2EQ0A

Solution structure of the 8th c2h2 type zinc finger domain of zinc finger protein 347
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYKCHECGKVFRRNSHLARHQLIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural genomics, unknown function
molecule keywords Zinc finger protein 347
publication title Solution structure of the 8th C2H2 type zinc finger domain of Zinc finger protein 347
rcsb
source organism Homo sapiens
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eq0A01
2EOQA 2YTPA 4IS1C 2YRKA 2GLIA 1X5WA 1G2FC 4F6MA 1BB8A 2EN3A 2EN8A 2EPXA 2EL5A 2EMYA 2EM4A 2EMIA 2J7JA 2CT1A 4F6NA 2HGHA 5KL3A 2YRHA 2VRDA 2EMXA 4R2DA 2EMKA 2EPAA 2LCEA 2RPCA 2EN1A 2YU5A 2YTJA 4IJDA 2EE8A 2EJ4A 1ZR9A 2EOHA 2JPAA 2EPCA 1TN9A 5KL2A 1P47A 1X6FA 2EN7A 1G2DC 2EM8A 1UBDC 2EOIA 2GHFA 4WSGA 2YTGA 2I13A 2PRTA 2EM7A 2EMLA 2YTNA 3EPJA 1TF3A 3EPHA 2DGCA 1X6EA 2EM3A 2CSHA 4R2EA 1A1GA 1WJPA 3MHSC 3EPLA 1DGCA 2A25A 2EQ1A 1X6HA 2BB8A 1KJKA 2YU8A 1ZU1A 2EOSA 2JP9A 2LO3A 1JK1A 2M9AA 2EMFA 1YUIA 4GZNC 2EP3A 2LVHA 2EMAA 2EMZA 2D9HA 1YSAC 5KL5A 2ELZA 2EMWA 2EOMA 1MEYC 2YTIA 2EM2A 2EPUA 2DLKA 1ZAAC 2EN4A 2EOEA 1A1HA 2EOXA 2EMBA 2EMHA 1Z1BA 2LT7A 4R2QA 4R2AA 1LLMC 1JK2A 3EPKA 4R2RA 1RMDA 2ADRA 2EPZA 2CTDA 3M99B 2ENHA 2EPPA 5KL6A 2WBSA 2EN2A 2RSIA 2DRPA 2EMCA 2LV2A 2EOFA 2YRMA 2WCC3 1F2IG 2YTDA 4R2PA 2YSOA 2EOZA 1A1IA 2YTEA 2E72A 1NCSA 2EL6A 2EORA 3MHHC 2WBUA 2NABA 2EOJA 2EQ0A 2DLQA 2MKNA 1AAYA 4X9JA 4FK5C 2YSPA 2WBTA 2EM6A 4M9VC 3VHTB 1TF6A 2YTFA 2ENCA 2EPRA 1A1FA 2EM5A 5KL7A 2EN6A 1BBOA 4R2SA 1A1KA 3UK3C 2R1FA 2YTQA 2YTOA 2ELYA 4F2JC 1B69A 2MDGA 2DMIA 1YUJA 2EL4A 2EM9A 1UN6B 2MKDA 1A1LA 2ENAA 1A1JA 4R2CA 2EM0A 5KL4A 1X3CA 2EOOA 2EMGA 2EOYA 2EQ3A
chains in the Genus database with same CATH superfamily
