1JK1A

Zif268 d20a mutant bound to wt dna site
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
85
structure length
85
Chain Sequence
RPYACPVESCDRRFSRSAELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Rearrangement of side-chains in a Zif268 mutant highlights the complexities of zinc finger-DNA recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords 5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*CP*GP*G)-3'
total genus 26
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2001-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1jk1A02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1jk1A01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1jk1A03
4IJDA 2MKNA 2EMZA 2EN7A 4GZNC 2YTJA 2EOEA 1ZAAC 4R2PA 2EM3A 2EMFA 2EOZA 2ENAA 1YUIA 2YTQA 2MDGA 2YTEA 1X5WA 2YRHA 2CTDA 4F2JC 1G2FC 2EOYA 2EPAA 2YTPA 1X6EA 2EM9A 2EPZA 2EN4A 2EN6A 4R2QA 2EM4A 2YSOA 2EL5A 1ZU1A 1TF3A 2EQ1A 5KL5A 2EOSA 2EN1A 2YSPA 1P47A 1A1FA 2EOJA 5KL7A 2ELYA 2EMIA 2NABA 2VRDA 2EMWA 5KL4A 2CSHA 5KL6A 2M9AA 2I13A 1G2DC 2LT7A 2EORA 1X6FA 1Z1BA 3EPKA 2EM6A 2PRTA 2EM0A 2EL4A 2JP9A 2EJ4A 1JK2A 5KL2A 1MEYC 2A25A 4R2EA 2DMIA 2RSIA 2GHFA 2EMLA 2EMBA 2YTOA 1A1HA 1NCSA 2EMXA 1A1IA 2ENHA 2EQ3A 2EPRA 2YU8A 2YRKA 3EPJA 2BB8A 2EOQA 2EMKA 2EOIA 2EN2A 2EPUA 2WBTA 2EM2A 5KL3A 2YRMA 4FK5C 1F2IG 1LLMC 3EPLA 1UN6B 4R2CA 2R1FA 1X3CA 2EOFA 2YTGA 1A1LA 2LO3A 1TF6A 2ELZA 4R2RA 3M99B 1A1GA 2LV2A 2YU5A 2JPAA 1BBOA 2EN3A 1YSAC 2DRPA 2EOOA 2MKDA 2LCEA 1WJPA 1YUJA 2EQ0A 2ADRA 2RPCA 1B69A 3EPHA 2EOMA 1BB8A 2EOXA 2WCC3 2YTNA 3VHTB 2WBSA 2EM7A 4F6NA 4F6MA 1TN9A 4R2AA 3MHSC 4R2DA 3MHHC 2E72A 4M9VC 2EPXA 2EP3A 2CT1A 4WSGA 1JK1A 2YTDA 3UK3C 1KJKA 2EMHA 4R2SA 2EPCA 1A1KA 2EMCA 2DLQA 2EMAA 2EM5A 2EMYA 4X9JA 4IS1C 1DGCA 2HGHA 2J7JA 2ENCA 2DLKA 2EE8A 2EL6A 2WBUA 1AAYA 1UBDC 2YTIA 2EMGA 2EN8A 1ZR9A 2D9HA 2LVHA 1RMDA 2DGCA 2YTFA 2EM8A 1X6HA 1A1JA 2GLIA 2EOHA 2EPPA
chains in the Genus database with same CATH superfamily
