WBTA 2EL6A 1BB8A 4IJDA 2WCC3 4R2AA 2EMIA 2EOYA 2PRTA 3UK3C 2YRMA 1F2IG 2YRHA 1BBOA 2YSOA 1A1FA 2EOEA 2LT7A 2EMHA 2MKNA 2VRDA 1TN9A 2DMIA 2YTFA 2LVHA 4IS1C 2EOHA 4GZNC 2EOQA 3VHTB 1G2FC 1P47A 2EN3A 2YTDA 2MKDA 2EL5A 5KL6A 4X9JA 1YUIA 1KJKA 2EMFA 2EE8A 1B69A 2ADRA 4F6NA 2YSPA 4FK5C 2RSIA 2EMLA 1ZU1A 2YTPA 2DLKA 5KL3A 1UN6B 2EP3A 4R2DA 3MHHC 2EMWA 2EM0A 1NCSA 2EPAA 2LCEA 2GHFA 2EM4A 1ZAAC 1X6FA 2EPPA 1G2DC 2EM7A 2CT1A 2EOFA 2LO3A 1A1HA 2EOOA 5KL7A 2EMBA 3EPKA 2YTEA 2EM9A 1TF3A 2EN1A 1LLMC 2EPUA 2EMZA 2EN7A 2EQ0A 2YTOA 2EM6A 2LV2A 2NABA 4R2QA 4R2SA 2EPZA 2DGCA 4WSGA 3M99B 1TF6A 2EN8A 4R2CA 2EMCA 3EPLA 2YTJA 1A1LA 2EPRA 2YTNA 3EPJA 2R1FA 1JK1A 2EM8A 2EPCA 2EOJA 2J7JA 2EOMA 2RPCA 1A1JA 4F6MA 2M9AA 1A1KA 2I13A 1WJPA 2EOIA 2WBSA 2YTGA 1X3CA 3MHSC 2ELZA 2EMXA 1AAYA 2DRPA 4M9VC 2E72A 2CTDA 2ENHA 2ELYA 2EOSA 2MDGA 2EN4A 2EMGA 2D9HA 3EPHA 2JP9A 1A1GA 1YUJA 2YTQA 1JK2A 2EPXA 1ZR9A 1YSAC 2BB8A 4R2RA 2EL4A 2YRKA
chains in the Genus database with same CATH superfamily
3HTXA 3BIDA 5ADZA 5AE1A 3OMLA 3FIGA 2EMAA 2WBUA 2HC5A 2L2NA 4X64E 1X6HA 2EQ1A 4LF6E 2LUPB 5CFFE 1WHNA 4JI0E 4B3TE 5IXMB 2LE2A 2EMKA 1X5WA 2DLQA 5KL2A 2H36X 1KYQA 3DJWA 2EQ3A 4OOGC 4TUIA 2UXBE 2YU8A 2LJHA 1J26A 4R2AA 2PRTA 2V85A 2YWQA 2YRMA 1RQ0A 2L8TA 4GEQB 2EOEA 4M0VA 4HTGA 4O24A 2LT7A 1YPNA 1I94E 2BBGA 2LVHA 1FKAE 3J81C 5LL6R 2DSYA 3H09A 2EMFA 4LU9A 2EE8A 1PJQA 2F4VE 2ADRA 2K7IA 1IBLE 4DR6E 4P7DA 4O5GA 5LMNE 2DLKA 5KL3A 2L3CA 2EP3A 1UN6B 2EM0A 4HEIA 1XNRE 1ZAAC 4WYQB 1PJTA 2E5LE 1L4SA 2LBSB 1WRJA 5KL7A 2LTRA 2UUAE 2V88A 2EN1A 1WHQA 2L92A 4DV3E 3P1XA 5FLXC 3LMLA 4JI3E 1HR0E 3KWRA 4WPYA 2EPLX 2L2KB 3HQ1A 3M99B 1TF6A 2EN8A 5DNYA 2M1SA 3C4TA 1HNXE 3ADJA 2EM8A 3THOB 2HHHE 1A1KA 2RPCA 2I13A 1IQOA 1X3CA 2DRPA 4M9VC 4JI5E 2E72A 2ELYA 2MDGA 2EMGA 1ZBQA 1HNZE 1IQSA 1UHZA 1UILA 4MLVA 4F9CB 2KOUA 2JP9A 4DUZE 1ZR9A 1YSAC 2YRKA 1AAYA 3L00A 1ZBTA 4R2PA 