2YTPA 5A6JA 4F6MA 2EN3A 4P78A 2EM4A 1IBLE 2J7JA 2CT1A 2HGHA 5CFFE 1T4NA 2DSYA 4RH8A 2EMXA 3ADJA 2DIXA 2G7HA 5DNYA 2YU5A 3AV0A 3IWBA 4GKKE 2LTSA 3LMLA 2Q8UA 3C4TA 2EJ4A 4I8OA 3THNA 5BR8E 2EN7A 4BC7A 4WXDA 3FIGA 1BBGA 2GHFA 1YYWA 4WX9A 2V87A 2YTNA 2NUGA 3EPHA 2MC5A 4NXNE 4DV3E 3VK6A 3VYYA 5LLQA 4JI0E 3TQMA 1RC7A 1PKPA 3BBGA 2EQ1A 2LUQA 1SR9A 1WHNA 3J7AG 4B3RE 2EPMX 4GKJE 1GZ6A 2EMZA 4R8OA 2RQLA 2EMWA 4GEQB 2EM2A 2JYAA 4X64E 4DR3E 3C4BA 1A1HA 1QU6A 1STUA 4BHCA 1T39A 3EPKA 4R2RA 2ADRA 2EPZA 3M99B 1YYOA 5LL6R 1X47A 1RQ0A 4ZYDA 4DV6E 2WCC3 2N3HA 3BGHA 2RS7A 4LFCE 2EOZA 4JI7E 2N3GA 1X48A 3HTXA 5LMUE 4JI2E 1XNQE 2DLQA 2EPNA 1WRJA 1X49A 4FK5C 1YYKA 4JI4E 2B7TA 2EM6A 2WBTA 4M9VC 4R03A 2ENCA 4O24A 2EM5A 2V85A 1A1KA 3UK3C 5A6KA 4DR7E 2EM9A 4BC9A 2LUPB 2EWLA 4RHBB 1YPNA 1T38A 2EOYA 3JTZA 2V8QB 2YTOA 2EQ3A 2YRKA 2GLIA 1X5WA 4JI3E 1N36E 4O4KA 2NUFA 4DV4E 4F6NA 4BCAA 1IBKE 2DMYA 2YRHA 2VRDA 1ZBQA 4NXME 5AC4A 4LF9E 4LTYA 5IXMB 1EH6A 4IJDA 2EE8A 1ZR9A 1TN9A 3J80C 1P47A 3HPZA 4O5GA 1J26A 2EM8A 2V83A 2LBSB 3ZOQB 1UBDC 2YTGA 2L2NA 3LLHA 5FLXC 3C6MA 2L6MA 3OTOE 4DR2E 2LTRA 1X6EA 2FV4B 4R2EA 4DR6E 3MHSC 4KWYA 1EKZA 1HNXE 4DV7E 5A6BD 3F6HA 2BB8A 3L00A 2R76A 2LO3A 1JK1A 4YHHE 2EMFA 1YUIA 5F3WA 2EP3A 2K4VA 2ODRD 2DB2A 2EMAA 2VE7C 2M7QA 4F9AB 2K7IA 3OMLA 1YSAC 4DKKA 2EPKX 2L3JA 4L5NC 1MEYC 4WYQB 1PDAA 3HPSA 1QNTA 2EN4A 2EOEA 3T1HE 2EOXA 4JI8E 2EMBA 4X62E 2B9DA 1UHZA 2JWOA 4B3SE 1LLMC 1JK2A 3HQ1A 2JR1A 2WBSA 2EN2A 4DR1E 4MLVA 2EMCA 1J5EE 1F2IG 2L92A 3MSWA 4R2PA 2YSOA 5A2QC 1A1IA 2YTEA 3C6KA 2EL6A 3J7Yp 1HNWE 1DQ3A 2EOJA 2EQ0A 4LFBE 1HNZE 4X9JA 2YSPA 1ZBTA 4BBYA 3HXLA 3VHTB 1TF6A 2JOBA 4F54A 2EN6A 1FJGE 4DV1E 1AH5A 2R1FA 2GPIA 3T1YE 4LF8E 2ELYA 3EQ1A 4F2JC 4BS9A 2MDGA 4HEIA 1UN6B 2ENAA 4R2CA 1UILA 2EOOA 5TSEA 2DRPA 2EOQA 1DI2A 4ZYHA 1BB8A 3BIDA 2EL5A 2EMYA 4AQYE 1XMQE 4WFTA 4B3ME 2M1SA 5KL3A 4WXCA 2LRSA 2EMKA 2LCEA 2LJUA 2YPNA 2EN1A 1YFHA 2YTJA 2EOHA 2JPAA 5A69A 2WZOA 4X66E 1O0WA 4JI1E 4OX9E 2L33A 3KWRA 4LF6E 2EOIA 2N8XA 1SFEA 3ADGA 2HHHE 1N33E 2YWQA 1N32E 2PRTA 2EM7A 2EMLA 4N4RB 3EPJA 2NA2A 1IBME 2YZTA 2DGCA 2EM3A 3EPLA 2YT4A 2A25A 5IWAE 2I9IA 2L2KB 1XNRE 1XMOE 2IHR1 2RTXA 4JI5E 4GZNC 5LMNE 4LF4E 5AC5A 3ECRA 