1JK1A

Zif268 d20a mutant bound to wt dna site
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
85
structure length
85
Chain Sequence
RPYACPVESCDRRFSRSAELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Rearrangement of side-chains in a Zif268 mutant highlights the complexities of zinc finger-DNA recognition.
pubmed doi rcsb
molecule keywords 5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*CP*GP*G)-3'
molecule tags Transcription/dna
source organism Mus musculus
total genus 26
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2001-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1jk1A02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1jk1A01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1jk1A03
2EPRA 4R2SA 1JK2A 2EOMA 2EM3A 1TF3A 1YUJA 2DGCA 2EN3A 1F2IG 2DLKA 2YU5A 4X9JA 2ADRA 2EPAA 1BBOA 1A1HA 2A25A 2M9AA 2EMCA 5KL2A 2EP3A 2EPZA 4F2JC 2EM5A 2MKDA 1AAYA 2EN4A 2EQ1A 2RPCA 3M99B 4WSGA 2WBSA 2CTDA 3MHSC 1ZAAC 2EOFA 2EQ3A 2EMKA 2EM7A 2WCC3 4IJDA 1BB8A 2EOYA 2EM4A 2EN8A 2LO3A 4R2RA 2CSHA 2EMAA 2EMXA 1YSAC 2YSOA 5KL4A 2EOSA 2EL4A 4R2AA 4M9VC 2EJ4A 2MDGA 2I13A 2JPAA 2EPPA 1A1GA 2NABA 2EPCA 2EOEA 4FK5C 2YU8A 1MEYC 3EPKA 1ZR9A 1P47A 2MKNA 2YRKA 2GHFA 2YTFA 5KL6A 2ENAA 1X5WA 1A1KA 2EL6A 2YTDA 2LV2A 2LCEA 2LVHA 2EORA 1JK1A 2EM8A 3UK3C 2EOHA 2YTQA 2EMYA 3EPJA 2EOXA 1TN9A 2EMIA 1RMDA 2EPXA 2EM2A 4R2PA 1A1JA 1A1IA 2EM9A 1LLMC 2CT1A 4R2QA 2EOQA 2VRDA 2EQ0A 2EL5A 1NCSA 2R1FA 4IS1C 2LT7A 2EOJA 2EOIA 4GZNC 1X6EA 2DLQA 2EMGA 2EN6A 1B69A 1UN6B 2EMZA 4F6MA 2DMIA 4F6NA 2YSPA 2EN1A 2EN2A 3MHHC 1DGCA 4R2CA 2EOZA 2D9HA 2J7JA 2YTNA 5KL3A 2WBUA 2YRHA 1WJPA 3EPLA 2EMFA 2EMHA 1YUIA 2YTOA 4R2DA 2RSIA 2YTGA 2YTEA 2ELYA 2EM6A 2ELZA 2YTIA 2EE8A 2GLIA 1X6FA 2HGHA 1ZU1A 2YTJA 2ENHA 2YTPA 2DRPA 2EM0A 2JP9A 3VHTB 3EPHA 2EMLA 1Z1BA 2EOOA 2WBTA 2BB8A 2PRTA 1TF6A 1UBDC 1A1LA 5KL7A 1G2DC 2E72A 5KL5A 1KJKA 1X6HA 2EMBA 2ENCA 1G2FC 4R2EA 2YRMA 2EN7A 2EPUA 1A1FA 1X3CA 2EMWA
chains in the Genus database with same CATH superfamily
