2EQ0A

Solution structure of the 8th c2h2 type zinc finger domain of zinc finger protein 347
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYKCHECGKVFRRNSHLARHQLIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the 8th C2H2 type zinc finger domain of Zinc finger protein 347
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords Zinc finger protein 347
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eq0A01
2EMAA 2BB8A 4R2PA 2EOZA 2EQ1A 4IJDA 2EN8A 1JK1A 2EN4A 1YSAC 2EM5A 1B69A 1ZR9A 2EL6A 2ENCA 2EM8A 2YSOA 1P47A 2EM9A 4R2AA 2JP9A 2EM4A 2I13A 1X3CA 1BBOA 2EMFA 2HGHA 1A1HA 1TF6A 2EOJA 1ZU1A 2MDGA 2DLQA 4WSGA 2CSHA 1X6HA 2EMBA 2LV2A 1TF3A 2LO3A 2EN7A 2WBTA 1A1IA 1YUJA 2R1FA 2EOOA 2EOIA 2EE8A 1BB8A 2CTDA 2YU8A 2YTJA 2PRTA 2EM6A 2EPRA 2EN6A 1UBDC 3UK3C 2WCC3 2YRKA 2YU5A 4F6NA 2EOFA 5KL4A 1A1JA 3MHHC 2DRPA 2EMGA 1DGCA 2EMZA 2ELZA 1UN6B 4F2JC 1X5WA 2EMLA 2J7JA 2EMHA 2YTOA 4M9VC 1ZAAC 2ADRA 2EL4A 4X9JA 2EN3A 2GLIA 4R2SA 2DGCA 1G2FC 4R2QA 3EPJA 2EPCA 2MKNA 2ENHA 2YSPA 2YTIA 5KL6A 2EM0A 2EMWA 2EMXA 1AAYA 2EPPA 1G2DC 4R2EA 2EQ0A 2EPAA 2WBUA 2EL5A 1KJKA 3MHSC 2EPXA 2JPAA 2LCEA 2ENAA 5KL2A 2YTDA 4R2RA 2YTQA 3M99B 2GHFA 2YTFA 2EOXA 2EORA 3EPKA 4FK5C 2YRMA 4F6MA 2M9AA 2EQ3A 4IS1C 2YTGA 1A1KA 1A1FA 1LLMC 2EOHA 2LT7A 2EMKA 1TN9A 5KL7A 2RSIA 2E72A 2EM3A 3VHTB 2LVHA 2ELYA 1X6FA 2EMCA 2EOYA 1RMDA 2EMIA 2YTPA 2EM7A 2YTEA 2MKDA 5KL3A 2CT1A 2D9HA 1F2IG 3EPLA 1YUIA 2EPUA 1Z1BA 2DLKA 1MEYC 2A25A 2EMYA 2EN2A 1X6EA 2EPZA 2NABA 4R2DA 3EPHA 4R2CA 2WBSA 2EOQA 2EOEA 2YTNA 2EJ4A 2RPCA 2VRDA 4GZNC 2EN1A 2EOMA 1A1LA 1NCSA 2EOSA 1A1GA 1WJPA 2DMIA 5KL5A 2EP3A 1JK2A 2YRHA 2EM2A
chains in the Genus database with same CATH superfamily
