2EQ0A

Solution structure of the 8th c2h2 type zinc finger domain of zinc finger protein 347
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYKCHECGKVFRRNSHLARHQLIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the 8th C2H2 type zinc finger domain of Zinc finger protein 347
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords Zinc finger protein 347
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eq0A01
1F2IG 1X6HA 2YTNA 1NCSA 2EQ1A 2EPRA 2MDGA 2EPCA 1X5WA 1YUIA 2DRPA 4F6MA 1Z1BA 2EE8A 2YRKA 2DLKA 2EOYA 2EM5A 1KJKA 2EM4A 2CTDA 1A1GA 1WJPA 1G2DC 2EMZA 1YSAC 1BBOA 2EOJA 2EOXA 3EPJA 3MHSC 2EM0A 2EL4A 2EMXA 1X6FA 3EPKA 1TF6A 1ZR9A 2GLIA 1UN6B 2EOMA 1A1FA 2LT7A 2ELYA 2YTPA 2BB8A 1X3CA 1X6EA 3M99B 4R2DA 4F2JC 4R2EA 2E72A 2EOFA 2LVHA 2RSIA 2YTFA 3VHTB 4R2AA 2EL6A 1A1HA 4F6NA 2EPZA 2EN2A 2EOZA 2PRTA 1A1KA 2YTOA 2DGCA 2YTGA 2CSHA 2EMFA 1A1LA 2EMKA 2EPAA 2MKDA 2EMWA 1P47A 4IS1C 2WBUA 2VRDA 5KL4A 2EN4A 2WBTA 2EN8A 1LLMC 2DMIA 2EM6A 2EN3A 2EMIA 2ADRA 2NABA 4IJDA 2YTIA 1MEYC 2HGHA 1B69A 2EN7A 1G2FC 1UBDC 1BB8A 2EM7A 2EOHA 2EN6A 2EMYA 2YTEA 2EOSA 5KL7A 4R2PA 1ZAAC 2A25A 2EM2A 2YU8A 4FK5C 2EMAA 2YRHA 2EQ0A 5KL5A 5KL6A 1TN9A 2JP9A 2LV2A 2ENAA 1JK2A 2EMBA 2EMGA 2ENCA 2EM9A 2EMCA 2EORA 2EOIA 3EPLA 1JK1A 2EMLA 3MHHC 2EMHA 2EOOA 1ZU1A 2ENHA 2ELZA 2YTDA 2YSOA 2CT1A 2LCEA 4R2QA 2J7JA 3UK3C 1TF3A 2M9AA 2WBSA 2YTQA 2D9HA 2EL5A 2RPCA 3EPHA 2EOQA 2YRMA 5KL3A 2EOEA 2YTJA 4M9VC 4GZNC 2LO3A 2EPXA 2EP3A 2EPPA 5KL2A 2JPAA 1YUJA 2YSPA 2EJ4A 2DLQA 4R2SA 2I13A 2WCC3 4WSGA 2MKNA 1AAYA 2EM8A 4R2CA 2EN1A 2YU5A 4X9JA 4R2RA 2R1FA 2GHFA 1RMDA 1A1JA 2EQ3A 1A1IA 2EM3A 1DGCA 2EPUA
chains in the Genus database with same CATH superfamily