2B7TA 1XMQE 4OX9E 1XNRE 2YT4A 3ADIA 2EPKX 3AUZA 1EH7A 4KHPE 1BBOA 2KONA 1A1HA 5LL6R 2EMCA 3C6KA 4BC7A 2UXDE 1AAYA 2DSYA 2JXPA 2F4VE 1X47A 1HNZE 2HHHE 4LF8E 3MHSC 5LMNE 2EOFA 2EQ3A 2K7IA 2EM7A 2V87A 4IJDA 1ZBTA 2EM4A 1T4LB 4RHBB 2B9DA 4R2RA 2UXCE 1YSAC 2F8BA 4NZVA 2EOSA 2EJ4A 2I13A 5F3WA 2ODRD 3ZOQB 2JPAA 2EPPA 1WRJA 2V89A 1O0WA 3J80C 2N3GA 2FV4B 2YRKA 4X65E 3KZYA 2YTFA 1YYWA 4BMJA 1A1KA 1IBME 4DV3E 2EORA 1WHNA 4WPYA 2EM8A 3T1HE 4JI5E 2VQFE 2K4VA 2EMYA 1I94E 3EPJA 2LTSA 4JI0E 2LMZA 4JI1E 2V85A 4X8WA 2B3TB 2CT1A 2EQ0A 2EL5A 4WSPA 4DR5E 2DLQA 1MGTA 1UHZA 1B69A 2I9IA 1UN6B 4F6MA 4DV1E 2DMIA 1IMUA 4X66E 5A6AA 1KYQA 4R2CA 1PDAA 2D9HA 2J7JA 5KL3A 2YRHA 5ADZA 1WJPA 4R03A 4DR4E 5AC4A 3BBGA 2RSIA 3JTZA 4M30A 2ELZA 4TUIA 4BHBA 1SR9A 3J81C 1X49A 2ENHA 2V8QB 3EPHA 4DR3E 2L2MA 2WBTA 2BB8A 2RS7A 1TF6A 3LLHA 1KJKA 2EMBA 2ENCA 4RH8A 4B3SE 2EMWA 2EPRA 1T38A 2LRSA 1PJTA 2EOMA 2N8XA 2M7QA 2LBSB 3THNA 5AC5A 2DLKA 1WXRA 1YZ9A 4X9JA 1X48A 4GKKE 2JOBA 1GTKA 4N4RB 4LF6E 2EPMX 2Q8UA 2EQ1A 2RPCA 4LFBE 4WSGA 5A6JA 2WBSA 2CTDA 2VQEE 4M0VA 2YPNA 3C4TA 2EN8A 4L5NC 5CFFE 2CSHA 4O24A 2EMAA 4DV2E 2EL4A 2YWQA 4HEIA 4R2AA 4X62E 2MDGA 1FKAE 3J7AG 1YFHA 2LUPB 2NABA 3MSWA 2EOEA 4FK5C 1PKPA 2MKNA 4DR6E 2GHFA 4P78A 4DV7E 5KL6A 2H36X 4GKJE 4TUGA 2DMYA 3C6MA 4Q35B 2MDRA 3DF6A 1QU6A 2LVHA 3HXLA 2RQLA 3UK3C 5T6JA 4DUYE 2EOHA 5A69A 2YTQA 2V83A 2EOXA 4JI2E 2HJJA 4R2PA 1A1JA 4WXCA 3OMLA 2EM9A 2L3CA 2R1FA 1NCSA 4IS1C 2EN6A 1EH6A 2NA2A 4O5GA 4LFAE 3VYXA 4HTGA 2YTNA 4J8ZA 5IV8B 1GZ6A 3EPLA 1EH8A 2EMFA 2M1SA 3JU0A 2ZM6E 4YHHE 2YTOA 4O43A 4ZYEA 2YTEA 1AH5A 2YTIA 4B3ME 1SFEA 1X6FA 2JVAA 1ZU1A 2UUBE 2YTJA 2DRPA 4JI6E 5AE3A 2VF1A 4JI7E 3VHTB 1HNWE 4DR7E 2EMLA 4JI8E 2EOOA 4DV6E 3FIGA 5FLXC 2WZOA 1N3GA 4O4KA 1A1LA 2JOXA 1G2DC 2E72A 1X6HA 4BS9A 3ADGA 5TSEA 2YRMA 4JI4E 2B7VA 3HPZA 2G7HA 3F6HA 2EM3A 1WHQA 1YPNA 1TF3A 3OTOE 2DGCA 2EN3A 2YU5A 1YYKA 4F9CB 3L00A 3K6QA 4LF5E 5IXMB 2EP3A 2EPZA 4F2JC 4ZYGA 3M99B 4R8OA 4JV5E 1ZAAC 2FGGA 2NUFA 2EMKA 4BC9A 3IWDA 1PJSA 2MC6A 