4IJDA 4YHHE 3J81C 2L3JA 2JWOA 2LTRA 2NUEA 5LL6R 4BMJA 2EM3A 2EPNA 4LU9A 2EOZA 1YUIA 2BBGA 1ZBQA 1WHQA 4NHRA 2CTDA 4F2JC 4BBYA 3HPZA 1X6EA 1X49A 4DR7E 3F6HA 4JV5E 1RC7A 1YZ9A 1ZU1A 2EQ1A 5KL5A 2EOSA 5AASA 1HR0E 2L2MA 1X48A 4L5NC 2LUPB 2EOJA 2UXDE 1IBLE 2H36X 5KL6A 2LT7A 3THOB 2RQLA 1Z1BA 4K0KE 3EPKA 4HEIA 2EM6A 5CFFE 2LBSB 1SFEA 2EL4A 2K4VA 4DV4E 5IV8B 1KYQA 3OMLA 4R2EA 1A1HA 1PDAA 2EMBA 1GZ6A 1QU6A 3HXLA 2EPRA 4O24A 2YRKA 2DB2A 2EOIA 1O0WA 2EPUA 2JR1A 2WBTA 5FLXC 2EM2A 4L8NA 1N3GA 3EPLA 2L3CA 2RTXA 4WXCA 2L2KB 2YTGA 1A1LA 3L00A 2ELZA 4ZYEA 3M99B 4R2RA 1A1GA 4JI5E 1BBOA 1IBKE 1WRJA 2DRPA 3J80C 1YUJA 2EQ0A 2EOMA 2EOXA 1UHZA 4JI8E 4F6MA 5A6AA 1TN9A 3BGHA 4BHBA 4R2DA 2CPNA 2E72A 3DF6A 2FTXB 2LTSA 2LMZA 2EPXA 1JK1A 2EMHA 2VQFE 4R2SA 2M4IA 3IWBA 2DLQA 2J7JA 2ENCA 2EL6A 4OOGC 1AAYA 2N8XA 2EN8A 4LF4E 5A6KA 3H09A 2B7TA 1A1JA 4DV6E 2EPKX 3JU0A 5ADZA 2L6MA 2JXPA 2EN7A 2EOEA 5TSEA 2V83A 2E1MA 4R2PA 4DV7E 2B3TB 2UUBE 4DR2E 2YTQA 1N33E 2MDGA 3LLHA 2N3GA 2EPAA 2UUCE 2EWLA 2EPZA 4DV5E 4ZYHA 2EL5A 1TF3A 1T4OA 1EH7A 2EN1A 2YSPA 1P47A 1A1FA 5A6JA 2ELYA 2EMIA 3T1HE 5A6BD 3DJWA 1J5EE 2ZM6E 2LJHA 2EORA 3ADIA 1PJTA 2PRTA 4DV3E 2EM0A 5A2QC 2JP9A 2N3HA 4DUZE 5AE2A 2A25A 4GEQB 2DSYA 3IWCA 2RSIA 1T38A 2GHFA 2YTOA 4BC7A 3C6KA 1X47A 2LE2A 2EN2A 5A6BA 5A69A 5KL3A 2ODRD 1F2IG 2LUQA 4MLVA 4DKKA 2EOFA 4O43A 2LV2A 2KONA 2YU5A 4TUGA 5IXMB 1YYKA 2LCEA 4JI3E 1WJPA 1NEIA 2VQEE 5LMNE 1WXRA 2LRSA 5DNYA 4LF6E 1XNRE 3J7AG 3MHHC 4O5GA 1XMQE 2UXBE 4WSGA 2V87A 4LFCE 4Q35B 2NUFA 1KJKA 3OTOE 4DV2E 4KHPE 2EMAA 4IS1C 3VYYA 3BIDA 1PJSA 1UBDC 2YTIA 1EH8A 4OX9E 4GKKE 2DGCA 4R8OA 4LFAE 4RHBB 2EPOA 4ZYGA 1PJQA 4O4KA 4JI7E 2EPPA 3ZOQB 3HQ1A 1FJGE 4M30A 3QG5C 2HHHE 4ZYDA 3TQMA 2MC5A 2ENAA 2HC5A 1N36E 3BF2A 4R03A 3THNA 1XNQE 1X5WA 2YRHA 2EOYA 2EM9A 4NXNE 4B3RE 2EN4A 4F9BB 4R2QA 4BC9A 2YSOA 2M1SA 1HNWE 4P7DA 2V88A 2E5LE 2JY9A 5KL7A 4J8ZA 1MGTA 2NABA 2NUGA 2EMWA 3K6QA 5KL4A 2L33A 2DMYA 4F9CB 2KOUA 2KHXA 1EH6A 3ADLA 2EJ4A 3FIGA 1T39A 1RQ0A 5KL2A 1MEYC 4Q28A 4JI6E 4WSPA 1L4SA 2DMIA 4BHCA 4BCAA 