3AUZA 4ZYGA 4GKJE 3MSWA 3HXLA 4KHPE 4KZSA 4DR7E 1IBKE 1X5WA 2YWQA 3H09A 1YUIA 2FV4B 2EOYA 2LJUA 2UXCE 3P1XA 2L92A 1KJKA 1A1GA 2EPOA 4R8OA 1YZ9A 1WJPA 5A2QC 1G2DC 1BBOA 4JI1E 3BF2A 2EOXA 3J7Yp 4LFCE 2M7QA 1N3GA 1YFHA 1X6FA 1TF6A 4WYQB 2GLIA 4DV1E 2LBSB 1QNTA 2LT7A 2LUPB 4DR2E 1X3CA 4DR5E 2EPNA 2RSIA 2V87A 3VHTB 2LTRA 4DR3E 1A1HA 2Q8UA 4WXDA 1IBME 4N4RB 1T39A 2MDRA 2I9IA 2EMFA 1T4OA 1P47A 3C4TA 3T1HE 1L4SA 2DB2A 4WX9A 2M1SA 2DMIA 2EN3A 2YZTA 1I94E 2EMIA 2ADRA 3F6GA 4IJDA 3VYYA 1HR0E 2EOHA 5AC5A 1MGTA 2H36X 4Q35B 4RH8A 2A25A 4F9CB 2ODRD 4JI7E 4JI5E 1YYWA 4HEIA 2NA2A 4O24A 3ADGA 1X47A 2FTXB 4F54A 5KL6A 1TN9A 2JP9A 2ENAA 4JI3E 1IMUA 2ENCA 3EPLA 1PJSA 4ZYEA 3FIGA 4R2QA 2M9AA 2D9HA 1XMQE 2LE2A 2V8QB 4TUGA 1EKZA 3EPHA 3HPZA 4M30A 2RQLA 2JPAA 1N32E 4OX9E 2ODRC 3DJWA 2I13A 4WSGA 4LF9E 1AAYA 3ADJA 2YU5A 4X9JA 1X49A 4R2RA 4NZVA 4JI4E 4DV3E 4GEQB 1A1JA 1A1IA 4JV5E 5IT9C 1WHQA 1DGCA 1HNWE 3JTZA 3KWRA 4ZYHA 3THOB 4O43A 1X6HA 4JI6E 2EPRA 2DIXA 2V86A 2DRPA 4F6MA 2EE8A 2YRKA 2DLKA 1O0WA 2EM4A 2B7VA 4DUYE 4B3SE 4NHRA 2LTSA 3EPJA 1PJTA 1DQ3A 1RC7A 4X66E 2EMXA 3EPKA 1UN6B 1ZR9A 5IV8B 3OTOE 1UHZA 2YTPA 2EWLA 1GZ6A 1X6EA 5LMUE 2UXBE 2UUAE 4LU9A 2L3JA 2KONA 4F2JC 2EOFA 2DMYA 2EPLX 3JU0A 4BBYA 4LF5E 3AV0A 3K6QA 2K4VA 5TSEA 2DGCA 2YTGA 1SFEA 2JOBA 4WFTA 2YT4A 2KOUA 3HTXA 2JYAA 2EMKA 2EPAA 2MKDA 3ZOQB 5IWAE 2EMWA 4IS1C 4TUIA 1EH6A 2HJJA 5KL4A 1IQSA 2NUGA 2JY9A 2WBTA 4WSPA 2EN8A 1LLMC 2DSYA 5LL6R 4DKKA 3BBGA 1MEYC 4LFAE 2GPIA 2EN6A 2L3CA 2EOSA 5CFFE 2B7TA 4BCAA 4R03A 2EQ0A 1RQ0A 5KL5A 4LF6E 2EMBA 3RMPA 3LLHA 2WZOA 2FGGA 1JK1A 3MHHC 3TQMA 2EMHA 2ENHA 2YSOA 4X8WA 3J7AG 4LF8E 1TF3A 4NXNE 2WBSA 2YTQA 1XNRE 2RPCA 2EOQA 1PKPA 4JI2E 2EOEA 2YTJA 1WXRA 4X64E 4O5GA 4JI8E 4B3TE 2EP3A 4DV2E 2F8BA 1YUJA 1T4NA 2YSPA 2DLQA 4R2SA 4P78A 4DV4E 5LMNE 4R2CA 2V83A 3IWDA 2L2KB 1YYKA 2RTXA 1YYOA 1SR9A 3THNA 4JYAE 2E5LE 4Q28A 1XNQE 4DV6E 1ZBTA 3JAMC 1T4LB 5A6BD 2V89A 1N34E 4DR4E 2YTNA 2MDGA 2LJHA 1YPNA 2UU9E 3IWBA 2EM5A 1BBGA 2RSMA 3LMLA 1WRJA 2NUEA 4L5NC 5A69A 4P7DA 1EH7A 2EM0A 2EL4A 5ADZA 2VQEE 1AH5A 1A1FA 2BB8A 4I8OA 3C4BA 2MC6A 3KZYA 1PDAA 3KZZA 4R2AA 3BIDA 4F6NA 2EPZA 3J81C 2EN2A 2EPMX 2YTOA 1T38A 2CSHA 3HQ1A 1J5EE 1A1LA 3IWCA 2HC5A 2LRSA 2E1MA 2VRDA 2UUCE 4AQYE 2R76A 4B3ME 