4WXDA 2LO3A 2EMXA 2YSOA 5KL4A 2EPLX 1J26A 3IWBA 4F9BB 4LTYA 4DKKA 5AE1A 4DR1E 2YZTA 2M4IA 3TQMA 4WFTA 1A1GA 2YU8A 1MEYC 1QNTA 3EPKA 2L6MA 1ZR9A 1P47A 3T1YE 4DR2E 5A6BA 3EQ1A 2E5LE 1BBGA 2ENAA 1X5WA 4F54A 2EL6A 1RC7A 1T4OA 2L92A 1DI2A 4YY3E 1TN9A 2EMIA 4X64E 1EKZA 4JI3E 1A1IA 4NHRA 1LLMC 2LT7A 2L2NA 1X6EA 2EMGA 5BR8E 4DV5E 2EMZA 1YYOA 3JAMC 4B3TE 1DQ3A 2EPOA 3ADJA 5DNYA 1IBLE 3MHHC 2EN2A 2UU9E 5A6BD 2L33A 1IQOA 1NEIA 2WBUA 2LTRA 4I8OA 2UUCE 2EWLA 3HQ1A 1YUIA 4NXME 2JYAA 2NUGA 4LF9E 2V86A 2EM6A 3LMLA 2JR1A 2EE8A 2JY9A 1HR0E 2EM0A 2LJHA 3KWRA 2LUQA 2ODRC 3VYYA 2L2KB 1N36E 4LU9A 2LJUA 5KL5A 1J5EE 3AV0A 1G2FC 4R2EA 4DUZE 2EPUA 1A1FA 4R2SA 1N32E 1JK2A 2E1MA 1YUJA 1L4SA 4BBYA 2CPNA 5A2QC 1F2IG 3HPSA 2ADRA 2EPAA 4KWYA 3J7Yp 3C4BA 1IQSA 2A25A 2M9AA 5KL2A 4JYAE 4K0KE 2LE2A 4NXNE 2VE7C 2IHR1 2EM5A 2MKDA 2EN4A 2RSMA 5IT9C 2KOUA 2DB2A 2MC5A 4ZYHA 2WCC3 1BB8A 4MLVA 2L3JA 2EOYA 2L8TA 1T4NA 4B3RE 4ZYDA 3F6GA 5AE2A 4DV4E 4M9VC 4AQYE 1RQ0A 1IBKE 4BCAA 4Q28A 2V88A 1FJGE 2EPCA 3H09A 5IWAE 2FTXB 4DV0E 1XMOE 3ECRA 2YTDA 2LV2A 3IWCA 2LCEA 2RS6A 1JK1A 4BHCA 3VK6A 4MLQA 4KZSA 2DIXA 2UUAE 4P7DA 2HC5A 1RMDA 2JWOA 2EPXA 2R76A 2EM2A 4LF4E 4GEQB 3ADLA 1PJQA 3THOB 4R2QA 2EOQA 2VRDA 2EOJA 2EOIA 4GZNC 1STUA 5LMUE 3KZZA 4F9AB 2KHXA 4F6NA 2YSPA 4LFCE 2EN1A 1N34E 1DGCA 2EOZA 4M2ZA 3DJWA 3P1XA 4WYQB 3QG5C 2EMHA 5A6KA 4WX9A 1XNQE 5AASA 1ZBQA 3BF2A 4R2DA 2N3HA 4OOGC 2YTGA 5LLQA 2ELYA 2RTXA 2GPIA 2GLIA 2HGHA 2UXBE 3BGHA 1N33E 1GQEA 1HNXE 2YTPA 4L8NA 2NUEA 2JP9A 2EZ6A 1Z1BA 3BIDA 4DMIA 2PRTA 1UBDC 5KL7A 2BBGA 3HTXA 4LF7E 1T39A 3RMPA 2EN7A 1UILA 1X3CA 2EPNA
chains in the Genus database with same CATH topology
2EPRA 4R2SA 1JK2A 2EOMA 2EM3A 1TF3A 1YUJA 2DGCA 2EN3A 1F2IG 2DLKA 2YU5A 4X9JA 2ADRA 2EPAA 1BBOA 1A1HA 2A25A 2M9AA 2EMCA 5KL2A 2EP3A 2EPZA 4F2JC 2EM5A 2MKDA 1AAYA 2EN4A 2EQ1A 2RPCA 3M99B 4WSGA 2WBSA 2CTDA 3MHSC 1ZAAC 2EOFA 2EQ3A 2EMKA 2EM7A 2WCC3 4IJDA 1BB8A 2EOYA 2EM4A 2EN8A 2LO3A 4R2RA 2CSHA 2EMAA 2EMXA 1YSAC 2YSOA 5KL4A 2EOSA 2EL4A 4R2AA 4M9VC 