2EOXA 3F6HA 4L8NA 3THNA 4DMIA 2GLIA 1O0WA 2B3TB 5A69A 3JU0A 1UBDC 1YFHA 2ZM6E 4I8OA 4JI7E 4F2JC 2JOBA 3MSWA 2EORA 2R76A 5AASA 2A25A 5KL4A 2EM2A 5A6AA 5T6JA 2NUGA 4KZSA 2FTXB 4JI8E 2B7VA 2YU5A 2EM3A 2WBTA 2EL6A 2V83A 4B3SE 4DV1E 3J7AG 1PJSA 2WCC3 1F2IG 5A6BA 1BBOA 1EH6A 4YHHE 5LLQA 4R03A 1A1FA 2EWLA 2EMHA 2MKNA 4DR2E 4F9AB 4LF8E 3VHTB 1G2FC 2MKDA 2EL5A 4DV2E 2CPNA 2JR1A 1B69A 4NXNE 4K0KE 2NA2A 3JTZA 2HJJA 3ZOQB 5TSEA 2EPAA 4DV4E 2GHFA 2EM4A 1X6FA 3IWCA 1G2DC 2EM7A 2L3JA 2RS7A 2EOFA 4RHBB 4NXME 3HPSA 4DUYE 4DKKA 3T1HE 2EMZA 3KZZA 2V87A 2EQ0A 2N3HA 2LV2A 4RH8A 1STUA 2LTSA 4TUGA 1GQEA 4R2SA 4B3RE 4WSGA 2DMYA 2UU9E 3AUZA 1AH5A 2EMCA 3EPLA 3J7Yp 4JV5E 2B7TA 3K6QA 4DR5E 2Q8UA 2VF1A 3VK6A 1A1JA 5AC5A 4F6MA 1IBME 4DR7E 4LFBE 2YTGA 2EPMX 2ELZA 2ENHA 1YYWA 2EOSA 2KONA 4ZYGA 2D9HA 4L5NC 4WSPA 1T4NA 1A1GA 1JK2A 2EPXA 1N3GA 4F54A 4O4KA 3TQMA 4M2ZA 3C6MA 1GZ6A 4Q28A 2FV4B 2EMYA 2NUEA 4N4RB 5KL5A 4B3ME 2UXCE 1A1IA 1Z1BA 3ADIA 4OX9E 3VYXA 2DIXA 1XMOE 4WFTA 4DR4E 5LMUE 1NEIA 3IWBA 4BBYA 2EOZA 1BBGA 4BCAA 2JVAA 4R2EA 1PDAA 1GTKA 2EM5A 2DB2A 2RS6A 1DGCA 2YTIA 1BB8A 2JWOA 2M7QA 3T1YE 2EOYA 2VQFE 4BMJA 3UK3C 2UUBE 2L6MA 1HNWE 1TN9A 2DMIA 4NZVA 2YTFA 4IS1C 5AC4A 4GZNC 1P47A 2EN3A 1T4OA 5KL6A 2GPIA 1SFEA 1YUIA 1YYOA 4DV0E 4FK5C 2RSIA 4ZYEA 2UXDE 2YTPA 2LUQA 2N8XA 1N36E 4O43A 3MHHC 1NCSA 4LFCE 2RSMA 1WXRA 2E1MA 2CT1A 2V86A 2LO3A 1XMQE 2MDRA 2RTXA 5IV8B 2VQEE 2I9IA 4JI2E 2EMBA 3KZYA 2YTEA 2EM9A 1TF3A 1X47A 1LLMC 2EPUA 1XNQE 3LLHA 4BHBA 3J80C 2YTOA 2EM6A 3QG5C 4X66E 2JXPA 4BHCA 2EPZA 4X65E 2EZ6A 3C6KA 4DR3E 2V8QB 2EPKX 5A6BD 1N32E 2EPRA 2YTNA 3EPJA 1T39A 2R1FA 4JI4E 2EPCA 2EOJA 1X49A 2G7HA 3OTOE 2EPNA 1WJPA 5A2QC 1YZ9A 2WBSA 4DV5E 4GKKE 3RMPA 2EMXA 3ADGA 5BR8E 1MGTA 2LRSA 2CTDA 5F3WA 1X48A 2WZOA 3EPHA 1SR9A 1FJGE 1YUJA 2YTQA 3ADLA 2BB8A 4LFAE 4R2RA 4LF4E 2EL4A 1T4LB 4X62E 4JI1E 1QNTA 2EN2A 2LMZA 1RC7A 2JOXA 4YY3E 3F6GA 