3T1YE 4OOGC 4DV5E 2YTIA 1B69A 2EN7A 1G2FC 1UBDC 3ADLA 1ZBQA 2EM7A 1UILA 2EPKX 2YTEA 1NEIA 2N8XA 4R2PA 5A6BA 4LF4E 4NXME 4FK5C 1IQOA 2JXPA 2EMAA 2YRHA 1GQEA 2V85A 1WHNA 1GTKA 1FKAE 2ZM6E 4BMJA 2EMCA 2EORA 4L8NA 4BHCA 1STUA 2LCEA 2NUFA 1PJQA 2LUQA 1DI2A 4BHBA 2JOXA 2LMZA 3ECRA 2EL5A 3DF6A 5KL3A 1FJGE 4DV0E 2HHHE 2F4VE 2L2NA 2EPPA 5KL2A 1KYQA 2EM8A 2EN1A 4DR1E 4M0VA 4J8ZA 5IXMB 2VQFE 2GHFA 2L8TA 2EQ3A 1X48A 3C6MA 2EM3A 5T6JA 2EPUA 1EH8A 1F2IG 4ZYDA 1NCSA 3BGHA 2EQ1A 2EPCA 2IHR1 1N36E 1QU6A 4JI0E 3C6KA 3EQ1A 3J80C 1J26A 1Z1BA 4YHHE 5BR8E 5A6KA 4X65E 2RS6A 2CTDA 2VE7C 2EMZA 1YSAC 4DMIA 2EOJA 4WPYA 4DV7E 3MHSC 1HNXE 4HTGA 4KWYA 2JR1A 2K7IA 1N33E 2EOMA 2ELYA 4F9BB 2G7HA 5AE3A 3M99B 4R2DA 3OMLA 4R2EA 2E72A 2LVHA 2YTFA 2EL6A 4BC9A 1XMOE 2EOZA 4O4KA 4F9AB 2UXDE 3HPSA 2PRTA 1A1KA 4LFBE 4RHBB 1HNZE 4BC7A 2JVAA 3F6HA 2WBUA 2EN4A 5AC4A 5FLXC 2EM6A 3VYXA 2V88A 4DUZE 2N3HA 2NABA 2HGHA 2UUBE 1BB8A 2VF1A 4WXCA 2EMYA 2BBGA 5KL7A 1ZAAC 2B3TB 5AE1A 4GKKE 2EM2A 2KHXA 2M4IA 2YU8A 2EZ6A 4K0KE 2CPNA 2LV2A 1JK2A 2EMGA 4DR6E 4MLVA 2EM9A 3ADIA 2EOIA 5AASA 2EMLA 2EOOA 1ZU1A 2ELZA 2YTDA 2YPNA 2J7JA 3UK3C 2MC5A 4LTYA 2N3GA 2YRMA 4M2ZA 5A6AA 4LF7E 2L33A 4M9VC 4YY3E 2RS7A 3L00A 4GZNC 5DNYA 2LO3A 2EPXA 4BS9A 2EJ4A 2JWOA 2B9DA 2WCC3 1IBLE 2MKNA 5F3WA 3VK6A 4X62E 2L6MA 5A6JA 2L2MA 5LLQA 2R1FA 4MLQA 4B3RE 1RMDA 5AE2A 3QG5C 2CT1A
chains in the Genus database with same CATH topology
1F2IG 1X6HA 2YTNA 1NCSA 2EQ1A 2EPRA 2MDGA 2EPCA 1X5WA 1YUIA 2DRPA 4F6MA 1Z1BA 2EE8A 2YRKA 2DLKA 2EOYA 2EM5A 1KJKA 2EM4A 2CTDA 1A1GA 1WJPA 1G2DC 2EMZA 1YSAC 1BBOA 2EOJA 2EOXA 3EPJA 3MHSC 2EM0A 2EL4A 2EMXA 1X6FA 3EPKA 1TF6A 1ZR9A 2GLIA 1UN6B 2EOMA 1A1FA 2LT7A 2ELYA 2YTPA 2BB8A 1X3CA 1X6EA 3M99B 4R2DA 4F2JC 4R2EA 2E72A 2EOFA 2LVHA 2RSIA 2YTFA 3VHTB 4R2AA 2EL6A 1A1HA 4F6NA 2EPZA 2EN2A 2EOZA 2PRTA 1A1KA 2YTOA 2DGCA 2YTGA 2CSHA 2EMFA 1A1LA 2EMKA 2EPAA 2MKDA 2EMWA 1P47A 4IS1C 2WBUA 2VRDA 5KL4A 2EN4A 2WBTA 2EN8A 1LLMC 2DMIA 2EM6A 2EN3A 2EMIA 