3VYXA 4WSPA 1T4OA 1IQOA 5KL5A 1WHQA 3DJWA 2YTIA 4OOGC 1ZAAC 2LJHA 4KHPE 2BBGA 2RSMA 1HR0E 4DMIA 3IWDA 4JI6E 1GQEA 2EPOA 4R2QA 4R2AA 1RMDA 4KZSA 5KL6A 2MDRA 2V89A 2RSIA 4DV0E 2E5LE 3P1XA 2EOFA 2KONA 1FKAE 2NUEA 1NCSA 2UUBE 2L2MA 4BHBA 2VF1A 2EORA 3MHHC 2WBUA 1IMUA 4P7DA 4M0VA 2ZM6E 1EH8A 5A6AA 1AAYA 5ADZA 2LMZA 3IWCA 4DV2E 2JOXA 2EPRA 1A1FA 5KL7A 1BBOA 4F9CB 4HTGA 2UUCE 4R2SA 2LE2A 4B3TE 3QG5C 3F6GA 2F4VE 4Q35B 5IV8B 2L8TA 2MKDA 1KYQA 1A1LA 1YZ9A 1A1JA 5KL4A 4ZYEA 1TF3A 5IT9C 4IS1C 1MGTA 1G2FC 2MC6A 3RMPA 2EN8A 2EPXA 4TUGA 2E1MA 2EMIA 2UXCE 2CPNA 4R2DA 2KHXA 4Q28A 2L3CA 2EPAA 2FGGA 2RPCA 2F8BA 3KZZA 4JV5E 2KOUA 4F9BB 2JVAA 2EPCA 2EPLX 4J8ZA 5KL2A 1X6FA 1G2DC 2EZ6A 3BF2A 1PJQA 3AUZA 4WSGA 2I13A 3H09A 1IQSA 4O43A 4K0KE 4DV5E 5T6JA 2CSHA 1PJTA 4DUYE 1A1GA 1NEIA 1WJPA 1DGCA 4YY3E 1X6HA 1KJKA 2FTXB 2JXPA 2YU8A 1ZU1A 2EOSA 4MLQA 2JP9A 2UXBE 2VQEE 1EH7A 2M9AA 2HJJA 2V86A 2ODRC 3THOB 2LVHA 5AASA 4LF5E 2D9HA 2VQFE 2UU9E 4L8NA 2ELZA 4WPYA 3ADIA 4BMJA 2JY9A 2EOMA 1I94E 2EPUA 4M2ZA 2DLKA 1GTKA 2B7VA 3JU0A 2V88A 5AE2A 4M30A 1N34E 2EMHA 1Z1BA 4NHRA 2LT7A 4JYAE 2HC5A 2M4IA 2RS6A 1PJSA 2UUAE 2CTDA 2ENHA 2EPPA 3JAMC 1L4SA 2B3TB 2LV2A 2YRMA 2YTDA 5A6BA 4X8WA 4LU9A 2E72A 1WXRA 4DR4E 2NABA 4DR5E 2H36X 2MKNA 4NZVA 1T4LB 4X65E 4LFAE 5AE3A 2UXDE 2YTFA 3DF6A 4LF7E 5AE1A 1N3GA 3J81C 2YTQA 3KZYA 1B69A 4ZYGA 2DMIA 1YUJA 3K6QA 2EL4A 3ADLA 4TUIA 2EM0A 1X3CA 2EMGA 4DUZE
chains in the Genus database with same CATH topology
2EOQA 2YTPA 4IS1C 2YRKA 2GLIA 1X5WA 1G2FC 4F6MA 1BB8A 2EN3A 2EN8A 2EPXA 2EL5A 2EMYA 2EM4A 2EMIA 2J7JA 2CT1A 4F6NA 2HGHA 5KL3A 2YRHA 2VRDA 2EMXA 4R2DA 2EMKA 2EPAA 2LCEA 2RPCA 2EN1A 2YU5A 2YTJA 4IJDA 2EE8A 2EJ4A 1ZR9A 2EOHA 2JPAA 2EPCA 1TN9A 5KL2A 1P47A 1X6FA 2EN7A 1G2DC 2EM8A 1UBDC 2EOIA 2GHFA 4WSGA 2YTGA 2I13A 2PRTA 2EM7A 2EMLA 2YTNA 3EPJA 1TF3A 3EPHA 2DGCA 1X6EA 2EM3A 2CSHA 4R2EA 1A1GA 1WJPA 3MHSC 3EPLA 1DGCA 2A25A 2EQ1A 1X6HA 2BB8A 1KJKA 2YU8A 1ZU1A 2EOSA 2JP9A 2LO3A 1JK1A 2M9AA 2EMFA 1YUIA 