3VYYA 1X6EA 2EJ4A 2CSHA 2HGHA 4GKJE 1PKPA 2EN6A 4ZYHA 2JPAA 2F8BA 1MEYC 4X8WA 1RMDA 2MC5A 4JYAE 2ENCA 2ENAA 2M4IA 4WX9A 2NUFA 2L33A 3AV0A 4LF5E 3HPZA 4IJDA 2JY9A 1N33E 3HXLA 2EMIA 1EH7A 2FGGA 2YRHA 2VE7C 2YSOA 4ZYDA 2UUCE 2VRDA 2YPNA 2EOHA 4NHRA 2EOQA 2YTDA 4X9JA 1KJKA 5IWAE 4F6NA 2YSPA 4Q35B 5A6KA 5AE2A 1EH8A 2EMLA 1ZU1A 2N3GA 1IMUA 3C4BA 4MLQA 4R2DA 1N34E 2K4VA 3BBGA 4LF9E 2EMWA 2LJUA 4M30A 4BC7A 1QU6A 2LCEA 4KWYA 4DR1E 2EPPA 4JI6E 4KHPE 2ODRD 1T38A 4P78A 1A1HA 2EOOA 4DV6E 4DV7E 5A6JA 3EQ1A 2YT4A 3EPKA 2EPOA 3BF2A 4BC9A 1YYKA 4R8OA 2EN7A 2JYAA 2KHXA 2NABA 4R2QA 4F9BB 3JAMC 2DGCA 2B9DA 2IHR1 4WXCA 4R2CA 2V89A 2YTJA 1A1LA 1JK1A 1EKZA 4J8ZA 4LTYA 2J7JA 2EOMA 2RQLA 2M9AA 5AE3A 3DF6A 1J5EE 2EOIA 3IWDA 2L2MA 3MHSC 3ECRA 4AQYE 2EN4A 4WXDA 5IT9C 1IBKE 4LF7E 1DI2A 2YZTA 2MC6A 2ODRC 4BS9A 1DQ3A 3BGHA
chains in the Genus database with same CATH topology
4R2PA 2EOXA 2GLIA 2WBUA 2EMAA 2EMYA 2EN2A 1UBDC 1X6HA 2EQ1A 1X6EA 5KL5A 4F2JC 2EJ4A 1A1IA 1Z1BA 2CSHA 2HGHA 2EN6A 2EORA 2JPAA 1MEYC 2EMKA 2A25A 5KL4A 1X5WA 1RMDA 2DLQA 2EM2A 5KL2A 2EQ3A 2EOZA 2ENCA 2ENAA 4R2EA 2YU8A 2EM5A 2YU5A 1DGCA 2EM3A 2YTIA 2WBTA 2EL6A 1BB8A 4IJDA 2WCC3 4R2AA 2EMIA 2EOYA 2PRTA 3UK3C 2YRMA 1F2IG 2YRHA 1BBOA 2YSOA 1A1FA 2EOEA 2LT7A 2EMHA 2MKNA 2VRDA 1TN9A 2DMIA 2YTFA 2LVHA 4IS1C 2EOHA 4GZNC 2EOQA 3VHTB 1G2FC 1P47A 2EN3A 2YTDA 2MKDA 2EL5A 5KL6A 4X9JA 1YUIA 1KJKA 2EMFA 2EE8A 1B69A 2ADRA 4F6NA 2YSPA 4FK5C 2RSIA 2EMLA 1ZU1A 2YTPA 2DLKA 5KL3A 1UN6B 2EP3A 4R2DA 3MHHC 2EMWA 2EM0A 1NCSA 2EPAA 2LCEA 2GHFA 2EM4A 1ZAAC 1X6FA 2EPPA 1G2DC 2EM7A 2CT1A 2EOFA 2LO3A 1A1HA 2EOOA 5KL7A 2EMBA 3EPKA 2YTEA 2EM9A 1TF3A 2EN1A 1LLMC 2EPUA 2EMZA 2EN7A 2EQ0A 2YTOA 2EM6A 2LV2A 2NABA 4R2QA 4R2SA 2EPZA 2DGCA 4WSGA 3M99B 1TF6A 2EN8A 4R2CA 2EMCA 3EPLA 2YTJA 1A1LA 2EPRA 2YTNA 3EPJA 2R1FA 1JK1A 2EM8A 2EPCA 2EOJA 2J7JA 2EOMA 2RPCA 1A1JA 4F6MA 2M9AA 1A1KA 2I13A 