2ADRA 2NABA 4IJDA 2YTIA 1MEYC 2HGHA 1B69A 2EN7A 1G2FC 1UBDC 1BB8A 2EM7A 2EOHA 2EN6A 2EMYA 2YTEA 2EOSA 5KL7A 4R2PA 1ZAAC 2A25A 2EM2A 2YU8A 4FK5C 2EMAA 2YRHA 2EQ0A 5KL5A 5KL6A 1TN9A 2JP9A 2LV2A 2ENAA 1JK2A 2EMBA 2EMGA 2ENCA 2EM9A 2EMCA 2EORA 2EOIA 3EPLA 1JK1A 2EMLA 3MHHC 2EMHA 2EOOA 1ZU1A 2ENHA 2ELZA 2YTDA 2YSOA 2CT1A 2LCEA 4R2QA 2J7JA 3UK3C 1TF3A 2M9AA 2WBSA 2YTQA 2D9HA 2EL5A 2RPCA 3EPHA 2EOQA 2YRMA 5KL3A 2EOEA 2YTJA 4M9VC 4GZNC 2LO3A 2EPXA 2EP3A 2EPPA 5KL2A 2JPAA 1YUJA 2YSPA 2EJ4A 2DLQA 4R2SA 2I13A 2WCC3 4WSGA 2MKNA 1AAYA 2EM8A 4R2CA 2EN1A 2YU5A 4X9JA 4R2RA 2R1FA 2GHFA 1RMDA 1A1JA 2EQ3A 1A1IA 2EM3A 1DGCA 2EPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F2I G;  1X6H A;  2YTN A;  1NCS A;  2EQ1 A;  2EPR A;  2MDG A;  2EPC A;  1X5W A;  1YUI A;  2DRP A;  4F6M A;  1Z1B A;  2EE8 A;  2YRK A;  2DLK A;  2EOY A;  2EM5 A;  1KJK A;  2EM4 A;  2CTD A;  1A1G A;  1WJP A;  1G2D C;  2EMZ A;  1YSA C;  1BBO A;  2EOJ A;  2EOX A;  3EPJ A;  3MHS C;  2EM0 A;  2EL4 A;  2EMX A;  1X6F A;  3EPK A;  1TF6 A;  1ZR9 A;  2GLI A;  1UN6 B;  2EOM A;  1A1F A;  2LT7 A;  2ELY A;  2YTP A;  2BB8 A;  1X3C A;  1X6E A;  3M99 B;  4R2D A;  4F2J C;  4R2E A;  2E72 A;  2EOF A;  2LVH A;  2RSI A;  2YTF A;  3VHT B;  4R2A A;  2EL6 A;  1A1H A;  4F6N A;  2EPZ A;  2EN2 A;  2EOZ A;  2PRT A;  1A1K A;  2YTO A;  2DGC A;  2YTG A;  2CSH A;  2EMF A;  1A1L A;  2EMK A;  2EPA A;  2MKD A;  2EMW A;  1P47 A;  4IS1 C;  2WBU A;  2VRD A;  5KL4 A;  2EN4 A;  2WBT A;  2EN8 A;  1LLM C;  2DMI A;  2EM6 A;  2EN3 A;  2EMI A;  2ADR A;  2NAB A;  4IJD A;  2YTI A;  1MEY C;  2HGH A;  1B69 A;  2EN7 A;  1G2F C;  1UBD C;  1BB8 A;  2EM7 A;  2EOH A;  2EN6 A;  2EMY A;  2YTE A;  2EOS A;  5KL7 A;  4R2P A;  1ZAA C;  2A25 A;  2EM2 A;  2YU8 A;  4FK5 C;  2EMA A;  2YRH A;  2EQ0 A;  5KL5 A;  5KL6 A;  1TN9 A;  2JP9 A;  2LV2 A;  2ENA A;  1JK2 A;  2EMB A;  2EMG A;  2ENC A;  2EM9 A;  2EMC A;  2EOR A;  2EOI A;  3EPL A;  1JK1 A;  2EML A;  3MHH C;  2EMH A;  2EOO A;  1ZU1 