4X65E 4DR3E 1NCSA 2EMXA 2Q8UA 1WHNA 2ENHA 2EQ3A 2EPMX 3ADJA 1EKZA 4P78A 2YU8A 4F9AB 5AE3A 2BB8A 3VK6A 2EOQA 3EPJA 2YRMA 1XMOE 4FK5C 1IMUA 1LLMC 3AUZA 4GKJE 4R2CA 4DR6E 1DQ3A 2R1FA 2IHR1 2VE7C 4X64E 2B7VA 5AE1A 1T4LB 2I9IA 3C4BA 1YSAC 2EOOA 2MKDA 4LF8E 1YPNA 5T6JA 3MSWA 3JAMC 2YWQA 4DV0E 2WCC3 2YTNA 2WBSA 4LF7E 2M7QA 2EM7A 2ODRC 4F6NA 2EZ6A 1T4NA 2JYAA 3IWDA 3C4TA 4R2AA 3MHSC 4X8WA 2GPIA 4KWYA 4M9VC 1BBGA 2UUAE 2EP3A 2V86A 2L92A 3UK3C 2YT4A 2EPCA 1A1KA 2F8BA 2EMCA 2EMYA 3HPSA 1DGCA 4N4RB 2JOXA 2EE8A 2MDRA 1ZBTA 1HNZE 2WBUA 1I94E 2RSMA 2EMGA 2R76A 1PKPA 1GTKA 3ECRA 2LVHA 4I8OA 2YTFA 4JI1E 1X6HA 2YZTA 2GLIA 2NA2A 2V85A 2EOHA 1IQSA 3F6GA 1YYWA 2MKNA 2EMZA 4GZNC 2RS7A 2YTJA 4X62E 5AC4A 4B3TE 4NXME 4X66E 1ZAAC 1QNTA 2EMFA 3KZZA 2HJJA 2JVAA 2G7HA 4NZVA 4WFTA 5IWAE 2YTEA 3HTXA 1G2FC 2F4VE 4LFBE 2YTPA 1N34E 3VYXA 2L2NA 2EN6A 2EM4A 2MC6A 1IBME 4LTYA 3EQ1A 1GQEA 3P1XA 4TUIA 3AV0A 2VRDA 2FV4B 2CSHA 4WPYA 2DIXA 2M9AA 2I13A 1G2DC 1X6FA 3KZYA 4B3ME 1N32E 4DR1E 4F54A 5BR8E 3J7Yp 1JK2A 4DV1E 5IT9C 5F3WA 2EMLA 2VF1A 1A1IA 3RMPA 4M2ZA 3KWRA 1HNXE 4M0VA 4LF5E 2EMKA 4JI4E 4DR4E 2YPNA 4BS9A 4WYQB 1YFHA 1UN6B 4RH8A 4KZSA 1X3CA 4B3SE 2LO3A 1TF6A 3LMLA 1AH5A 5LLQA 1FKAE 2WZOA 4HTGA 4WXDA 2JPAA 2EN3A 2L8TA 2RS6A 2ADRA 1STUA 4WX9A 2RPCA 3EPHA 1DI2A 1BB8A 1UILA 4JYAE 4DMIA 3VHTB 2UU9E 3JTZA 2EPLX 2UXCE 4YY3E 3C6MA 4AQYE 2CT1A 2V8QB 2FGGA 2YTDA 4DR5E 4JI0E 2LJUA 2K7IA 4X9JA 2EM5A 2HGHA 5AC5A 2DLKA 1J26A 2JOBA 5LMUE 1IQOA 4MLQA 1ZR9A 3BBGA 2D9HA 2V89A 1RMDA 2EM8A 4DUYE 3ADGA 1YYOA 3T1YE 1SR9A 4JI2E 2B9DA 1B69A 4LF9E
chains in the Genus database with same CATH topology
4IJDA 2MKNA 2EMZA 2EN7A 4GZNC 2YTJA 2EOEA 1ZAAC 4R2PA 2EM3A 2EMFA 2EOZA 2ENAA 1YUIA 2YTQA 2MDGA 2YTEA 1X5WA 2YRHA 2CTDA 4F2JC 1G2FC 2EOYA 2EPAA 2YTPA 1X6EA 2EM9A 2EPZA 2EN4A 2EN6A 4R2QA 2EM4A 2YSOA 2EL5A 1ZU1A 1TF3A 2EQ1A 5KL5A 2EOSA 2EN1A 2YSPA 1P47A 1A1FA 2EOJA 5KL7A 2ELYA 2EMIA 2NABA 2VRDA 2EMWA 5KL4A 2CSHA 5KL6A 2M9AA 2I13A 1G2DC 2LT7A 2EORA 1X6FA 1Z1BA 3EPKA 2EM6A 