1WJPA 2EOIA 2WBSA 2YTGA 1X3CA 3MHSC 2ELZA 2EMXA 1AAYA 2DRPA 4M9VC 2E72A 2CTDA 2ENHA 2ELYA 2EOSA 2MDGA 2EN4A 2EMGA 2D9HA 3EPHA 2JP9A 1A1GA 1YUJA 2YTQA 1JK2A 2EPXA 1ZR9A 1YSAC 2BB8A 4R2RA 2EL4A 2YRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R2P A;  2EOX A;  2GLI A;  2WBU A;  2EMA A;  2EMY A;  2EN2 A;  1UBD C;  1X6H A;  2EQ1 A;  1X6E A;  5KL5 A;  4F2J C;  2EJ4 A;  1A1I A;  1Z1B A;  2CSH A;  2HGH A;  2EN6 A;  2EOR A;  2JPA A;  1MEY C;  2EMK A;  2A25 A;  5KL4 A;  1X5W A;  1RMD A;  2DLQ A;  2EM2 A;  5KL2 A;  2EQ3 A;  2EOZ A;  2ENC A;  2ENA A;  4R2E A;  2YU8 A;  2EM5 A;  2YU5 A;  1DGC A;  2EM3 A;  2YTI A;  2WBT A;  2EL6 A;  1BB8 A;  4IJD A;  2WCC 3;  4R2A A;  2EMI A;  2EOY A;  2PRT A;  3UK3 C;  2YRM A;  1F2I G;  2YRH A;  1BBO A;  2YSO A;  1A1F A;  2EOE A;  2LT7 A;  2EMH A;  2MKN A;  2VRD A;  1TN9 A;  2DMI A;  2YTF A;  2LVH A;  4IS1 C;  2EOH A;  4GZN C;  2EOQ A;  3VHT B;  1G2F C;  1P47 A;  2EN3 A;  2YTD A;  2MKD A;  2EL5 A;  5KL6 A;  4X9J A;  1YUI A;  1KJK A;  2EMF A;  2EE8 A;  1B69 A;  2ADR A;  4F6N A;  2YSP A;  4FK5 C;  2RSI A;  2EML A;  1ZU1 A;  2YTP A;  2DLK A;  5KL3 A;  1UN6 B;  2EP3 A;  4R2D A;  3MHH C;  2EMW A;  2EM0 A;  1NCS A;  2EPA A;  2LCE A;  2GHF A;  2EM4 A;  1ZAA C;  1X6F A;  2EPP A;  1G2D C;  2EM7 A;  2CT1 A;  2EOF A;  2LO3 A;  1A1H A;  2EOO A;  5KL7 A;  2EMB A;  3EPK A;  2YTE A;  2EM9 A;  1TF3 A;  2EN1 A;  1LLM C;  2EPU A;  2EMZ A;  2EN7 A;  2EQ0 A;  2YTO A;  2EM6 A;  2LV2 A;  2NAB A;  4R2Q A;  4R2S A;  2EPZ A;  2DGC A;  4WSG A;  3M99 B;  1TF6 A;  2EN8 A;  4R2C A;  2EMC A;  3EPL A;  2YTJ A;  1A1L A;  2EPR A;  2YTN A;  3EPJ A;  2R1F A;  1JK1 A;  2EM8 A;  2EPC A;  2EOJ A;  2J7J A;  2EOM A;  2RPC A;  1A1J A;  4F6M A;  2M9A A;  1A1K A;  2I13 A;  1WJP A;  2EOI A;  2WBS A;  2YTG A;  1X3C A;  3MHS C;  2ELZ A;  2EMX A;  1AAY A;  2DRP A;  4M9V C;  2E72 A;  2CTD A;  2ENH A;  2ELY A;  2EOS A;  2MDG A;  2EN4 A;  2EMG A;  2D9H A;  3EPH A;  2JP9 A;  1A1G A;  1YUJ A;  2YTQ A;  1JK2 A;  2EPX A;  1ZR9 A;  1YSA C;  2BB8 A;  4R2R A;  2EL4 A;  2YRK A; 