4GZNC 2EP3A 2LVHA 2EMAA 2EMZA 2D9HA 1YSAC 5KL5A 2ELZA 2EMWA 2EOMA 1MEYC 2YTIA 2EM2A 2EPUA 2DLKA 1ZAAC 2EN4A 2EOEA 1A1HA 2EOXA 2EMBA 2EMHA 1Z1BA 2LT7A 4R2QA 4R2AA 1LLMC 1JK2A 3EPKA 4R2RA 1RMDA 2ADRA 2EPZA 2CTDA 3M99B 2ENHA 2EPPA 5KL6A 2WBSA 2EN2A 2RSIA 2DRPA 2EMCA 2LV2A 2EOFA 2YRMA 2WCC3 1F2IG 2YTDA 4R2PA 2YSOA 2EOZA 1A1IA 2YTEA 2E72A 1NCSA 2EL6A 2EORA 3MHHC 2WBUA 2NABA 2EOJA 2EQ0A 2DLQA 2MKNA 1AAYA 4X9JA 4FK5C 2YSPA 2WBTA 2EM6A 4M9VC 3VHTB 1TF6A 2YTFA 2ENCA 2EPRA 1A1FA 2EM5A 5KL7A 2EN6A 1BBOA 4R2SA 1A1KA 3UK3C 2R1FA 2YTQA 2YTOA 2ELYA 4F2JC 1B69A 2MDGA 2DMIA 1YUJA 2EL4A 2EM9A 1UN6B 2MKDA 1A1LA 2ENAA 1A1JA 4R2CA 2EM0A 5KL4A 1X3CA 2EOOA 2EMGA 2EOYA 2EQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOQ A;  2YTP A;  4IS1 C;  2YRK A;  2GLI A;  1X5W A;  1G2F C;  4F6M A;  1BB8 A;  2EN3 A;  2EN8 A;  2EPX A;  2EL5 A;  2EMY A;  2EM4 A;  2EMI A;  2J7J A;  2CT1 A;  4F6N A;  2HGH A;  5KL3 A;  2YRH A;  2VRD A;  2EMX A;  4R2D A;  2EMK A;  2EPA A;  2LCE A;  2RPC A;  2EN1 A;  2YU5 A;  2YTJ A;  4IJD A;  2EE8 A;  2EJ4 A;  1ZR9 A;  2EOH A;  2JPA A;  2EPC A;  1TN9 A;  5KL2 A;  1P47 A;  1X6F A;  2EN7 A;  1G2D C;  2EM8 A;  1UBD C;  2EOI A;  2GHF A;  4WSG A;  2YTG A;  2I13 A;  2PRT A;  2EM7 A;  2EML A;  2YTN A;  3EPJ A;  1TF3 A;  3EPH A;  2DGC A;  1X6E A;  2EM3 A;  2CSH A;  4R2E A;  1A1G A;  1WJP A;  3MHS C;  3EPL A;  1DGC A;  2A25 A;  2EQ1 A;  1X6H A;  2BB8 A;  1KJK A;  2YU8 A;  1ZU1 A;  2EOS A;  2JP9 A;  2LO3 A;  1JK1 A;  2M9A A;  2EMF A;  1YUI A;  4GZN C;  2EP3 A;  2LVH A;  2EMA A;  2EMZ A;  2D9H A;  1YSA C;  5KL5 A;  2ELZ A;  2EMW A;  2EOM A;  1MEY C;  2YTI A;  2EM2 A;  2EPU A;  2DLK A;  1ZAA C;  2EN4 A;  2EOE A;  1A1H A;  2EOX A;  2EMB A;  2EMH A;  1Z1B A;  2LT7 A;  4R2Q A;  4R2A A;  1LLM C;  1JK2 A;  3EPK A;  4R2R A;  1RMD A;  2ADR A;  2EPZ A;  2CTD A;  3M99 B;  2ENH A;  2EPP A;  5KL6 A;  2WBS A;  2EN2 A;  2RSI A;  2DRP A;  2EMC A;  2LV2 A;  2EOF A;  2YRM A;  2WCC 3;  1F2I G;  2YTD A;  4R2P