2EJ4A 2MDGA 2I13A 2JPAA 2EPPA 1A1GA 2NABA 2EPCA 2EOEA 4FK5C 2YU8A 1MEYC 3EPKA 1ZR9A 1P47A 2MKNA 2YRKA 2GHFA 2YTFA 5KL6A 2ENAA 1X5WA 1A1KA 2EL6A 2YTDA 2LV2A 2LCEA 2LVHA 2EORA 1JK1A 2EM8A 3UK3C 2EOHA 2YTQA 2EMYA 3EPJA 2EOXA 1TN9A 2EMIA 1RMDA 2EPXA 2EM2A 4R2PA 1A1JA 1A1IA 2EM9A 1LLMC 2CT1A 4R2QA 2EOQA 2VRDA 2EQ0A 2EL5A 1NCSA 2R1FA 4IS1C 2LT7A 2EOJA 2EOIA 4GZNC 1X6EA 2DLQA 2EMGA 2EN6A 1B69A 1UN6B 2EMZA 4F6MA 2DMIA 4F6NA 2YSPA 2EN1A 2EN2A 3MHHC 1DGCA 4R2CA 2EOZA 2D9HA 2J7JA 2YTNA 5KL3A 2WBUA 2YRHA 1WJPA 3EPLA 2EMFA 2EMHA 1YUIA 2YTOA 4R2DA 2RSIA 2YTGA 2YTEA 2ELYA 2EM6A 2ELZA 2YTIA 2EE8A 2GLIA 1X6FA 2HGHA 1ZU1A 2YTJA 2ENHA 2YTPA 2DRPA 2EM0A 2JP9A 3VHTB 3EPHA 2EMLA 1Z1BA 2EOOA 2WBTA 2BB8A 2PRTA 1TF6A 1UBDC 1A1LA 5KL7A 1G2DC 2E72A 5KL5A 1KJKA 1X6HA 2EMBA 2ENCA 1G2FC 4R2EA 2YRMA 2EN7A 2EPUA 1A1FA 1X3CA 2EMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EPR A;  4R2S A;  1JK2 A;  2EOM A;  2EM3 A;  1TF3 A;  1YUJ A;  2DGC A;  2EN3 A;  1F2I G;  2DLK A;  2YU5 A;  4X9J A;  2ADR A;  2EPA A;  1BBO A;  1A1H A;  2A25 A;  2M9A A;  2EMC A;  5KL2 A;  2EP3 A;  2EPZ A;  4F2J C;  2EM5 A;  2MKD A;  1AAY A;  2EN4 A;  2EQ1 A;  2RPC A;  3M99 B;  4WSG A;  2WBS A;  2CTD A;  3MHS C;  1ZAA C;  2EOF A;  2EQ3 A;  2EMK A;  2EM7 A;  2WCC 3;  4IJD A;  1BB8 A;  2EOY A;  2EM4 A;  2EN8 A;  2LO3 A;  4R2R A;  2CSH A;  2EMA A;  2EMX A;  1YSA C;  2YSO A;  5KL4 A;  2EOS A;  2EL4 A;  4R2A A;  4M9V C;  2EJ4 A;  2MDG A;  2I13 A;  2JPA A;  2EPP A;  1A1G A;  2NAB A;  2EPC A;  2EOE A;  4FK5 C;  2YU8 A;  1MEY C;  3EPK A;  1ZR9 A;  1P47 A;  2MKN A;  2YRK A;  2GHF A;  2YTF A;  5KL6 A;  2ENA A;  1X5W A;  1A1K A;  2EL6 A;  2YTD A;  2LV2 A;  2LCE A;  2LVH A;  2EOR A;  1JK1 A;  2EM8 A;  3UK3 C;  2EOH A;  2YTQ A;  2EMY A;  3EPJ A;  2EOX A;  1TN9 A;  2EMI A;  1RMD A;  2EPX A;  2EM2 A;  4R2P A;  1A1J A;  1A1I A;  2EM9 A;  1LLM C;  2CT1 A;  4R2Q A;  2EOQ A;  2VRD A;  2EQ0 A;  2EL5 A;  1NCS A;  2R1F A;  4IS1 C;  2LT7 A;  2EOJ A;  2EOI A;  4GZN C;  1X6E A;  2DLQ A;  