#chains in the Genus database with same CATH topology
 3HTX A;  3BID A;  5ADZ A;  5AE1 A;  3OML A;  3FIG A;  2EMA A;  2WBU A;  2HC5 A;  2L2N A;  4X64 E;  1X6H A;  2EQ1 A;  4LF6 E;  2LUP B;  5CFF E;  1WHN A;  4JI0 E;  4B3T E;  5IXM B;  2LE2 A;  2EMK A;  1X5W A;  2DLQ A;  5KL2 A;  2H36 X;  1KYQ A;  3DJW A;  2EQ3 A;  4OOG C;  4TUI A;  2UXB E;  2YU8 A;  2LJH A;  1J26 A;  4R2A A;  2PRT A;  2V85 A;  2YWQ A;  2YRM A;  1RQ0 A;  2L8T A;  4GEQ B;  2EOE A;  4M0V A;  4HTG A;  4O24 A;  2LT7 A;  1YPN A;  1I94 E;  2BBG A;  2LVH A;  1FKA E;  3J81 C;  5LL6 R;  2DSY A;  3H09 A;  2EMF A;  4LU9 A;  2EE8 A;  1PJQ A;  2F4V E;  2ADR A;  2K7I A;  1IBL E;  4DR6 E;  4P7D A;  4O5G A;  5LMN E;  2DLK A;  5KL3 A;  2L3C A;  2EP3 A;  1UN6 B;  2EM0 A;  4HEI A;  1XNR E;  1ZAA C;  4WYQ B;  1PJT A;  2E5L E;  1L4S A;  2LBS B;  1WRJ A;  5KL7 A;  2LTR A;  2UUA E;  2V88 A;  2EN1 A;  1WHQ A;  2L92 A;  4DV3 E;  3P1X A;  5FLX C;  3LML A;  4JI3 E;  1HR0 E;  3KWR A;  4WPY A;  2EPL X;  2L2K B;  3HQ1 A;  3M99 B;  1TF6 A;  2EN8 A;  5DNY A;  2M1S A;  3C4T A;  1HNX E;  3ADJ A;  2EM8 A;  3THO B;  2HHH E;  1A1K A;  2RPC A;  2I13 A;  1IQO A;  1X3C A;  2DRP A;  4M9V C;  4JI5 E;  2E72 A;  2ELY A;  2MDG A;  2EMG A;  1ZBQ A;  1HNZ E;  1IQS A;  1UHZ A;  1UIL A;  4MLV A;  4F9C B;  2KOU A;  2JP9 A;  4DUZ E;  1ZR9 A;  1YSA C;  2YRK A;  1AAY A;  3L00 A;  1ZBT A;  4R2P A;  2EOX A;  3F6H A;  4L8N A;  3THN A;  4DMI A;  2GLI A;  1O0W A;  2B3T B;  5A69 A;  3JU0 A;  1UBD C;  1YFH A;  2ZM6 E;  4I8O A;  4JI7 E;  4F2J C;  2JOB A;  3MSW A;  2EOR A;  2R76 A;  5AAS A;  2A25 A;  5KL4 A;  2EM2 A;  5A6A A;  5T6J A;  2NUG A;  4KZS A;  2FTX B;  4JI8 E;  2B7V A;  2YU5 A;  2EM3 A;  2WBT A;  2EL6 A;  2V83 A;  