A;  2ENH A;  2ELZ A;  2YTD A;  2YSO A;  2CT1 A;  2LCE A;  4R2Q A;  2J7J A;  3UK3 C;  1TF3 A;  2M9A A;  2WBS A;  2YTQ A;  2D9H A;  2EL5 A;  2RPC A;  3EPH A;  2EOQ A;  2YRM A;  5KL3 A;  2EOE A;  2YTJ A;  4M9V C;  4GZN C;  2LO3 A;  2EPX A;  2EP3 A;  2EPP A;  5KL2 A;  2JPA A;  1YUJ A;  2YSP A;  2EJ4 A;  2DLQ A;  4R2S A;  2I13 A;  2WCC 3;  4WSG A;  2MKN A;  1AAY A;  2EM8 A;  4R2C A;  2EN1 A;  2YU5 A;  4X9J A;  4R2R A;  2R1F A;  2GHF A;  1RMD A;  1A1J A;  2EQ3 A;  1A1I A;  2EM3 A;  1DGC A;  2EPU A; 
#chains in the Genus database with same CATH topology
 3AUZ A;  4ZYG A;  4GKJ E;  3MSW A;  3HXL A;  4KHP E;  4KZS A;  4DR7 E;  1IBK E;  1X5W A;  2YWQ A;  3H09 A;  1YUI A;  2FV4 B;  2EOY A;  2LJU A;  2UXC E;  3P1X A;  2L92 A;  1KJK A;  1A1G A;  2EPO A;  4R8O A;  1YZ9 A;  1WJP A;  5A2Q C;  1G2D C;  1BBO A;  4JI1 E;  3BF2 A;  2EOX A;  3J7Y p;  4LFC E;  2M7Q A;  1N3G A;  1YFH A;  1X6F A;  1TF6 A;  4WYQ B;  2GLI A;  4DV1 E;  2LBS B;  1QNT A;  2LT7 A;  2LUP B;  4DR2 E;  1X3C A;  4DR5 E;  2EPN A;  2RSI A;  2V87 A;  3VHT B;  2LTR A;  4DR3 E;  1A1H A;  2Q8U A;  4WXD A;  1IBM E;  4N4R B;  1T39 A;  2MDR A;  2I9I A;  2EMF A;  1T4O A;  1P47 A;  3C4T A;  3T1H E;  1L4S A;  2DB2 A;  4WX9 A;  2M1S A;  2DMI A;  2EN3 A;  2YZT A;  1I94 E;  2EMI A;  2ADR A;  3F6G A;  4IJD A;  3VYY A;  1HR0 E;  2EOH A;  5AC5 A;  1MGT A;  2H36 X;  4Q35 B;  4RH8 A;  2A25 A;  4F9C B;  2ODR D;  4JI7 E;  4JI5 E;  1YYW A;  4HEI A;  2NA2 A;  4O24 A;  3ADG A;  1X47 A;  2FTX B;  4F54 A;  5KL6 A;  1TN9 A;  2JP9 A;  2ENA A;  4JI3 E;  1IMU A;  2ENC A;  3EPL A;  1PJS A;  4ZYE A;  3FIG A;  4R2Q A;  2M9A A;  2D9H A;  1XMQ E;  2LE2 A;  2V8Q B;  4TUG A;  1EKZ A;  3EPH A;  3HPZ A;  4M30 A;  2RQL A;  2JPA A;  1N32 E;  4OX9 E;  2ODR C;  3DJW A;  2I13 A;  4WSG A;  4LF9 E;  1AAY A;  3ADJ A;  2YU5 A;  4X9J A;  1X49 A;  4R2R A;  4NZV A;  4JI4 E;  4DV3 E;  4GEQ B;  1A1J A;  1A1I A;  4JV5 E;  5IT9 C;  1WHQ A;  1DGC A;  1HNW E;  3JTZ A;  3KWR A;  