2PRTA 2EM0A 2EL4A 2JP9A 2EJ4A 1JK2A 5KL2A 1MEYC 2A25A 4R2EA 2DMIA 2RSIA 2GHFA 2EMLA 2EMBA 2YTOA 1A1HA 1NCSA 2EMXA 1A1IA 2ENHA 2EQ3A 2EPRA 2YU8A 2YRKA 3EPJA 2BB8A 2EOQA 2EMKA 2EOIA 2EN2A 2EPUA 2WBTA 2EM2A 5KL3A 2YRMA 4FK5C 1F2IG 1LLMC 3EPLA 1UN6B 4R2CA 2R1FA 1X3CA 2EOFA 2YTGA 1A1LA 2LO3A 1TF6A 2ELZA 4R2RA 3M99B 1A1GA 2LV2A 2YU5A 2JPAA 1BBOA 2EN3A 1YSAC 2DRPA 2EOOA 2MKDA 2LCEA 1WJPA 1YUJA 2EQ0A 2ADRA 2RPCA 1B69A 3EPHA 2EOMA 1BB8A 2EOXA 2WCC3 2YTNA 3VHTB 2WBSA 2EM7A 4F6NA 4F6MA 1TN9A 4R2AA 3MHSC 4R2DA 3MHHC 2E72A 4M9VC 2EPXA 2EP3A 2CT1A 4WSGA 1JK1A 2YTDA 3UK3C 1KJKA 2EMHA 4R2SA 2EPCA 1A1KA 2EMCA 2DLQA 2EMAA 2EM5A 2EMYA 4X9JA 4IS1C 1DGCA 2HGHA 2J7JA 2ENCA 2DLKA 2EE8A 2EL6A 2WBUA 1AAYA 1UBDC 2YTIA 2EMGA 2EN8A 1ZR9A 2D9HA 2LVHA 1RMDA 2DGCA 2YTFA 2EM8A 1X6HA 1A1JA 2GLIA 2EOHA 2EPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJD A;  2MKN A;  2EMZ A;  2EN7 A;  4GZN C;  2YTJ A;  2EOE A;  1ZAA C;  4R2P A;  2EM3 A;  2EMF A;  2EOZ A;  2ENA A;  1YUI A;  2YTQ A;  2MDG A;  2YTE A;  1X5W A;  2YRH A;  2CTD A;  4F2J C;  1G2F C;  2EOY A;  2EPA A;  2YTP A;  1X6E A;  2EM9 A;  2EPZ A;  2EN4 A;  2EN6 A;  4R2Q A;  2EM4 A;  2YSO A;  2EL5 A;  1ZU1 A;  1TF3 A;  2EQ1 A;  5KL5 A;  2EOS A;  2EN1 A;  2YSP A;  1P47 A;  1A1F A;  2EOJ A;  5KL7 A;  2ELY A;  2EMI A;  2NAB A;  2VRD A;  2EMW A;  5KL4 A;  2CSH A;  5KL6 A;  2M9A A;  2I13 A;  1G2D C;  2LT7 A;  2EOR A;  1X6F A;  1Z1B A;  3EPK A;  2EM6 A;  2PRT A;  2EM0 A;  2EL4 A;  2JP9 A;  2EJ4 A;  1JK2 A;  5KL2 A;  1MEY C;  2A25 A;  4R2E A;  2DMI A;  2RSI A;  2GHF A;  2EML A;  2EMB A;  2YTO A;  1A1H A;  1NCS A;  2EMX A;  1A1I A;  2ENH A;  2EQ3 A;  2EPR A;  2YU8 A;  2YRK A;  3EPJ A;  2BB8 A;  2EOQ A;  2EMK A;  2EOI A;  2EN2 A;  2EPU A;  2WBT A;  2EM2 A;  5KL3 A;  2YRM A;  4FK5 C;  1F2I G;  1LLM C;  3EPL A;  1UN6 B;  4R2C A;  2R1F A;  1X3C A;  2EOF A;  2YTG A;  1A1L A;  2LO3 A;  1TF6 A;  2ELZ A;  4R2R A;  3M99 B;  1A1G A;  2LV2 A;  2YU5 A;  2JPA A;  1BBO A;  2EN3 A;  1YSA C;  2DRP A;  2EOO A;  