4B3S E;  4DV1 E;  3J7A G;  1PJS A;  2WCC 3;  1F2I G;  5A6B A;  1BBO A;  1EH6 A;  4YHH E;  5LLQ A;  4R03 A;  1A1F A;  2EWL A;  2EMH A;  2MKN A;  4DR2 E;  4F9A B;  4LF8 E;  3VHT B;  1G2F C;  2MKD A;  2EL5 A;  4DV2 E;  2CPN A;  2JR1 A;  1B69 A;  4NXN E;  4K0K E;  2NA2 A;  3JTZ A;  2HJJ A;  3ZOQ B;  5TSE A;  2EPA A;  4DV4 E;  2GHF A;  2EM4 A;  1X6F A;  3IWC A;  1G2D C;  2EM7 A;  2L3J A;  2RS7 A;  2EOF A;  4RHB B;  4NXM E;  3HPS A;  4DUY E;  4DKK A;  3T1H E;  2EMZ A;  3KZZ A;  2V87 A;  2EQ0 A;  2N3H A;  2LV2 A;  4RH8 A;  1STU A;  2LTS A;  4TUG A;  1GQE A;  4R2S A;  4B3R E;  4WSG A;  2DMY A;  2UU9 E;  3AUZ A;  1AH5 A;  2EMC A;  3EPL A;  3J7Y p;  4JV5 E;  2B7T A;  3K6Q A;  4DR5 E;  2Q8U A;  2VF1 A;  3VK6 A;  1A1J A;  5AC5 A;  4F6M A;  1IBM E;  4DR7 E;  4LFB E;  2YTG A;  2EPM X;  2ELZ A;  2ENH A;  1YYW A;  2EOS A;  2KON A;  4ZYG A;  2D9H A;  4L5N C;  4WSP A;  1T4N A;  1A1G A;  1JK2 A;  2EPX A;  1N3G A;  4F54 A;  4O4K A;  3TQM A;  4M2Z A;  3C6M A;  1GZ6 A;  4Q28 A;  2FV4 B;  2EMY A;  2NUE A;  4N4R B;  5KL5 A;  4B3M E;  2UXC E;  1A1I A;  1Z1B A;  3ADI A;  4OX9 E;  3VYX A;  2DIX A;  1XMO E;  4WFT A;  4DR4 E;  5LMU E;  1NEI A;  3IWB A;  4BBY A;  2EOZ A;  1BBG A;  4BCA A;  2JVA A;  4R2E A;  1PDA A;  1GTK A;  2EM5 A;  2DB2 A;  2RS6 A;  1DGC A;  2YTI A;  1BB8 A;  2JWO A;  2M7Q A;  3T1Y E;  2EOY A;  2VQF E;  4BMJ A;  3UK3 C;  2UUB E;  2L6M A;  1HNW E;  1TN9 A;  2DMI A;  4NZV A;  2YTF A;  4IS1 C;  5AC4 A;  4GZN C;  1P47 A;  2EN3 A;  1T4O A;  5KL6 A;  2GPI A;  1SFE A;  1YUI A;  1YYO A;  4DV0 E;  4FK5 C;  2RSI A;  4ZYE A;  2UXD E;  2YTP A;  2LUQ A;  2N8X A;  1N36 E;  4O43 A;  3MHH C;  1NCS A;  4LFC E;  2RSM A;  1WXR A;  2E1M A;  2CT1 A;  2V86 A;  2LO3 A;  1XMQ E;  2MDR A;  2RTX A;  5IV8 B;  2VQE E;  2I9I A;  4JI2 E;  2EMB A;  3KZY A;  2YTE A;  2EM9 A;  1TF3 A;  1X47 A;  1LLM C;  2EPU A;  1XNQ E;  3LLH A;  