4BCAA 1GQEA 2HC5A 2EQ1A 2JY9A 3T1YE 4BC9A 2L3JA 4JI5E 1T38A 2YSOA 3C6KA 4R2AA 2LJUA 2EM4A 2I13A 1HNWE 2L33A 5A6KA 2GPIA 4DMIA 2JWOA 2EWLA 1IQOA 2EMBA 2LV2A 2EPKX 2WBTA 1QNTA 3J80C 1A1IA 4LF4E 4LF7E 1YUJA 5ADZA 4M2ZA 2NUEA 1UHZA 2EOOA 2EOIA 1N33E 1WHQA 4B3SE 2EPRA 2VE7C 3KWRA 1NEIA 1EH7A 2NUFA 2YRKA 2YWQA 4RH8A 4LF8E 3THNA 2DRPA 2EMZA 3DJWA 1UN6B 1X5WA 2M7QA 2YTOA 4JI2E 2DGCA 1G2FC 3TQMA 3EPJA 2HJJA 2EPCA 3P1XA 1AAYA 2EMXA 1RC7A 3ZOQB 1WHNA 1G2DC 4JI3E 2EQ0A 2WBUA 2L3CA 4DR6E 1WXRA 1ZBQA 4KHPE 5KL2A 1QU6A 2JOBA 4LFCE 4I8OA 4J8ZA 4K0KE 2YTQA 2GHFA 1X47A 5AE3A 2KOUA 2EORA 4F6MA 3JAMC 4HEIA 2EQ3A 1A1KA 4ZYHA 1YPNA 4L8NA 2NUGA 3OTOE 1PJSA 2RSIA 4DV7E 2EMCA 2EOYA 4KZSA 2MKDA 1F2IG 1YUIA 3RMPA 2EPZA 5IT9C 1T4LB 2EOEA 3J7AG 1AH5A 2EJ4A 2RPCA 2VRDA 2YTNA 4GZNC 2RTXA 3IWDA 5A2QC 2Q8UA 1IBKE 4O5GA 2DMIA 2UXCE 2CPNA 5KL5A 2UUAE 2F8BA 5AC4A 3VK6A 4NXNE 4WPYA 4X62E 1DI2A 4TUIA 2KONA 4Q28A 4RHBB 2JR1A 3VYXA 2EM5A 3VYYA 1ZR9A 2EL6A 3BIDA 3K6QA 2E5LE 2UXDE 2EM8A 4DV2E 1L4SA 1EH6A 4ZYDA 1BBOA 1X3CA 2NA2A 3HQ1A 2HGHA 2BBGA 3C4BA 1TF6A 2V88A 2M1SA 4JI7E 3ADJA 4BHCA 5FLXC 3F6GA 4MLQA 1N34E 2FV4B 4LFAE 2YTJA 5TSEA 4O43A 3HTXA 3UK3C 1EH8A 2V87A 4GKJE 4F6NA 1KYQA 2V83A 5A6JA 4DUYE 2DMYA 4MLVA 1PKPA 1XMOE 2EPMX 4ZYGA 1YYKA 2J7JA 3AUZA 4DR1E 2HHHE 1FJGE 1ZAAC 1IQSA 2L8TA 4DV6E 2EL4A 2YPNA 2WZOA 4R2SA 2G7HA 2ENHA 2YTIA 2EM0A 3KZZA 4M0VA 2LBSB 4F54A 3THOB 4R2EA 2EPAA 4JI6E 2EL5A 1J26A 3MHSC 2F4VE 2JPAA 5F3WA 2VQFE 2EZ6A 3C6MA 4R2RA 4P7DA 2YT4A 4YY3E 4F9AB 1O0WA 2RSMA 2YTGA 3ADGA 4DV5E 3HXLA 2EMKA 2LT7A 1RQ0A 4DR3E 4OX9E 3IWCA 1YFHA 2YTPA 2EM7A 2CT1A 3MSWA 1I94E 2IHR1 5CFFE 2L92A 1UILA 2V89A 4DR2E 1MEYC 2EN2A 2EPNA 2NABA 4R2DA 4AQYE 2RQLA 4R2CA 4DR7E 2EOQA 2LTRA 2EN1A 3OMLA 1NCSA 4BBYA 1A1LA 3LLHA 1WJPA 1PJQA 1MGTA 1T4OA 2LTSA 3QG5C 2VF1A 4L5NC 3IWBA 3HPZA 1IBME 1PDAA 2V85A 2MC5A 2EN4A 1DQ3A 2MDRA 2K4VA 2MC6A 1P47A 1EKZA 4WXDA 4JI4E 2LUPB 2CSHA 1YYOA 2L2NA 1X6HA 2YZTA 3C4TA 4JV5E 2LO3A 2EN7A 2ODRC 2R76A 1T4NA 5AE1A 3LMLA 3KZYA 2CTDA 2YU8A 4X64E 4TUGA 2PRTA 5AASA 1UBDC 4N4RB 2WCC3 2YU5A 5IV8B 5T6JA 2KHXA 2DIXA 4DKKA 1SR9A 2EMGA 4NHRA 5A69A 5LLQA 1DGCA 1IMUA 2ELZA 4YHHE 1N32E 4BMJA 4F2JC 4M9VC 1HNZE 5A6AA 2EN3A 2RS7A 2LUQA 2N3HA 4R2QA 4X65E 2YSPA 1XMQE 5KL6A 