2MKD A;  2LCE A;  1WJP A;  1YUJ A;  2EQ0 A;  2ADR A;  2RPC A;  1B69 A;  3EPH A;  2EOM A;  1BB8 A;  2EOX A;  2WCC 3;  2YTN A;  3VHT B;  2WBS A;  2EM7 A;  4F6N A;  4F6M A;  1TN9 A;  4R2A A;  3MHS C;  4R2D A;  3MHH C;  2E72 A;  4M9V C;  2EPX A;  2EP3 A;  2CT1 A;  4WSG A;  1JK1 A;  2YTD A;  3UK3 C;  1KJK A;  2EMH A;  4R2S A;  2EPC A;  1A1K A;  2EMC A;  2DLQ A;  2EMA A;  2EM5 A;  2EMY A;  4X9J A;  4IS1 C;  1DGC A;  2HGH A;  2J7J A;  2ENC A;  2DLK A;  2EE8 A;  2EL6 A;  2WBU A;  1AAY A;  1UBD C;  2YTI A;  2EMG A;  2EN8 A;  1ZR9 A;  2D9H A;  2LVH A;  1RMD A;  2DGC A;  2YTF A;  2EM8 A;  1X6H A;  1A1J A;  2GLI A;  2EOH A;  2EPP A; 
#chains in the Genus database with same CATH topology
 4IJD A;  4YHH E;  3J81 C;  2L3J A;  2JWO A;  2LTR A;  2NUE A;  5LL6 R;  4BMJ A;  2EM3 A;  2EPN A;  4LU9 A;  2EOZ A;  1YUI A;  2BBG A;  1ZBQ A;  1WHQ A;  4NHR A;  2CTD A;  4F2J C;  4BBY A;  3HPZ A;  1X6E A;  1X49 A;  4DR7 E;  3F6H A;  4JV5 E;  1RC7 A;  1YZ9 A;  1ZU1 A;  2EQ1 A;  5KL5 A;  2EOS A;  5AAS A;  1HR0 E;  2L2M A;  1X48 A;  4L5N C;  2LUP B;  2EOJ A;  2UXD E;  1IBL E;  2H36 X;  5KL6 A;  2LT7 A;  3THO B;  2RQL A;  1Z1B A;  4K0K E;  3EPK A;  4HEI A;  2EM6 A;  5CFF E;  2LBS B;  1SFE A;  2EL4 A;  2K4V A;  4DV4 E;  5IV8 B;  1KYQ A;  3OML A;  4R2E A;  1A1H A;  1PDA A;  2EMB A;  1GZ6 A;  1QU6 A;  3HXL A;  2EPR A;  4O24 A;  2YRK A;  2DB2 A;  2EOI A;  1O0W A;  2EPU A;  2JR1 A;  2WBT A;  5FLX C;  2EM2 A;  4L8N A;  1N3G A;  3EPL A;  2L3C A;  2RTX A;  4WXC A;  2L2K B;  2YTG A;  1A1L A;  3L00 A;  2ELZ A;  4ZYE A;  3M99 B;  4R2R A;  1A1G A;  4JI5 E;  1BBO A;  1IBK E;  1WRJ A;  2DRP A;  3J80 C;  1YUJ A;  2EQ0 A;  2EOM A;  2EOX A;  1UHZ A;  4JI8 E;  4F6M A;  5A6A A;  1TN9 A;  3BGH A;  4BHB A;  4R2D A;  2CPN A;  2E72 A;  3DF6 A;  2FTX B;  2LTS A;  2LMZ A;  2EPX A;  1JK1 A;  2EMH A;  2VQF E;  4R2S A;  2M4I A;  3IWB A;  2DLQ A;  2J7J A;  2ENC A;  2EL6 A;  4OOG C;  1AAY A;  2N8X A;  2EN8 A;  4LF4 E;  5A6K A;  3H09 A;  2B7T A;  1A1J A;  4DV6 E;  