A;  2YSO A;  2EOZ A;  1A1I A;  2YTE A;  2E72 A;  1NCS A;  2EL6 A;  2EOR A;  3MHH C;  2WBU A;  2NAB A;  2EOJ A;  2EQ0 A;  2DLQ A;  2MKN A;  1AAY A;  4X9J A;  4FK5 C;  2YSP A;  2WBT A;  2EM6 A;  4M9V C;  3VHT B;  1TF6 A;  2YTF A;  2ENC A;  2EPR A;  1A1F A;  2EM5 A;  5KL7 A;  2EN6 A;  1BBO A;  4R2S A;  1A1K A;  3UK3 C;  2R1F A;  2YTQ A;  2YTO A;  2ELY A;  4F2J C;  1B69 A;  2MDG A;  2DMI A;  1YUJ A;  2EL4 A;  2EM9 A;  1UN6 B;  2MKD A;  1A1L A;  2ENA A;  1A1J A;  4R2C A;  2EM0 A;  5KL4 A;  1X3C A;  2EOO A;  2EMG A;  2EOY A;  2EQ3 A; 
#chains in the Genus database with same CATH topology
 2YTP A;  5A6J A;  4F6M A;  2EN3 A;  4P78 A;  2EM4 A;  1IBL E;  2J7J A;  2CT1 A;  2HGH A;  5CFF E;  1T4N A;  2DSY A;  4RH8 A;  2EMX A;  3ADJ A;  2DIX A;  2G7H A;  5DNY A;  2YU5 A;  3AV0 A;  3IWB A;  4GKK E;  2LTS A;  3LML A;  2Q8U A;  3C4T A;  2EJ4 A;  4I8O A;  3THN A;  5BR8 E;  2EN7 A;  4BC7 A;  4WXD A;  3FIG A;  1BBG A;  2GHF A;  1YYW A;  4WX9 A;  2V87 A;  2YTN A;  2NUG A;  3EPH A;  2MC5 A;  4NXN E;  4DV3 E;  3VK6 A;  3VYY A;  5LLQ A;  4JI0 E;  3TQM A;  1RC7 A;  1PKP A;  3BBG A;  2EQ1 A;  2LUQ A;  1SR9 A;  1WHN A;  3J7A G;  4B3R E;  2EPM X;  4GKJ E;  1GZ6 A;  2EMZ A;  4R8O A;  2RQL A;  2EMW A;  4GEQ B;  2EM2 A;  2JYA A;  4X64 E;  4DR3 E;  3C4B A;  1A1H A;  1QU6 A;  1STU A;  4BHC A;  1T39 A;  3EPK A;  4R2R A;  2ADR A;  2EPZ A;  3M99 B;  1YYO A;  5LL6 R;  1X47 A;  1RQ0 A;  4ZYD A;  4DV6 E;  2WCC 3;  2N3H A;  3BGH A;  2RS7 A;  4LFC E;  2EOZ A;  4JI7 E;  2N3G A;  1X48 A;  3HTX A;  5LMU E;  4JI2 E;  1XNQ E;  2DLQ A;  2EPN A;  1WRJ A;  1X49 A;  4FK5 C;  1YYK A;  4JI4 E;  2B7T A;  2EM6 A;  2WBT A;  4M9V C;  4R03 A;  2ENC A;  4O24 A;  2EM5 A;  2V85 A;  1A1K A;  3UK3 C;  5A6K A;  4DR7 E;  2EM9 A;  4BC9 A;  2LUP B;  2EWL A;  4RHB B;  1YPN A;  1T38 A;  2EOY A;  3JTZ A;  2V8Q B;  2YTO A;  2EQ3 A;  2YRK A;  2GLI A;  1X5W A;  4JI3 E;  1N36 E;  4O4K A;  2NUF A;  4DV4 E;  4F6N A;  4BCA A;  1IBK E;  2DMY A;  2YRH A;  