2EMWA 1GTKA 5BR8E 2UXBE 4WSPA 2H36X 1KJKA 1HNXE 2ZM6E 2V86A 2UU9E 5A6BA 4DUZE 3FIGA 2YTDA 5DNYA 4LFBE 1YZ9A 2YTFA 2E1MA 5IXMB 4DR4E 4M30A 4BC7A 3EPKA 2YRMA 4KWYA 2L2MA 2M9AA 2M4IA 2LE2A 2EPOA 2JXPA 1LLMC 5LL6R 1TN9A 2DB2A 2L2KB 4R03A 3VHTB 2ELYA 1X6FA 2EMIA 4B3TE 4LU9A 5KL3A 2D9HA 2L6MA 3EPLA 2EPUA 2B3TB 4F9CB 1T39A 2B7VA 4OOGC 1X49A 2EOMA 1J5EE 2JVAA 1A1GA 1N3GA 2B9DA 3J81C 4X8WA 1XNRE 1JK2A 2YRHA 2FGGA 4F9BB 3L00A 2EMAA 2BB8A 4R2PA 2EOZA 4IJDA 2EN8A 1JK1A 4NXME 4B3ME 1YSAC 2UUCE 4GEQB 1B69A 2N3GA 2ENCA 5LMNE 4LF9E 2EM9A 4DV4E 2JP9A 1ZBTA 4O24A 4GKKE 2EMFA 4Q35B 1A1HA 5LMUE 2EOJA 1XNQE 1ZU1A 2MDGA 4JYAE 4JI1E 2DLQA 4WSGA 2EPLX 3BGHA 1TF3A 4O4KA 4B3RE 2B7TA 3ECRA 2R1FA 4WYQB 2EE8A 1BB8A 3BF2A 1STUA 4LF6E 2EM6A 2EN6A 2K7IA 3JTZA 4DV0E 4DV3E 2LRSA 1IBLE 2EOFA 2DSYA 1X48A 5KL4A 3H09A 1N36E 1A1JA 3MHHC 2JYAA 3F6HA 2EMLA 2EMHA 2ADRA 4X9JA 2GLIA 3ADLA 3EQ1A 4JI8E 2MKNA 3J7Yp 3AV0A 5A6BD 2EPPA 5IWAE 2N8XA 4WX9A 1FKAE 2EPXA 4HTGA 4LF5E 2JOXA 4BS9A 4WXCA 1SFEA 2LCEA 2ENAA 2UUBE 2ODRD 2RS6A 4WFTA 3M99B 2EOXA 2VQEE 1PJTA 4FK5C 4NZVA 3BBGA 4IS1C 1A1FA 2EOHA 3JU0A 2V8QB 2I9IA 1BBGA 2E72A 2EM3A 5KL7A 2LVHA 1RMDA 2LMZA 2YTEA 1YYWA 3HPSA 3ADIA 1Z1BA 2DLKA 2A25A 2EMYA 1X6EA 4R8OA 4DR5E 3EPHA 1GZ6A 2WBSA 4P78A 5AE2A 2LJHA 2EOSA 4BHBA 4X66E 2FTXB 4JI0E 4ZYEA 3DF6A 2EP3A 1WRJA 4LTYA 3T1HE 2EM2A 1HR0E 5AC5A 4DV1E
chains in the Genus database with same CATH topology
2EMAA 2BB8A 4R2PA 2EOZA 2EQ1A 4IJDA 2EN8A 1JK1A 2EN4A 1YSAC 2EM5A 1B69A 1ZR9A 2EL6A 2ENCA 2EM8A 2YSOA 1P47A 2EM9A 4R2AA 2JP9A 2EM4A 2I13A 1X3CA 1BBOA 2EMFA 2HGHA 1A1HA 1TF6A 2EOJA 1ZU1A 2MDGA 2DLQA 4WSGA 2CSHA 1X6HA 2EMBA 2LV2A 1TF3A 2LO3A 2EN7A 2WBTA 1A1IA 1YUJA 2R1FA 2EOOA 2EOIA 2EE8A 1BB8A 2CTDA 2YU8A 2YTJA 2PRTA 2EM6A 2EPRA 2EN6A 1UBDC 3UK3C 2WCC3 2YRKA 2YU5A 4F6NA 2EOFA 5KL4A 1A1JA 3MHHC 2DRPA 2EMGA 1DGCA 2EMZA 2ELZA 1UN6B 4F2JC 1X5WA 2EMLA 2J7JA 2EMHA 2YTOA 4M9VC 1ZAAC 2ADRA 2EL4A 4X9JA 2EN3A 2GLIA 4R2SA 2DGCA 1G2FC 4R2QA 3EPJA 