4ZYH A;  3THO B;  4O43 A;  1X6H A;  4JI6 E;  2EPR A;  2DIX A;  2V86 A;  2DRP A;  4F6M A;  2EE8 A;  2YRK A;  2DLK A;  1O0W A;  2EM4 A;  2B7V A;  4DUY E;  4B3S E;  4NHR A;  2LTS A;  3EPJ A;  1PJT A;  1DQ3 A;  1RC7 A;  4X66 E;  2EMX A;  3EPK A;  1UN6 B;  1ZR9 A;  5IV8 B;  3OTO E;  1UHZ A;  2YTP A;  2EWL A;  1GZ6 A;  1X6E A;  5LMU E;  2UXB E;  2UUA E;  4LU9 A;  2L3J A;  2KON A;  4F2J C;  2EOF A;  2DMY A;  2EPL X;  3JU0 A;  4BBY A;  4LF5 E;  3AV0 A;  3K6Q A;  2K4V A;  5TSE A;  2DGC A;  2YTG A;  1SFE A;  2JOB A;  4WFT A;  2YT4 A;  2KOU A;  3HTX A;  2JYA A;  2EMK A;  2EPA A;  2MKD A;  3ZOQ B;  5IWA E;  2EMW A;  4IS1 C;  4TUI A;  1EH6 A;  2HJJ A;  5KL4 A;  1IQS A;  2NUG A;  2JY9 A;  2WBT A;  4WSP A;  2EN8 A;  1LLM C;  2DSY A;  5LL6 R;  4DKK A;  3BBG A;  1MEY C;  4LFA E;  2GPI A;  2EN6 A;  2L3C A;  2EOS A;  5CFF E;  2B7T A;  4BCA A;  4R03 A;  2EQ0 A;  1RQ0 A;  5KL5 A;  4LF6 E;  2EMB A;  3RMP A;  3LLH A;  2WZO A;  2FGG A;  1JK1 A;  3MHH C;  3TQM A;  2EMH A;  2ENH A;  2YSO A;  4X8W A;  3J7A G;  4LF8 E;  1TF3 A;  4NXN E;  2WBS A;  2YTQ A;  1XNR E;  2RPC A;  2EOQ A;  1PKP A;  4JI2 E;  2EOE A;  2YTJ A;  1WXR A;  4X64 E;  4O5G A;  4JI8 E;  4B3T E;  2EP3 A;  4DV2 E;  2F8B A;  1YUJ A;  1T4N A;  2YSP A;  2DLQ A;  4R2S A;  4P78 A;  4DV4 E;  5LMN E;  4R2C A;  2V83 A;  3IWD A;  2L2K B;  1YYK A;  2RTX A;  1YYO A;  1SR9 A;  3THN A;  4JYA E;  2E5L E;  4Q28 A;  1XNQ E;  4DV6 E;  1ZBT A;  3JAM C;  1T4L B;  5A6B D;  2V89 A;  1N34 E;  4DR4 E;  2YTN A;  2MDG A;  2LJH A;  1YPN A;  2UU9 E;  3IWB A;  2EM5 A;  1BBG A;  2RSM A;  3LML A;  1WRJ A;  2NUE A;  4L5N C;  5A69 A;  4P7D A;  1EH7 A;  2EM0 A;  2EL4 A;  5ADZ A;  2VQE E;  1AH5 A;  1A1F A;  2BB8 A;  4I8O A;  3C4B A;  2MC6 A;  3KZY A;  1PDA A;  3KZZ A;  4R2A A;  3BID A;  4F6N A;  2EPZ A;  3J81 C;  2EN2 A;  2EPM X;  2YTO A;  1T38 A;  2CSH A;  3HQ1 A;  1J5E E;  1A1L A;  3IWC A;  2HC5 A;  2LRS A;  2E1M A;  2VRD A;  2UUC E;  4AQY E;  2R76 A;  4B3M E;  3T1Y