2EPK X;  3JU0 A;  5ADZ A;  2L6M A;  2JXP A;  2EN7 A;  2EOE A;  5TSE A;  2V83 A;  2E1M A;  4R2P A;  4DV7 E;  2B3T B;  2UUB E;  4DR2 E;  2YTQ A;  1N33 E;  2MDG A;  3LLH A;  2N3G A;  2EPA A;  2UUC E;  2EWL A;  2EPZ A;  4DV5 E;  4ZYH A;  2EL5 A;  1TF3 A;  1T4O A;  1EH7 A;  2EN1 A;  2YSP A;  1P47 A;  1A1F A;  5A6J A;  2ELY A;  2EMI A;  3T1H E;  5A6B D;  3DJW A;  1J5E E;  2ZM6 E;  2LJH A;  2EOR A;  3ADI A;  1PJT A;  2PRT A;  4DV3 E;  2EM0 A;  5A2Q C;  2JP9 A;  2N3H A;  4DUZ E;  5AE2 A;  2A25 A;  4GEQ B;  2DSY A;  3IWC A;  2RSI A;  1T38 A;  2GHF A;  2YTO A;  4BC7 A;  3C6K A;  1X47 A;  2LE2 A;  2EN2 A;  5A6B A;  5A69 A;  5KL3 A;  2ODR D;  1F2I G;  2LUQ A;  4MLV A;  4DKK A;  2EOF A;  4O43 A;  2LV2 A;  2KON A;  2YU5 A;  4TUG A;  5IXM B;  1YYK A;  2LCE A;  4JI3 E;  1WJP A;  1NEI A;  2VQE E;  5LMN E;  1WXR A;  2LRS A;  5DNY A;  4LF6 E;  1XNR E;  3J7A G;  3MHH C;  4O5G A;  1XMQ E;  2UXB E;  4WSG A;  2V87 A;  4LFC E;  4Q35 B;  2NUF A;  1KJK A;  3OTO E;  4DV2 E;  4KHP E;  2EMA A;  4IS1 C;  3VYY A;  3BID A;  1PJS A;  1UBD C;  2YTI A;  1EH8 A;  4OX9 E;  4GKK E;  2DGC A;  4R8O A;  4LFA E;  4RHB B;  2EPO A;  4ZYG A;  1PJQ A;  4O4K A;  4JI7 E;  2EPP A;  3ZOQ B;  3HQ1 A;  1FJG E;  4M30 A;  3QG5 C;  2HHH E;  4ZYD A;  3TQM A;  2MC5 A;  2ENA A;  2HC5 A;  1N36 E;  3BF2 A;  4R03 A;  3THN A;  1XNQ E;  1X5W A;  2YRH A;  2EOY A;  2EM9 A;  4NXN E;  4B3R E;  2EN4 A;  4F9B B;  4R2Q A;  4BC9 A;  2YSO A;  2M1S A;  1HNW E;  4P7D A;  2V88 A;  2E5L E;  2JY9 A;  5KL7 A;  4J8Z A;  1MGT A;  2NAB A;  2NUG A;  2EMW A;  3K6Q A;  5KL4 A;  2L33 A;  2DMY A;  4F9C B;  2KOU A;  2KHX A;  1EH6 A;  3ADL A;  2EJ4 A;  3FIG A;  1T39 A;  1RQ0 A;  5KL2 A;  1MEY C;  4Q28 A;  4JI6 E;  4WSP A;  1L4S A;  2DMI A;  4BHC A;  4BCA A;  4X65 E;  4DR3 E;  1NCS A;  2EMX A;  2Q8U A;  1WHN A;  2ENH A;  2EQ3 A;  2EPM X;  3ADJ A;  1EKZ A;  4P78 A;  2YU8 A;  4F9A B;  5AE3 A;  2BB8 A;  3VK6 A;  2EOQ A;  3EPJ A;  2YRM A;  1XMO E;  4FK5 C;  1IMU A;  1LLM C;  3AUZ A;  4GKJ E;  