2EPCA 2MKNA 2ENHA 2YSPA 2YTIA 5KL6A 2EM0A 2EMWA 2EMXA 1AAYA 2EPPA 1G2DC 4R2EA 2EQ0A 2EPAA 2WBUA 2EL5A 1KJKA 3MHSC 2EPXA 2JPAA 2LCEA 2ENAA 5KL2A 2YTDA 4R2RA 2YTQA 3M99B 2GHFA 2YTFA 2EOXA 2EORA 3EPKA 4FK5C 2YRMA 4F6MA 2M9AA 2EQ3A 4IS1C 2YTGA 1A1KA 1A1FA 1LLMC 2EOHA 2LT7A 2EMKA 1TN9A 5KL7A 2RSIA 2E72A 2EM3A 3VHTB 2LVHA 2ELYA 1X6FA 2EMCA 2EOYA 1RMDA 2EMIA 2YTPA 2EM7A 2YTEA 2MKDA 5KL3A 2CT1A 2D9HA 1F2IG 3EPLA 1YUIA 2EPUA 1Z1BA 2DLKA 1MEYC 2A25A 2EMYA 2EN2A 1X6EA 2EPZA 2NABA 4R2DA 3EPHA 4R2CA 2WBSA 2EOQA 2EOEA 2YTNA 2EJ4A 2RPCA 2VRDA 4GZNC 2EN1A 2EOMA 1A1LA 1NCSA 2EOSA 1A1GA 1WJPA 2DMIA 5KL5A 2EP3A 1JK2A 2YRHA 2EM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMA A;  2BB8 A;  4R2P A;  2EOZ A;  2EQ1 A;  4IJD A;  2EN8 A;  1JK1 A;  2EN4 A;  1YSA C;  2EM5 A;  1B69 A;  1ZR9 A;  2EL6 A;  2ENC A;  2EM8 A;  2YSO A;  1P47 A;  2EM9 A;  4R2A A;  2JP9 A;  2EM4 A;  2I13 A;  1X3C A;  1BBO A;  2EMF A;  2HGH A;  1A1H A;  1TF6 A;  2EOJ A;  1ZU1 A;  2MDG A;  2DLQ A;  4WSG A;  2CSH A;  1X6H A;  2EMB A;  2LV2 A;  1TF3 A;  2LO3 A;  2EN7 A;  2WBT A;  1A1I A;  1YUJ A;  2R1F A;  2EOO A;  2EOI A;  2EE8 A;  1BB8 A;  2CTD A;  2YU8 A;  2YTJ A;  2PRT A;  2EM6 A;  2EPR A;  2EN6 A;  1UBD C;  3UK3 C;  2WCC 3;  2YRK A;  2YU5 A;  4F6N A;  2EOF A;  5KL4 A;  1A1J A;  3MHH C;  2DRP A;  2EMG A;  1DGC A;  2EMZ A;  2ELZ A;  1UN6 B;  4F2J C;  1X5W A;  2EML A;  2J7J A;  2EMH A;  2YTO A;  4M9V C;  1ZAA C;  2ADR A;  2EL4 A;  4X9J A;  2EN3 A;  2GLI A;  4R2S A;  2DGC A;  1G2F C;  4R2Q A;  3EPJ A;  2EPC A;  2MKN A;  2ENH A;  2YSP A;  2YTI A;  5KL6 A;  2EM0 A;  2EMW A;  2EMX A;  1AAY A;  2EPP A;  1G2D C;  4R2E A;  2EQ0 A;  2EPA A;  2WBU A;  2EL5 A;  1KJK A;  3MHS C;  2EPX A;  2JPA A;  2LCE A;  2ENA A;  5KL2 A;  2YTD A;  4R2R A;  2YTQ A;  3M99 B;  2GHF A;  2YTF A;  2EOX A;  2EOR A;  3EPK A;  4FK5 C;  2YRM A;  4F6M A;  2M9A A;  2EQ3 A;  4IS1 C;  2YTG A;  1A1K A;  1A1F A;  1LLM C;  2EOH A;  2LT7 A;  2EMK A;  1TN9 A;  5KL7 