E;  4OOG C;  4DV5 E;  2YTI A;  1B69 A;  2EN7 A;  1G2F C;  1UBD C;  3ADL A;  1ZBQ A;  2EM7 A;  1UIL A;  2EPK X;  2YTE A;  1NEI A;  2N8X A;  4R2P A;  5A6B A;  4LF4 E;  4NXM E;  4FK5 C;  1IQO A;  2JXP A;  2EMA A;  2YRH A;  1GQE A;  2V85 A;  1WHN A;  1GTK A;  1FKA E;  2ZM6 E;  4BMJ A;  2EMC A;  2EOR A;  4L8N A;  4BHC A;  1STU A;  2LCE A;  2NUF A;  1PJQ A;  2LUQ A;  1DI2 A;  4BHB A;  2JOX A;  2LMZ A;  3ECR A;  2EL5 A;  3DF6 A;  5KL3 A;  1FJG E;  4DV0 E;  2HHH E;  2F4V E;  2L2N A;  2EPP A;  5KL2 A;  1KYQ A;  2EM8 A;  2EN1 A;  4DR1 E;  4M0V A;  4J8Z A;  5IXM B;  2VQF E;  2GHF A;  2L8T A;  2EQ3 A;  1X48 A;  3C6M A;  2EM3 A;  5T6J A;  2EPU A;  1EH8 A;  1F2I G;  4ZYD A;  1NCS A;  3BGH A;  2EQ1 A;  2EPC A;  2IHR 1;  1N36 E;  1QU6 A;  4JI0 E;  3C6K A;  3EQ1 A;  3J80 C;  1J26 A;  1Z1B A;  4YHH E;  5BR8 E;  5A6K A;  4X65 E;  2RS6 A;  2CTD A;  2VE7 C;  2EMZ A;  1YSA C;  4DMI A;  2EOJ A;  4WPY A;  4DV7 E;  3MHS C;  1HNX E;  4HTG A;  4KWY A;  2JR1 A;  2K7I A;  1N33 E;  2EOM A;  2ELY A;  4F9B B;  2G7H A;  5AE3 A;  3M99 B;  4R2D A;  3OML A;  4R2E A;  2E72 A;  2LVH A;  2YTF A;  2EL6 A;  4BC9 A;  1XMO E;  2EOZ A;  4O4K A;  4F9A B;  2UXD E;  3HPS A;  2PRT A;  1A1K A;  4LFB E;  4RHB B;  1HNZ E;  4BC7 A;  2JVA A;  3F6H A;  2WBU A;  2EN4 A;  5AC4 A;  5FLX C;  2EM6 A;  3VYX A;  2V88 A;  4DUZ E;  2N3H A;  2NAB A;  2HGH A;  2UUB E;  1BB8 A;  2VF1 A;  4WXC A;  2EMY A;  2BBG A;  5KL7 A;  1ZAA C;  2B3T B;  5AE1 A;  4GKK E;  2EM2 A;  2KHX A;  2M4I A;  2YU8 A;  2EZ6 A;  4K0K E;  2CPN A;  2LV2 A;  1JK2 A;  2EMG A;  4DR6 E;  4MLV A;  2EM9 A;  3ADI A;  2EOI A;  5AAS A;  2EML A;  2EOO A;  1ZU1 A;  2ELZ A;  2YTD A;  2YPN A;  2J7J A;  3UK3 C;  2MC5 A;  4LTY A;  2N3G A;  2YRM A;  4M2Z A;  5A6A A;  4LF7 E;  2L33 A;  4M9V C;  4YY3 E;  2RS7 A;  3L00 A;  4GZN C;  5DNY A;  2LO3 A;  2EPX A;  4BS9 A;  2EJ4 A;  2JWO A;  2B9D A;  2WCC 3;  1IBL E;  2MKN A;  5F3W A;  3VK6 A;  4X62 E;  2L6M A;  5A6J A;  2L2M A;  5LLQ A;  2R1F A;  4MLQ A;  4B3R E;  1RMD A;  5AE2 A;  3QG5 C;  2CT1 A; 