2EMG A;  2EN6 A;  1B69 A;  1UN6 B;  2EMZ A;  4F6M A;  2DMI A;  4F6N A;  2YSP A;  2EN1 A;  2EN2 A;  3MHH C;  1DGC A;  4R2C A;  2EOZ A;  2D9H A;  2J7J A;  2YTN A;  5KL3 A;  2WBU A;  2YRH A;  1WJP A;  3EPL A;  2EMF A;  2EMH A;  1YUI A;  2YTO A;  4R2D A;  2RSI A;  2YTG A;  2YTE A;  2ELY A;  2EM6 A;  2ELZ A;  2YTI A;  2EE8 A;  2GLI A;  1X6F A;  2HGH A;  1ZU1 A;  2YTJ A;  2ENH A;  2YTP A;  2DRP A;  2EM0 A;  2JP9 A;  3VHT B;  3EPH A;  2EML A;  1Z1B A;  2EOO A;  2WBT A;  2BB8 A;  2PRT A;  1TF6 A;  1UBD C;  1A1L A;  5KL7 A;  1G2D C;  2E72 A;  5KL5 A;  1KJK A;  1X6H A;  2EMB A;  2ENC A;  1G2F C;  4R2E A;  2YRM A;  2EN7 A;  2EPU A;  1A1F A;  1X3C A;  2EMW A; 
#chains in the Genus database with same CATH topology
 2B7T A;  1XMQ E;  4OX9 E;  1XNR E;  2YT4 A;  3ADI A;  2EPK X;  3AUZ A;  1EH7 A;  4KHP E;  1BBO A;  2KON A;  1A1H A;  5LL6 R;  2EMC A;  3C6K A;  4BC7 A;  2UXD E;  1AAY A;  2DSY A;  2JXP A;  2F4V E;  1X47 A;  1HNZ E;  2HHH E;  4LF8 E;  3MHS C;  5LMN E;  2EOF A;  2EQ3 A;  2K7I A;  2EM7 A;  2V87 A;  4IJD A;  1ZBT A;  2EM4 A;  1T4L B;  4RHB B;  2B9D A;  4R2R A;  2UXC E;  1YSA C;  2F8B A;  4NZV A;  2EOS A;  2EJ4 A;  2I13 A;  5F3W A;  2ODR D;  3ZOQ B;  2JPA A;  2EPP A;  1WRJ A;  2V89 A;  1O0W A;  3J80 C;  2N3G A;  2FV4 B;  2YRK A;  4X65 E;  3KZY A;  2YTF A;  1YYW A;  4BMJ A;  1A1K A;  1IBM E;  4DV3 E;  2EOR A;  1WHN A;  4WPY A;  2EM8 A;  3T1H E;  4JI5 E;  2VQF E;  2K4V A;  2EMY A;  1I94 E;  3EPJ A;  2LTS A;  4JI0 E;  2LMZ A;  4JI1 E;  2V85 A;  4X8W A;  2B3T B;  2CT1 A;  2EQ0 A;  2EL5 A;  4WSP A;  4DR5 E;  2DLQ A;  1MGT A;  1UHZ A;  1B69 A;  2I9I A;  1UN6 B;  4F6M A;  4DV1 E;  2DMI A;  1IMU A;  4X66 E;  5A6A A;  1KYQ A;  4R2C A;  1PDA A;  2D9H A;  2J7J A;  5KL3 A;  2YRH A;  5ADZ A;  1WJP A;  4R03 A;  4DR4 E;  5AC4 A;  3BBG A;  2RSI A;  3JTZ A;  4M30 A;  2ELZ A;  4TUI A;  4BHB A;  1SR9 A;  3J81 C;  1X49 A;  2ENH A;  2V8Q B;  3EPH A;  4DR3 E;  2L2M A;  2WBT A;  2BB8 A;  2RS7 A;  1TF6 A;  3LLH A;  1KJK A;  2EMB A;  2ENC A;  