2VRD A;  1ZBQ A;  4NXM E;  5AC4 A;  4LF9 E;  4LTY A;  5IXM B;  1EH6 A;  4IJD A;  2EE8 A;  1ZR9 A;  1TN9 A;  3J80 C;  1P47 A;  3HPZ A;  4O5G A;  1J26 A;  2EM8 A;  2V83 A;  2LBS B;  3ZOQ B;  1UBD C;  2YTG A;  2L2N A;  3LLH A;  5FLX C;  3C6M A;  2L6M A;  3OTO E;  4DR2 E;  2LTR A;  1X6E A;  2FV4 B;  4R2E A;  4DR6 E;  3MHS C;  4KWY A;  1EKZ A;  1HNX E;  4DV7 E;  5A6B D;  3F6H A;  2BB8 A;  3L00 A;  2R76 A;  2LO3 A;  1JK1 A;  4YHH E;  2EMF A;  1YUI A;  5F3W A;  2EP3 A;  2K4V A;  2ODR D;  2DB2 A;  2EMA A;  2VE7 C;  2M7Q A;  4F9A B;  2K7I A;  3OML A;  1YSA C;  4DKK A;  2EPK X;  2L3J A;  4L5N C;  1MEY C;  4WYQ B;  1PDA A;  3HPS A;  1QNT A;  2EN4 A;  2EOE A;  3T1H E;  2EOX A;  4JI8 E;  2EMB A;  4X62 E;  2B9D A;  1UHZ A;  2JWO A;  4B3S E;  1LLM C;  1JK2 A;  3HQ1 A;  2JR1 A;  2WBS A;  2EN2 A;  4DR1 E;  4MLV A;  2EMC A;  1J5E E;  1F2I G;  2L92 A;  3MSW A;  4R2P A;  2YSO A;  5A2Q C;  1A1I A;  2YTE A;  3C6K A;  2EL6 A;  3J7Y p;  1HNW E;  1DQ3 A;  2EOJ A;  2EQ0 A;  4LFB E;  1HNZ E;  4X9J A;  2YSP A;  1ZBT A;  4BBY A;  3HXL A;  3VHT B;  1TF6 A;  2JOB A;  4F54 A;  2EN6 A;  1FJG E;  4DV1 E;  1AH5 A;  2R1F A;  2GPI A;  3T1Y E;  4LF8 E;  2ELY A;  3EQ1 A;  4F2J C;  4BS9 A;  2MDG A;  4HEI A;  1UN6 B;  2ENA A;  4R2C A;  1UIL A;  2EOO A;  5TSE A;  2DRP A;  2EOQ A;  1DI2 A;  4ZYH A;  1BB8 A;  3BID A;  2EL5 A;  2EMY A;  4AQY E;  1XMQ E;  4WFT A;  4B3M E;  2M1S A;  5KL3 A;  4WXC A;  2LRS A;  2EMK A;  2LCE A;  2LJU A;  2YPN A;  2EN1 A;  1YFH A;  2YTJ A;  2EOH A;  2JPA A;  5A69 A;  2WZO A;  4X66 E;  1O0W A;  4JI1 E;  4OX9 E;  2L33 A;  3KWR A;  4LF6 E;  2EOI A;  2N8X A;  1SFE A;  3ADG A;  2HHH E;  1N33 E;  2YWQ A;  1N32 E;  2PRT A;  2EM7 A;  2EML A;  4N4R B;  3EPJ A;  2NA2 A;  1IBM E;  2YZT A;  2DGC A;  2EM3 A;  3EPL A;  2YT4 A;  2A25 A;  5IWA E;  2I9I A;  2L2K B;  1XNR E;  1XMO E;  2IHR 1;  2RTX A;  4JI5 E;  4GZN C;  5LMN E;  4LF4 E;  5AC5 A;  3ECR A;  3VYX A;  4WSP A;  1T4O A;  1IQO A;  5KL5 A;  1WHQ A;  3DJW