4BHB A;  3J80 C;  2YTO A;  2EM6 A;  3QG5 C;  4X66 E;  2JXP A;  4BHC A;  2EPZ A;  4X65 E;  2EZ6 A;  3C6K A;  4DR3 E;  2V8Q B;  2EPK X;  5A6B D;  1N32 E;  2EPR A;  2YTN A;  3EPJ A;  1T39 A;  2R1F A;  4JI4 E;  2EPC A;  2EOJ A;  1X49 A;  2G7H A;  3OTO E;  2EPN A;  1WJP A;  5A2Q C;  1YZ9 A;  2WBS A;  4DV5 E;  4GKK E;  3RMP A;  2EMX A;  3ADG A;  5BR8 E;  1MGT A;  2LRS A;  2CTD A;  5F3W A;  1X48 A;  2WZO A;  3EPH A;  1SR9 A;  1FJG E;  1YUJ A;  2YTQ A;  3ADL A;  2BB8 A;  4LFA E;  4R2R A;  4LF4 E;  2EL4 A;  1T4L B;  4X62 E;  4JI1 E;  1QNT A;  2EN2 A;  2LMZ A;  1RC7 A;  2JOX A;  4YY3 E;  3F6G A;  3VYY A;  1X6E A;  2EJ4 A;  2CSH A;  2HGH A;  4GKJ E;  1PKP A;  2EN6 A;  4ZYH A;  2JPA A;  2F8B A;  1MEY C;  4X8W A;  1RMD A;  2MC5 A;  4JYA E;  2ENC A;  2ENA A;  2M4I A;  4WX9 A;  2NUF A;  2L33 A;  3AV0 A;  4LF5 E;  3HPZ A;  4IJD A;  2JY9 A;  1N33 E;  3HXL A;  2EMI A;  1EH7 A;  2FGG A;  2YRH A;  2VE7 C;  2YSO A;  4ZYD A;  2UUC E;  2VRD A;  2YPN A;  2EOH A;  4NHR A;  2EOQ A;  2YTD A;  4X9J A;  1KJK A;  5IWA E;  4F6N A;  2YSP A;  4Q35 B;  5A6K A;  5AE2 A;  1EH8 A;  2EML A;  1ZU1 A;  2N3G A;  1IMU A;  3C4B A;  4MLQ A;  4R2D A;  1N34 E;  2K4V A;  3BBG A;  4LF9 E;  2EMW A;  2LJU A;  4M30 A;  4BC7 A;  1QU6 A;  2LCE A;  4KWY A;  4DR1 E;  2EPP A;  4JI6 E;  4KHP E;  2ODR D;  1T38 A;  4P78 A;  1A1H A;  2EOO A;  4DV6 E;  4DV7 E;  5A6J A;  3EQ1 A;  2YT4 A;  3EPK A;  2EPO A;  3BF2 A;  4BC9 A;  1YYK A;  4R8O A;  2EN7 A;  2JYA A;  2KHX A;  2NAB A;  4R2Q A;  4F9B B;  3JAM C;  2DGC A;  2B9D A;  2IHR 1;  4WXC A;  4R2C A;  2V89 A;  2YTJ A;  1A1L A;  1JK1 A;  1EKZ A;  4J8Z A;  4LTY A;  2J7J A;  2EOM A;  2RQL A;  2M9A A;  5AE3 A;  3DF6 A;  1J5E E;  2EOI A;  3IWD A;  2L2M A;  3MHS C;  3ECR A;  4AQY E;  2EN4 A;  4WXD A;  5IT9 C;  1IBK E;  4LF7 E;  1DI2 A;  2YZT A;  2MC6 A;  2ODR C;  4BS9 A;  1DQ3 A;  3BGH A; 