4RH8 A;  4B3S E;  2EMW A;  2EPR A;  1T38 A;  2LRS A;  1PJT A;  2EOM A;  2N8X A;  2M7Q A;  2LBS B;  3THN A;  5AC5 A;  2DLK A;  1WXR A;  1YZ9 A;  4X9J A;  1X48 A;  4GKK E;  2JOB A;  1GTK A;  4N4R B;  4LF6 E;  2EPM X;  2Q8U A;  2EQ1 A;  2RPC A;  4LFB E;  4WSG A;  5A6J A;  2WBS A;  2CTD A;  2VQE E;  4M0V A;  2YPN A;  3C4T A;  2EN8 A;  4L5N C;  5CFF E;  2CSH A;  4O24 A;  2EMA A;  4DV2 E;  2EL4 A;  2YWQ A;  4HEI A;  4R2A A;  4X62 E;  2MDG A;  1FKA E;  3J7A G;  1YFH A;  2LUP B;  2NAB A;  3MSW A;  2EOE A;  4FK5 C;  1PKP A;  2MKN A;  4DR6 E;  2GHF A;  4P78 A;  4DV7 E;  5KL6 A;  2H36 X;  4GKJ E;  4TUG A;  2DMY A;  3C6M A;  4Q35 B;  2MDR A;  3DF6 A;  1QU6 A;  2LVH A;  3HXL A;  2RQL A;  3UK3 C;  5T6J A;  4DUY E;  2EOH A;  5A69 A;  2YTQ A;  2V83 A;  2EOX A;  4JI2 E;  2HJJ A;  4R2P A;  1A1J A;  4WXC A;  3OML A;  2EM9 A;  2L3C A;  2R1F A;  1NCS A;  4IS1 C;  2EN6 A;  1EH6 A;  2NA2 A;  4O5G A;  4LFA E;  3VYX A;  4HTG A;  2YTN A;  4J8Z A;  5IV8 B;  1GZ6 A;  3EPL A;  1EH8 A;  2EMF A;  2M1S A;  3JU0 A;  2ZM6 E;  4YHH E;  2YTO A;  4O43 A;  4ZYE A;  2YTE A;  1AH5 A;  2YTI A;  4B3M E;  1SFE A;  1X6F A;  2JVA A;  1ZU1 A;  2UUB E;  2YTJ A;  2DRP A;  4JI6 E;  5AE3 A;  2VF1 A;  4JI7 E;  3VHT B;  1HNW E;  4DR7 E;  2EML A;  4JI8 E;  2EOO A;  4DV6 E;  3FIG A;  5FLX C;  2WZO A;  1N3G A;  4O4K A;  1A1L A;  2JOX A;  1G2D C;  2E72 A;  1X6H A;  4BS9 A;  3ADG A;  5TSE A;  2YRM A;  4JI4 E;  2B7V A;  3HPZ A;  2G7H A;  3F6H A;  2EM3 A;  1WHQ A;  1YPN A;  1TF3 A;  3OTO E;  2DGC A;  2EN3 A;  2YU5 A;  1YYK A;  4F9C B;  3L00 A;  3K6Q A;  4LF5 E;  5IXM B;  2EP3 A;  2EPZ A;  4F2J C;  4ZYG A;  3M99 B;  4R8O A;  4JV5 E;  1ZAA C;  2FGG A;  2NUF A;  2EMK A;  4BC9 A;  3IWD A;  1PJS A;  2MC6 A;  4WXD A;  2LO3 A;  2EMX A;  2YSO A;  5KL4 A;  2EPL X;  1J26 A;  3IWB A;  4F9B B;  4LTY A;  4DKK A;  5AE1 A;  4DR1 E;  2YZT A;  2M4I A;  3TQM A;  4WFT A;  1A1G A;  2YU8 A;  1MEY C;  1QNT A;  3EPK A;  2L6M A;  1ZR9 A;  1P47 A;  3T1Y E;  4DR2 E;  5A6B A;  3EQ1 A;  2E5L E;  