A;  2YTI A;  4OOG C;  1ZAA C;  2LJH A;  4KHP E;  2BBG A;  2RSM A;  1HR0 E;  4DMI A;  3IWD A;  4JI6 E;  1GQE A;  2EPO A;  4R2Q A;  4R2A A;  1RMD A;  4KZS A;  5KL6 A;  2MDR A;  2V89 A;  2RSI A;  4DV0 E;  2E5L E;  3P1X A;  2EOF A;  2KON A;  1FKA E;  2NUE A;  1NCS A;  2UUB E;  2L2M A;  4BHB A;  2VF1 A;  2EOR A;  3MHH C;  2WBU A;  1IMU A;  4P7D A;  4M0V A;  2ZM6 E;  1EH8 A;  5A6A A;  1AAY A;  5ADZ A;  2LMZ A;  3IWC A;  4DV2 E;  2JOX A;  2EPR A;  1A1F A;  5KL7 A;  1BBO A;  4F9C B;  4HTG A;  2UUC E;  4R2S A;  2LE2 A;  4B3T E;  3QG5 C;  3F6G A;  2F4V E;  4Q35 B;  5IV8 B;  2L8T A;  2MKD A;  1KYQ A;  1A1L A;  1YZ9 A;  1A1J A;  5KL4 A;  4ZYE A;  1TF3 A;  5IT9 C;  4IS1 C;  1MGT A;  1G2F C;  2MC6 A;  3RMP A;  2EN8 A;  2EPX A;  4TUG A;  2E1M A;  2EMI A;  2UXC E;  2CPN A;  4R2D A;  2KHX A;  4Q28 A;  2L3C A;  2EPA A;  2FGG A;  2RPC A;  2F8B A;  3KZZ A;  4JV5 E;  2KOU A;  4F9B B;  2JVA A;  2EPC A;  2EPL X;  4J8Z A;  5KL2 A;  1X6F A;  1G2D C;  2EZ6 A;  3BF2 A;  1PJQ A;  3AUZ A;  4WSG A;  2I13 A;  3H09 A;  1IQS A;  4O43 A;  4K0K E;  4DV5 E;  5T6J A;  2CSH A;  1PJT A;  4DUY E;  1A1G A;  1NEI A;  1WJP A;  1DGC A;  4YY3 E;  1X6H A;  1KJK A;  2FTX B;  2JXP A;  2YU8 A;  1ZU1 A;  2EOS A;  4MLQ A;  2JP9 A;  2UXB E;  2VQE E;  1EH7 A;  2M9A A;  2HJJ A;  2V86 A;  2ODR C;  3THO B;  2LVH A;  5AAS A;  4LF5 E;  2D9H A;  2VQF E;  2UU9 E;  4L8N A;  2ELZ A;  4WPY A;  3ADI A;  4BMJ A;  2JY9 A;  2EOM A;  1I94 E;  2EPU A;  4M2Z A;  2DLK A;  1GTK A;  2B7V A;  3JU0 A;  2V88 A;  5AE2 A;  4M30 A;  1N34 E;  2EMH A;  1Z1B A;  4NHR A;  2LT7 A;  4JYA E;  2HC5 A;  2M4I A;  2RS6 A;  1PJS A;  2UUA E;  2CTD A;  2ENH A;  2EPP A;  3JAM C;  1L4S A;  2B3T B;  2LV2 A;  2YRM A;  2YTD A;  5A6B A;  4X8W A;  4LU9 A;  2E72 A;  1WXR A;  4DR4 E;  2NAB A;  4DR5 E;  2H36 X;  2MKN A;  4NZV A;  1T4L B;  4X65 E;  4LFA E;  5AE3 A;  2UXD E;  2YTF A;  3DF6 A;  4LF7 E;  5AE1 A;  1N3G A;  3J81 C;  2YTQ A;  3KZY A;  1B69 A;  4ZYG A;  2DMI A;  1YUJ A;  3K6Q A;  2EL4 A;  3ADL A;  4TUI A;  2EM0 A;  1X3C A;  2EMG A;  4DUZ E; 