A;  2RSI A;  2E72 A;  2EM3 A;  3VHT B;  2LVH A;  2ELY A;  1X6F A;  2EMC A;  2EOY A;  1RMD A;  2EMI A;  2YTP A;  2EM7 A;  2YTE A;  2MKD A;  5KL3 A;  2CT1 A;  2D9H A;  1F2I G;  3EPL A;  1YUI A;  2EPU A;  1Z1B A;  2DLK A;  1MEY C;  2A25 A;  2EMY A;  2EN2 A;  1X6E A;  2EPZ A;  2NAB A;  4R2D A;  3EPH A;  4R2C A;  2WBS A;  2EOQ A;  2EOE A;  2YTN A;  2EJ4 A;  2RPC A;  2VRD A;  4GZN C;  2EN1 A;  2EOM A;  1A1L A;  1NCS A;  2EOS A;  1A1G A;  1WJP A;  2DMI A;  5KL5 A;  2EP3 A;  1JK2 A;  2YRH A;  2EM2 A; 
#chains in the Genus database with same CATH topology
 4BCA A;  1GQE A;  2HC5 A;  2EQ1 A;  2JY9 A;  3T1Y E;  4BC9 A;  2L3J A;  4JI5 E;  1T38 A;  2YSO A;  3C6K A;  4R2A A;  2LJU A;  2EM4 A;  2I13 A;  1HNW E;  2L33 A;  5A6K A;  2GPI A;  4DMI A;  2JWO A;  2EWL A;  1IQO A;  2EMB A;  2LV2 A;  2EPK X;  2WBT A;  1QNT A;  3J80 C;  1A1I A;  4LF4 E;  4LF7 E;  1YUJ A;  5ADZ A;  4M2Z A;  2NUE A;  1UHZ A;  2EOO A;  2EOI A;  1N33 E;  1WHQ A;  4B3S E;  2EPR A;  2VE7 C;  3KWR A;  1NEI A;  1EH7 A;  2NUF A;  2YRK A;  2YWQ A;  4RH8 A;  4LF8 E;  3THN A;  2DRP A;  2EMZ A;  3DJW A;  1UN6 B;  1X5W A;  2M7Q A;  2YTO A;  4JI2 E;  2DGC A;  1G2F C;  3TQM A;  3EPJ A;  2HJJ A;  2EPC A;  3P1X A;  1AAY A;  2EMX A;  1RC7 A;  3ZOQ B;  1WHN A;  1G2D C;  4JI3 E;  2EQ0 A;  2WBU A;  2L3C A;  4DR6 E;  1WXR A;  1ZBQ A;  4KHP E;  5KL2 A;  1QU6 A;  2JOB A;  4LFC E;  4I8O A;  4J8Z A;  4K0K E;  2YTQ A;  2GHF A;  1X47 A;  5AE3 A;  2KOU A;  2EOR A;  4F6M A;  3JAM C;  4HEI A;  2EQ3 A;  1A1K A;  4ZYH A;  1YPN A;  4L8N A;  2NUG A;  3OTO E;  1PJS A;  2RSI A;  4DV7 E;  2EMC A;  2EOY A;  4KZS A;  2MKD A;  1F2I G;  1YUI A;  3RMP A;  2EPZ A;  5IT9 C;  1T4L B;  2EOE A;  3J7A G;  1AH5 A;  2EJ4 A;  2RPC A;  2VRD A;  2YTN A;  4GZN C;  2RTX A;  3IWD A;  5A2Q C;  2Q8U A;  1IBK E;  4O5G A;  2DMI A;  2UXC E;  2CPN A;  5KL5 A;  2UUA E;  2F8B A;  5AC4 A;  3VK6 A;  4NXN E;  4WPY A;  4X62 E;  1DI2 A;  4TUI A;  2KON A;  4Q28 A;  4RHB B;  2JR1 A;  