1BBG A;  2ENA A;  1X5W A;  4F54 A;  2EL6 A;  1RC7 A;  1T4O A;  2L92 A;  1DI2 A;  4YY3 E;  1TN9 A;  2EMI A;  4X64 E;  1EKZ A;  4JI3 E;  1A1I A;  4NHR A;  1LLM C;  2LT7 A;  2L2N A;  1X6E A;  2EMG A;  5BR8 E;  4DV5 E;  2EMZ A;  1YYO A;  3JAM C;  4B3T E;  1DQ3 A;  2EPO A;  3ADJ A;  5DNY A;  1IBL E;  3MHH C;  2EN2 A;  2UU9 E;  5A6B D;  2L33 A;  1IQO A;  1NEI A;  2WBU A;  2LTR A;  4I8O A;  2UUC E;  2EWL A;  3HQ1 A;  1YUI A;  4NXM E;  2JYA A;  2NUG A;  4LF9 E;  2V86 A;  2EM6 A;  3LML A;  2JR1 A;  2EE8 A;  2JY9 A;  1HR0 E;  2EM0 A;  2LJH A;  3KWR A;  2LUQ A;  2ODR C;  3VYY A;  2L2K B;  1N36 E;  4LU9 A;  2LJU A;  5KL5 A;  1J5E E;  3AV0 A;  1G2F C;  4R2E A;  4DUZ E;  2EPU A;  1A1F A;  4R2S A;  1N32 E;  1JK2 A;  2E1M A;  1YUJ A;  1L4S A;  4BBY A;  2CPN A;  5A2Q C;  1F2I G;  3HPS A;  2ADR A;  2EPA A;  4KWY A;  3J7Y p;  3C4B A;  1IQS A;  2A25 A;  2M9A A;  5KL2 A;  4JYA E;  4K0K E;  2LE2 A;  4NXN E;  2VE7 C;  2IHR 1;  2EM5 A;  2MKD A;  2EN4 A;  2RSM A;  5IT9 C;  2KOU A;  2DB2 A;  2MC5 A;  4ZYH A;  2WCC 3;  1BB8 A;  4MLV A;  2L3J A;  2EOY A;  2L8T A;  1T4N A;  4B3R E;  4ZYD A;  3F6G A;  5AE2 A;  4DV4 E;  4M9V C;  4AQY E;  1RQ0 A;  1IBK E;  4BCA A;  4Q28 A;  2V88 A;  1FJG E;  2EPC A;  3H09 A;  5IWA E;  2FTX B;  4DV0 E;  1XMO E;  3ECR A;  2YTD A;  2LV2 A;  3IWC A;  2LCE A;  2RS6 A;  1JK1 A;  4BHC A;  3VK6 A;  4MLQ A;  4KZS A;  2DIX A;  2UUA E;  4P7D A;  2HC5 A;  1RMD A;  2JWO A;  2EPX A;  2R76 A;  2EM2 A;  4LF4 E;  4GEQ B;  3ADL A;  1PJQ A;  3THO B;  4R2Q A;  2EOQ A;  2VRD A;  2EOJ A;  2EOI A;  4GZN C;  1STU A;  5LMU E;  3KZZ A;  4F9A B;  2KHX A;  4F6N A;  2YSP A;  4LFC E;  2EN1 A;  1N34 E;  1DGC A;  2EOZ A;  4M2Z A;  3DJW A;  3P1X A;  4WYQ B;  3QG5 C;  2EMH A;  5A6K A;  4WX9 A;  1XNQ E;  5AAS A;  1ZBQ A;  3BF2 A;  4R2D A;  2N3H A;  4OOG C;  2YTG A;  5LLQ A;  2ELY A;  2RTX A;  2GPI A;  2GLI A;  2HGH A;  2UXB E;  3BGH A;  1N33 E;  1GQE A;  1HNX E;  2YTP A;  4L8N A;  2NUE A;  2JP9 A;  2EZ6 A;  1Z1B A;  3BID A;  4DMI A;  2PRT A;  1UBD C;  5KL7 A;  2BBG A;  3HTX A;  4LF7 E;  1T39 A;  3RMP A;  2EN7 A;  1UIL A;  1X3C A;  2EPN A; 