#chains in the Genus database with same CATH homology
 4R2P A;  2EOX A;  2GLI A;  2WBU A;  2EMA A;  2EMY A;  2EN2 A;  1UBD C;  1X6H A;  2EQ1 A;  1X6E A;  5KL5 A;  4F2J C;  2EJ4 A;  1A1I A;  1Z1B A;  2CSH A;  2HGH A;  2EN6 A;  2EOR A;  2JPA A;  1MEY C;  2EMK A;  2A25 A;  5KL4 A;  1X5W A;  1RMD A;  2DLQ A;  2EM2 A;  5KL2 A;  2EQ3 A;  2EOZ A;  2ENC A;  2ENA A;  4R2E A;  2YU8 A;  2EM5 A;  2YU5 A;  1DGC A;  2EM3 A;  2YTI A;  2WBT A;  2EL6 A;  1BB8 A;  4IJD A;  2WCC 3;  4R2A A;  2EMI A;  2EOY A;  2PRT A;  3UK3 C;  2YRM A;  1F2I G;  2YRH A;  1BBO A;  2YSO A;  1A1F A;  2EOE A;  2LT7 A;  2EMH A;  2MKN A;  2VRD A;  1TN9 A;  2DMI A;  2YTF A;  2LVH A;  4IS1 C;  2EOH A;  4GZN C;  2EOQ A;  3VHT B;  1G2F C;  1P47 A;  2EN3 A;  2YTD A;  2MKD A;  2EL5 A;  5KL6 A;  4X9J A;  1YUI A;  1KJK A;  2EMF A;  2EE8 A;  1B69 A;  2ADR A;  4F6N A;  2YSP A;  4FK5 C;  2RSI A;  2EML A;  1ZU1 A;  2YTP A;  2DLK A;  5KL3 A;  1UN6 B;  2EP3 A;  4R2D A;  3MHH C;  2EMW A;  2EM0 A;  1NCS A;  2EPA A;  2LCE A;  2GHF A;  2EM4 A;  1ZAA C;  1X6F A;  2EPP A;  1G2D C;  2EM7 A;  2CT1 A;  2EOF A;  2LO3 A;  1A1H A;  2EOO A;  5KL7 A;  2EMB A;  3EPK A;  2YTE A;  2EM9 A;  1TF3 A;  2EN1 A;  1LLM C;  2EPU A;  2EMZ A;  2EN7 A;  2EQ0 A;  2YTO A;  2EM6 A;  2LV2 A;  2NAB A;  4R2Q A;  4R2S A;  2EPZ A;  2DGC A;  4WSG A;  3M99 B;  1TF6 A;  2EN8 A;  4R2C A;  2EMC A;  3EPL A;  2YTJ A;  1A1L A;  2EPR A;  2YTN A;  3EPJ A;  2R1F A;  1JK1 A;  2EM8 A;  2EPC A;  2EOJ A;  2J7J A;  2EOM A;  2RPC A;  1A1J A;  4F6M A;  2M9A A;  1A1K A;  2I13 A;  1WJP A;  2EOI A;  2WBS A;  2YTG A;  1X3C A;  3MHS C;  2ELZ A;  2EMX A;  1AAY A;  2DRP A;  4M9V C;  2E72 A;  2CTD A;  2ENH A;  2ELY A;  2EOS A;  2MDG A;  2EN4 A;  2EMG A;  2D9H A;  3EPH A;  2JP9 A;  1A1G A;  1YUJ A;  2YTQ A;  1JK2 A;  2EPX A;  1ZR9 A;  1YSA C;  2BB8 A;  4R2R A;  2EL4 A;  2YRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...