3VYX A;  2EM5 A;  3VYY A;  1ZR9 A;  2EL6 A;  3BID A;  3K6Q A;  2E5L E;  2UXD E;  2EM8 A;  4DV2 E;  1L4S A;  1EH6 A;  4ZYD A;  1BBO A;  1X3C A;  2NA2 A;  3HQ1 A;  2HGH A;  2BBG A;  3C4B A;  1TF6 A;  2V88 A;  2M1S A;  4JI7 E;  3ADJ A;  4BHC A;  5FLX C;  3F6G A;  4MLQ A;  1N34 E;  2FV4 B;  4LFA E;  2YTJ A;  5TSE A;  4O43 A;  3HTX A;  3UK3 C;  1EH8 A;  2V87 A;  4GKJ E;  4F6N A;  1KYQ A;  2V83 A;  5A6J A;  4DUY E;  2DMY A;  4MLV A;  1PKP A;  1XMO E;  2EPM X;  4ZYG A;  1YYK A;  2J7J A;  3AUZ A;  4DR1 E;  2HHH E;  1FJG E;  1ZAA C;  1IQS A;  2L8T A;  4DV6 E;  2EL4 A;  2YPN A;  2WZO A;  4R2S A;  2G7H A;  2ENH A;  2YTI A;  2EM0 A;  3KZZ A;  4M0V A;  2LBS B;  4F54 A;  3THO B;  4R2E A;  2EPA A;  4JI6 E;  2EL5 A;  1J26 A;  3MHS C;  2F4V E;  2JPA A;  5F3W A;  2VQF E;  2EZ6 A;  3C6M A;  4R2R A;  4P7D A;  2YT4 A;  4YY3 E;  4F9A B;  1O0W A;  2RSM A;  2YTG A;  3ADG A;  4DV5 E;  3HXL A;  2EMK A;  2LT7 A;  1RQ0 A;  4DR3 E;  4OX9 E;  3IWC A;  1YFH A;  2YTP A;  2EM7 A;  2CT1 A;  3MSW A;  1I94 E;  2IHR 1;  5CFF E;  2L92 A;  1UIL A;  2V89 A;  4DR2 E;  1MEY C;  2EN2 A;  2EPN A;  2NAB A;  4R2D A;  4AQY E;  2RQL A;  4R2C A;  4DR7 E;  2EOQ A;  2LTR A;  2EN1 A;  3OML A;  1NCS A;  4BBY A;  1A1L A;  3LLH A;  1WJP A;  1PJQ A;  1MGT A;  1T4O A;  2LTS A;  3QG5 C;  2VF1 A;  4L5N C;  3IWB A;  3HPZ A;  1IBM E;  1PDA A;  2V85 A;  2MC5 A;  2EN4 A;  1DQ3 A;  2MDR A;  2K4V A;  2MC6 A;  1P47 A;  1EKZ A;  4WXD A;  4JI4 E;  2LUP B;  2CSH A;  1YYO A;  2L2N A;  1X6H A;  2YZT A;  3C4T A;  4JV5 E;  2LO3 A;  2EN7 A;  2ODR C;  2R76 A;  1T4N A;  5AE1 A;  3LML A;  3KZY A;  2CTD A;  2YU8 A;  4X64 E;  4TUG A;  2PRT A;  5AAS A;  1UBD C;  4N4R B;  2WCC 3;  2YU5 A;  5IV8 B;  5T6J A;  2KHX A;  2DIX A;  4DKK A;  1SR9 A;  2EMG A;  4NHR A;  5A69 A;  5LLQ A;  1DGC A;  1IMU A;  2ELZ A;  4YHH E;  1N32 E;  4BMJ A;  4F2J C;  4M9V C;  1HNZ E;  5A6A A;  2EN3 A;  2RS7 A;  2LUQ A;  2N3H A;  4R2Q A;  4X65 E;  2YSP A;  1XMQ E;  5KL6 A;  2EMW