#chains in the Genus database with same CATH homology
 2EPR A;  4R2S A;  1JK2 A;  2EOM A;  2EM3 A;  1TF3 A;  1YUJ A;  2DGC A;  2EN3 A;  1F2I G;  2DLK A;  2YU5 A;  4X9J A;  2ADR A;  2EPA A;  1BBO A;  1A1H A;  2A25 A;  2M9A A;  2EMC A;  5KL2 A;  2EP3 A;  2EPZ A;  4F2J C;  2EM5 A;  2MKD A;  1AAY A;  2EN4 A;  2EQ1 A;  2RPC A;  3M99 B;  4WSG A;  2WBS A;  2CTD A;  3MHS C;  1ZAA C;  2EOF A;  2EQ3 A;  2EMK A;  2EM7 A;  2WCC 3;  4IJD A;  1BB8 A;  2EOY A;  2EM4 A;  2EN8 A;  2LO3 A;  4R2R A;  2CSH A;  2EMA A;  2EMX A;  1YSA C;  2YSO A;  5KL4 A;  2EOS A;  2EL4 A;  4R2A A;  4M9V C;  2EJ4 A;  2MDG A;  2I13 A;  2JPA A;  2EPP A;  1A1G A;  2NAB A;  2EPC A;  2EOE A;  4FK5 C;  2YU8 A;  1MEY C;  3EPK A;  1ZR9 A;  1P47 A;  2MKN A;  2YRK A;  2GHF A;  2YTF A;  5KL6 A;  2ENA A;  1X5W A;  1A1K A;  2EL6 A;  2YTD A;  2LV2 A;  2LCE A;  2LVH A;  2EOR A;  1JK1 A;  2EM8 A;  3UK3 C;  2EOH A;  2YTQ A;  2EMY A;  3EPJ A;  2EOX A;  1TN9 A;  2EMI A;  1RMD A;  2EPX A;  2EM2 A;  4R2P A;  1A1J A;  1A1I A;  2EM9 A;  1LLM C;  2CT1 A;  4R2Q A;  2EOQ A;  2VRD A;  2EQ0 A;  2EL5 A;  1NCS A;  2R1F A;  4IS1 C;  2LT7 A;  2EOJ A;  2EOI A;  4GZN C;  1X6E A;  2DLQ A;  2EMG A;  2EN6 A;  1B69 A;  1UN6 B;  2EMZ A;  4F6M A;  2DMI A;  4F6N A;  2YSP A;  2EN1 A;  2EN2 A;  3MHH C;  1DGC A;  4R2C A;  2EOZ A;  2D9H A;  2J7J A;  2YTN A;  5KL3 A;  2WBU A;  2YRH A;  1WJP A;  3EPL A;  2EMF A;  2EMH A;  1YUI A;  2YTO A;  4R2D A;  2RSI A;  2YTG A;  2YTE A;  2ELY A;  2EM6 A;  2ELZ A;  2YTI A;  2EE8 A;  2GLI A;  1X6F A;  2HGH A;  1ZU1 A;  2YTJ A;  2ENH A;  2YTP A;  2DRP A;  2EM0 A;  2JP9 A;  3VHT B;  3EPH A;  2EML A;  1Z1B A;  2EOO A;  2WBT A;  2BB8 A;  2PRT A;  1TF6 A;  1UBD C;  1A1L A;  5KL7 A;  1G2D C;  2E72 A;  5KL5 A;  1KJK A;  1X6H A;  2EMB A;  2ENC A;  1G2F C;  4R2E A;  2YRM A;  2EN7 A;  2EPU A;  1A1F A;  1X3C A;  2EMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...