#chains in the Genus database with same CATH homology
 1F2I G;  1X6H A;  2YTN A;  1NCS A;  2EQ1 A;  2EPR A;  2MDG A;  2EPC A;  1X5W A;  1YUI A;  2DRP A;  4F6M A;  1Z1B A;  2EE8 A;  2YRK A;  2DLK A;  2EOY A;  2EM5 A;  1KJK A;  2EM4 A;  2CTD A;  1A1G A;  1WJP A;  1G2D C;  2EMZ A;  1YSA C;  1BBO A;  2EOJ A;  2EOX A;  3EPJ A;  3MHS C;  2EM0 A;  2EL4 A;  2EMX A;  1X6F A;  3EPK A;  1TF6 A;  1ZR9 A;  2GLI A;  1UN6 B;  2EOM A;  1A1F A;  2LT7 A;  2ELY A;  2YTP A;  2BB8 A;  1X3C A;  1X6E A;  3M99 B;  4R2D A;  4F2J C;  4R2E A;  2E72 A;  2EOF A;  2LVH A;  2RSI A;  2YTF A;  3VHT B;  4R2A A;  2EL6 A;  1A1H A;  4F6N A;  2EPZ A;  2EN2 A;  2EOZ A;  2PRT A;  1A1K A;  2YTO A;  2DGC A;  2YTG A;  2CSH A;  2EMF A;  1A1L A;  2EMK A;  2EPA A;  2MKD A;  2EMW A;  1P47 A;  4IS1 C;  2WBU A;  2VRD A;  5KL4 A;  2EN4 A;  2WBT A;  2EN8 A;  1LLM C;  2DMI A;  2EM6 A;  2EN3 A;  2EMI A;  2ADR A;  2NAB A;  4IJD A;  2YTI A;  1MEY C;  2HGH A;  1B69 A;  2EN7 A;  1G2F C;  1UBD C;  1BB8 A;  2EM7 A;  2EOH A;  2EN6 A;  2EMY A;  2YTE A;  2EOS A;  5KL7 A;  4R2P A;  1ZAA C;  2A25 A;  2EM2 A;  2YU8 A;  4FK5 C;  2EMA A;  2YRH A;  2EQ0 A;  5KL5 A;  5KL6 A;  1TN9 A;  2JP9 A;  2LV2 A;  2ENA A;  1JK2 A;  2EMB A;  2EMG A;  2ENC A;  2EM9 A;  2EMC A;  2EOR A;  2EOI A;  3EPL A;  1JK1 A;  2EML A;  3MHH C;  2EMH A;  2EOO A;  1ZU1 A;  2ENH A;  2ELZ A;  2YTD A;  2YSO A;  2CT1 A;  2LCE A;  4R2Q A;  2J7J A;  3UK3 C;  1TF3 A;  2M9A A;  2WBS A;  2YTQ A;  2D9H A;  2EL5 A;  2RPC A;  3EPH A;  2EOQ A;  2YRM A;  5KL3 A;  2EOE A;  2YTJ A;  4M9V C;  4GZN C;  2LO3 A;  2EPX A;  2EP3 A;  2EPP A;  5KL2 A;  2JPA A;  1YUJ A;  2YSP A;  2EJ4 A;  2DLQ A;  4R2S A;  2I13 A;  2WCC 3;  4WSG A;  2MKN A;  1AAY A;  2EM8 A;  4R2C A;  2EN1 A;  2YU5 A;  4X9J A;  4R2R A;  2R1F A;  2GHF A;  1RMD A;  1A1J A;  2EQ3 A;  1A1I A;  2EM3 A;  1DGC A;  2EPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...