4R2C A;  4DR6 E;  1DQ3 A;  2R1F A;  2IHR 1;  2VE7 C;  4X64 E;  2B7V A;  5AE1 A;  1T4L B;  2I9I A;  3C4B A;  1YSA C;  2EOO A;  2MKD A;  4LF8 E;  1YPN A;  5T6J A;  3MSW A;  3JAM C;  2YWQ A;  4DV0 E;  2WCC 3;  2YTN A;  2WBS A;  4LF7 E;  2M7Q A;  2EM7 A;  2ODR C;  4F6N A;  2EZ6 A;  1T4N A;  2JYA A;  3IWD A;  3C4T A;  4R2A A;  3MHS C;  4X8W A;  2GPI A;  4KWY A;  4M9V C;  1BBG A;  2UUA E;  2EP3 A;  2V86 A;  2L92 A;  3UK3 C;  2YT4 A;  2EPC A;  1A1K A;  2F8B A;  2EMC A;  2EMY A;  3HPS A;  1DGC A;  4N4R B;  2JOX A;  2EE8 A;  2MDR A;  1ZBT A;  1HNZ E;  2WBU A;  1I94 E;  2RSM A;  2EMG A;  2R76 A;  1PKP A;  1GTK A;  3ECR A;  2LVH A;  4I8O A;  2YTF A;  4JI1 E;  1X6H A;  2YZT A;  2GLI A;  2NA2 A;  2V85 A;  2EOH A;  1IQS A;  3F6G A;  1YYW A;  2MKN A;  2EMZ A;  4GZN C;  2RS7 A;  2YTJ A;  4X62 E;  5AC4 A;  4B3T E;  4NXM E;  4X66 E;  1ZAA C;  1QNT A;  2EMF A;  3KZZ A;  2HJJ A;  2JVA A;  2G7H A;  4NZV A;  4WFT A;  5IWA E;  2YTE A;  3HTX A;  1G2F C;  2F4V E;  4LFB E;  2YTP A;  1N34 E;  3VYX A;  2L2N A;  2EN6 A;  2EM4 A;  2MC6 A;  1IBM E;  4LTY A;  3EQ1 A;  1GQE A;  3P1X A;  4TUI A;  3AV0 A;  2VRD A;  2FV4 B;  2CSH A;  4WPY A;  2DIX A;  2M9A A;  2I13 A;  1G2D C;  1X6F A;  3KZY A;  4B3M E;  1N32 E;  4DR1 E;  4F54 A;  5BR8 E;  3J7Y p;  1JK2 A;  4DV1 E;  5IT9 C;  5F3W A;  2EML A;  2VF1 A;  1A1I A;  3RMP A;  4M2Z A;  3KWR A;  1HNX E;  4M0V A;  4LF5 E;  2EMK A;  4JI4 E;  4DR4 E;  2YPN A;  4BS9 A;  4WYQ B;  1YFH A;  1UN6 B;  4RH8 A;  4KZS A;  1X3C A;  4B3S E;  2LO3 A;  1TF6 A;  3LML A;  1AH5 A;  5LLQ A;  1FKA E;  2WZO A;  4HTG A;  4WXD A;  2JPA A;  2EN3 A;  2L8T A;  2RS6 A;  2ADR A;  1STU A;  4WX9 A;  2RPC A;  3EPH A;  1DI2 A;  1BB8 A;  1UIL A;  4JYA E;  4DMI A;  3VHT B;  2UU9 E;  3JTZ A;  2EPL X;  2UXC E;  4YY3 E;  3C6M A;  4AQY E;  2CT1 A;  2V8Q B;  2FGG A;  2YTD A;  4DR5 E;  4JI0 E;  2LJU A;  2K7I A;  4X9J A;  2EM5 A;  2HGH A;  5AC5 A;  2DLK A;  1J26 A;  2JOB A;  5LMU E;  1IQO A;  4MLQ A;  1ZR9 A;  3BBG A;  2D9H A;  2V89 A;  1RMD A;  2EM8 A;  4DUY E;  3ADG A;  1YYO A;  3T1Y E;  1SR9 A;  4JI2 E;  2B9D A;  1B69 A;  4LF9 E; 