#chains in the Genus database with same CATH homology
 2EOQ A;  2YTP A;  4IS1 C;  2YRK A;  2GLI A;  1X5W A;  1G2F C;  4F6M A;  1BB8 A;  2EN3 A;  2EN8 A;  2EPX A;  2EL5 A;  2EMY A;  2EM4 A;  2EMI A;  2J7J A;  2CT1 A;  4F6N A;  2HGH A;  5KL3 A;  2YRH A;  2VRD A;  2EMX A;  4R2D A;  2EMK A;  2EPA A;  2LCE A;  2RPC A;  2EN1 A;  2YU5 A;  2YTJ A;  4IJD A;  2EE8 A;  2EJ4 A;  1ZR9 A;  2EOH A;  2JPA A;  2EPC A;  1TN9 A;  5KL2 A;  1P47 A;  1X6F A;  2EN7 A;  1G2D C;  2EM8 A;  1UBD C;  2EOI A;  2GHF A;  4WSG A;  2YTG A;  2I13 A;  2PRT A;  2EM7 A;  2EML A;  2YTN A;  3EPJ A;  1TF3 A;  3EPH A;  2DGC A;  1X6E A;  2EM3 A;  2CSH A;  4R2E A;  1A1G A;  1WJP A;  3MHS C;  3EPL A;  1DGC A;  2A25 A;  2EQ1 A;  1X6H A;  2BB8 A;  1KJK A;  2YU8 A;  1ZU1 A;  2EOS A;  2JP9 A;  2LO3 A;  1JK1 A;  2M9A A;  2EMF A;  1YUI A;  4GZN C;  2EP3 A;  2LVH A;  2EMA A;  2EMZ A;  2D9H A;  1YSA C;  5KL5 A;  2ELZ A;  2EMW A;  2EOM A;  1MEY C;  2YTI A;  2EM2 A;  2EPU A;  2DLK A;  1ZAA C;  2EN4 A;  2EOE A;  1A1H A;  2EOX A;  2EMB A;  2EMH A;  1Z1B A;  2LT7 A;  4R2Q A;  4R2A A;  1LLM C;  1JK2 A;  3EPK A;  4R2R A;  1RMD A;  2ADR A;  2EPZ A;  2CTD A;  3M99 B;  2ENH A;  2EPP A;  5KL6 A;  2WBS A;  2EN2 A;  2RSI A;  2DRP A;  2EMC A;  2LV2 A;  2EOF A;  2YRM A;  2WCC 3;  1F2I G;  2YTD A;  4R2P A;  2YSO A;  2EOZ A;  1A1I A;  2YTE A;  2E72 A;  1NCS A;  2EL6 A;  2EOR A;  3MHH C;  2WBU A;  2NAB A;  2EOJ A;  2EQ0 A;  2DLQ A;  2MKN A;  1AAY A;  4X9J A;  4FK5 C;  2YSP A;  2WBT A;  2EM6 A;  4M9V C;  3VHT B;  1TF6 A;  2YTF A;  2ENC A;  2EPR A;  1A1F A;  2EM5 A;  5KL7 A;  2EN6 A;  1BBO A;  4R2S A;  1A1K A;  3UK3 C;  2R1F A;  2YTQ A;  2YTO A;  2ELY A;  4F2J C;  1B69 A;  2MDG A;  2DMI A;  1YUJ A;  2EL4 A;  2EM9 A;  1UN6 B;  2MKD A;  1A1L A;  2ENA A;  1A1J A;  4R2C A;  2EM0 A;  5KL4 A;  1X3C A;  2EOO A;  2EMG A;  2EOY A;  2EQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...