A;  1GTK A;  5BR8 E;  2UXB E;  4WSP A;  2H36 X;  1KJK A;  1HNX E;  2ZM6 E;  2V86 A;  2UU9 E;  5A6B A;  4DUZ E;  3FIG A;  2YTD A;  5DNY A;  4LFB E;  1YZ9 A;  2YTF A;  2E1M A;  5IXM B;  4DR4 E;  4M30 A;  4BC7 A;  3EPK A;  2YRM A;  4KWY A;  2L2M A;  2M9A A;  2M4I A;  2LE2 A;  2EPO A;  2JXP A;  1LLM C;  5LL6 R;  1TN9 A;  2DB2 A;  2L2K B;  4R03 A;  3VHT B;  2ELY A;  1X6F A;  2EMI A;  4B3T E;  4LU9 A;  5KL3 A;  2D9H A;  2L6M A;  3EPL A;  2EPU A;  2B3T B;  4F9C B;  1T39 A;  2B7V A;  4OOG C;  1X49 A;  2EOM A;  1J5E E;  2JVA A;  1A1G A;  1N3G A;  2B9D A;  3J81 C;  4X8W A;  1XNR E;  1JK2 A;  2YRH A;  2FGG A;  4F9B B;  3L00 A;  2EMA A;  2BB8 A;  4R2P A;  2EOZ A;  4IJD A;  2EN8 A;  1JK1 A;  4NXM E;  4B3M E;  1YSA C;  2UUC E;  4GEQ B;  1B69 A;  2N3G A;  2ENC A;  5LMN E;  4LF9 E;  2EM9 A;  4DV4 E;  2JP9 A;  1ZBT A;  4O24 A;  4GKK E;  2EMF A;  4Q35 B;  1A1H A;  5LMU E;  2EOJ A;  1XNQ E;  1ZU1 A;  2MDG A;  4JYA E;  4JI1 E;  2DLQ A;  4WSG A;  2EPL X;  3BGH A;  1TF3 A;  4O4K A;  4B3R E;  2B7T A;  3ECR A;  2R1F A;  4WYQ B;  2EE8 A;  1BB8 A;  3BF2 A;  1STU A;  4LF6 E;  2EM6 A;  2EN6 A;  2K7I A;  3JTZ A;  4DV0 E;  4DV3 E;  2LRS A;  1IBL E;  2EOF A;  2DSY A;  1X48 A;  5KL4 A;  3H09 A;  1N36 E;  1A1J A;  3MHH C;  2JYA A;  3F6H A;  2EML A;  2EMH A;  2ADR A;  4X9J A;  2GLI A;  3ADL A;  3EQ1 A;  4JI8 E;  2MKN A;  3J7Y p;  3AV0 A;  5A6B D;  2EPP A;  5IWA E;  2N8X A;  4WX9 A;  1FKA E;  2EPX A;  4HTG A;  4LF5 E;  2JOX A;  4BS9 A;  4WXC A;  1SFE A;  2LCE A;  2ENA A;  2UUB E;  2ODR D;  2RS6 A;  4WFT A;  3M99 B;  2EOX A;  2VQE E;  1PJT A;  4FK5 C;  4NZV A;  3BBG A;  4IS1 C;  1A1F A;  2EOH A;  3JU0 A;  2V8Q B;  2I9I A;  1BBG A;  2E72 A;  2EM3 A;  5KL7 A;  2LVH A;  1RMD A;  2LMZ A;  2YTE A;  1YYW A;  3HPS A;  3ADI A;  1Z1B A;  2DLK A;  2A25 A;  2EMY A;  1X6E A;  4R8O A;  4DR5 E;  3EPH A;  1GZ6 A;  2WBS A;  4P78 A;  5AE2 A;  2LJH A;  2EOS A;  4BHB A;  4X66 E;  2FTX B;  4JI0 E;  4ZYE A;  3DF6 A;  2EP3 A;  1WRJ A;  4LTY A;  3T1H E;  2EM2 A;  1HR0 E;  5AC5 A;  4DV1 E; 