#chains in the Genus database with same CATH homology
 4IJD A;  2MKN A;  2EMZ A;  2EN7 A;  4GZN C;  2YTJ A;  2EOE A;  1ZAA C;  4R2P A;  2EM3 A;  2EMF A;  2EOZ A;  2ENA A;  1YUI A;  2YTQ A;  2MDG A;  2YTE A;  1X5W A;  2YRH A;  2CTD A;  4F2J C;  1G2F C;  2EOY A;  2EPA A;  2YTP A;  1X6E A;  2EM9 A;  2EPZ A;  2EN4 A;  2EN6 A;  4R2Q A;  2EM4 A;  2YSO A;  2EL5 A;  1ZU1 A;  1TF3 A;  2EQ1 A;  5KL5 A;  2EOS A;  2EN1 A;  2YSP A;  1P47 A;  1A1F A;  2EOJ A;  5KL7 A;  2ELY A;  2EMI A;  2NAB A;  2VRD A;  2EMW A;  5KL4 A;  2CSH A;  5KL6 A;  2M9A A;  2I13 A;  1G2D C;  2LT7 A;  2EOR A;  1X6F A;  1Z1B A;  3EPK A;  2EM6 A;  2PRT A;  2EM0 A;  2EL4 A;  2JP9 A;  2EJ4 A;  1JK2 A;  5KL2 A;  1MEY C;  2A25 A;  4R2E A;  2DMI A;  2RSI A;  2GHF A;  2EML A;  2EMB A;  2YTO A;  1A1H A;  1NCS A;  2EMX A;  1A1I A;  2ENH A;  2EQ3 A;  2EPR A;  2YU8 A;  2YRK A;  3EPJ A;  2BB8 A;  2EOQ A;  2EMK A;  2EOI A;  2EN2 A;  2EPU A;  2WBT A;  2EM2 A;  5KL3 A;  2YRM A;  4FK5 C;  1F2I G;  1LLM C;  3EPL A;  1UN6 B;  4R2C A;  2R1F A;  1X3C A;  2EOF A;  2YTG A;  1A1L A;  2LO3 A;  1TF6 A;  2ELZ A;  4R2R A;  3M99 B;  1A1G A;  2LV2 A;  2YU5 A;  2JPA A;  1BBO A;  2EN3 A;  1YSA C;  2DRP A;  2EOO A;  2MKD A;  2LCE A;  1WJP A;  1YUJ A;  2EQ0 A;  2ADR A;  2RPC A;  1B69 A;  3EPH A;  2EOM A;  1BB8 A;  2EOX A;  2WCC 3;  2YTN A;  3VHT B;  2WBS A;  2EM7 A;  4F6N A;  4F6M A;  1TN9 A;  4R2A A;  3MHS C;  4R2D A;  3MHH C;  2E72 A;  4M9V C;  2EPX A;  2EP3 A;  2CT1 A;  4WSG A;  1JK1 A;  2YTD A;  3UK3 C;  1KJK A;  2EMH A;  4R2S A;  2EPC A;  1A1K A;  2EMC A;  2DLQ A;  2EMA A;  2EM5 A;  2EMY A;  4X9J A;  4IS1 C;  1DGC A;  2HGH A;  2J7J A;  2ENC A;  2DLK A;  2EE8 A;  2EL6 A;  2WBU A;  1AAY A;  1UBD C;  2YTI A;  2EMG A;  2EN8 A;  1ZR9 A;  2D9H A;  2LVH A;  1RMD A;  2DGC A;  2YTF A;  2EM8 A;  1X6H A;  1A1J A;  2GLI A;  2EOH A;  2EPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...