#chains in the Genus database with same CATH homology
 2EMA A;  2BB8 A;  4R2P A;  2EOZ A;  2EQ1 A;  4IJD A;  2EN8 A;  1JK1 A;  2EN4 A;  1YSA C;  2EM5 A;  1B69 A;  1ZR9 A;  2EL6 A;  2ENC A;  2EM8 A;  2YSO A;  1P47 A;  2EM9 A;  4R2A A;  2JP9 A;  2EM4 A;  2I13 A;  1X3C A;  1BBO A;  2EMF A;  2HGH A;  1A1H A;  1TF6 A;  2EOJ A;  1ZU1 A;  2MDG A;  2DLQ A;  4WSG A;  2CSH A;  1X6H A;  2EMB A;  2LV2 A;  1TF3 A;  2LO3 A;  2EN7 A;  2WBT A;  1A1I A;  1YUJ A;  2R1F A;  2EOO A;  2EOI A;  2EE8 A;  1BB8 A;  2CTD A;  2YU8 A;  2YTJ A;  2PRT A;  2EM6 A;  2EPR A;  2EN6 A;  1UBD C;  3UK3 C;  2WCC 3;  2YRK A;  2YU5 A;  4F6N A;  2EOF A;  5KL4 A;  1A1J A;  3MHH C;  2DRP A;  2EMG A;  1DGC A;  2EMZ A;  2ELZ A;  1UN6 B;  4F2J C;  1X5W A;  2EML A;  2J7J A;  2EMH A;  2YTO A;  4M9V C;  1ZAA C;  2ADR A;  2EL4 A;  4X9J A;  2EN3 A;  2GLI A;  4R2S A;  2DGC A;  1G2F C;  4R2Q A;  3EPJ A;  2EPC A;  2MKN A;  2ENH A;  2YSP A;  2YTI A;  5KL6 A;  2EM0 A;  2EMW A;  2EMX A;  1AAY A;  2EPP A;  1G2D C;  4R2E A;  2EQ0 A;  2EPA A;  2WBU A;  2EL5 A;  1KJK A;  3MHS C;  2EPX A;  2JPA A;  2LCE A;  2ENA A;  5KL2 A;  2YTD A;  4R2R A;  2YTQ A;  3M99 B;  2GHF A;  2YTF A;  2EOX A;  2EOR A;  3EPK A;  4FK5 C;  2YRM A;  4F6M A;  2M9A A;  2EQ3 A;  4IS1 C;  2YTG A;  1A1K A;  1A1F A;  1LLM C;  2EOH A;  2LT7 A;  2EMK A;  1TN9 A;  5KL7 A;  2RSI A;  2E72 A;  2EM3 A;  3VHT B;  2LVH A;  2ELY A;  1X6F A;  2EMC A;  2EOY A;  1RMD A;  2EMI A;  2YTP A;  2EM7 A;  2YTE A;  2MKD A;  5KL3 A;  2CT1 A;  2D9H A;  1F2I G;  3EPL A;  1YUI A;  2EPU A;  1Z1B A;  2DLK A;  1MEY C;  2A25 A;  2EMY A;  2EN2 A;  1X6E A;  2EPZ A;  2NAB A;  4R2D A;  3EPH A;  4R2C A;  2WBS A;  2EOQ A;  2EOE A;  2YTN A;  2EJ4 A;  2RPC A;  2VRD A;  4GZN C;  2EN1 A;  2EOM A;  1A1L A;  1NCS A;  2EOS A;  1A1G A;  1WJP A;  2DMI A;  5KL5 A;  2EP3 A;  1JK2 A;  2YRH A;  2EM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...