2EQ0A

Solution structure of the 8th c2h2 type zinc finger domain of zinc finger protein 347
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYKCHECGKVFRRNSHLARHQLIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Zinc finger protein 347
publication title Solution structure of the 8th C2H2 type zinc finger domain of Zinc finger protein 347
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eq0A01
4X9JA 4GZNC 2EOFA 1X6FA 2EMXA 2EMHA 5KL7A 2EJ4A 1B69A 3EPKA 2YTFA 1A1IA 2EPAA 2GLIA 2ENHA 2JP9A 1UN6B 2LVHA 2EM8A 2JPAA 2MDGA 2YTPA 2VRDA 1G2DC 2CTDA 2EM6A 2MKDA 2EOQA 1YUJA 2CT1A 2EN7A 2WBUA 1G2FC 1RMDA 2EL4A 2EPZA 2EM4A 2D9HA 2J7JA 2YTQA 1A1JA 2EQ3A 2WBSA 2M9AA 1DGCA 2EM3A 2EM9A 2EMBA 2RSIA 1NCSA 2EM2A 5KL4A 2YTDA 2YTOA 2EMCA 1ZU1A 2YTEA 1AAYA 2ADRA 2BB8A 2EMLA 2EOOA 2YTGA 2DLQA 4R2RA 2DLKA 2EOHA 2EE8A 2GHFA 2YTIA 3M99B 1A1HA 1TF3A 4R2PA 2EMZA 2YSOA 2ELZA 2EOMA 2EM0A 2YU8A 1X6EA 2EP3A 2EM5A 4R2QA 2YSPA 1KJKA 1LLMC 2EPUA 2EOEA 2YTNA 2EOYA 4R2EA 2ENAA 2YTJA 1Z1BA 2EN3A 4M9VC 2WBTA 4R2SA 2EN2A 2EQ1A 4IS1C 1UBDC 3EPHA 4F6NA 2EL6A 5KL3A 2EMKA 2NABA 2R1FA 2ELYA 3EPLA 2EOXA 5KL2A 1A1FA 1TF6A 1A1LA 2DGCA 2EPCA 1X6HA 2EPRA 4FK5C 3EPJA 1MEYC 3MHSC 2YRKA 2LT7A 2EOZA 4R2CA 2WCC3 2MKNA 2A25A 2EMAA 1YUIA 2EM7A 2EORA 1BB8A 1X5WA 2EMFA 2PRTA 1BBOA 2LO3A 2ENCA 2RPCA 2EMIA 1JK1A 2E72A 4R2AA 1F2IG 2YRMA 2EN6A 3MHHC 2EMYA 1JK2A 1A1KA 4R2DA 1ZAAC 2EN4A 4WSGA 1TN9A 2EPPA 4F6MA 1A1GA 2LV2A 5KL6A 2EMGA 2EOJA 2YRHA 4IJDA 2EPXA 2EL5A 2CSHA 1P47A 1X3CA 2LCEA 2DRPA 2HGHA 5KL5A 2EQ0A 2EMWA 2YU5A 2I13A 1YSAC 2EOSA 2EN1A 3UK3C 1WJPA 4F2JC 1ZR9A 2EN8A 2EOIA 2DMIA 3VHTB
chains in the Genus database with same CATH superfamily
4X9JA 1YYWA 2JR1A 4O43A 5KL7A 5A6BA 3VHTB 2YPNA 1N34E 1XMQE 4P78A 4KZSA 3JAMC 2MKDA 2EM6A 3J81C 2L8TA 1G2FC 2EN7A 4L8NA 3ADGA 5TSEA 1SR9A 1YPNA 5T6JA 2YTQA 2B3TB 1IQOA 5A2QC 4DMIA 4WSPA 2H36X 1NCSA 4BBYA 4X64E 1L4SA 2JVAA 4KHPE 2YTDA 4NXNE 1STUA 2EMCA 1AAYA 2HHHE 2ADRA 2BB8A 3IWDA 2YTGA 5ADZA 4R2RA 2DLKA 2EOHA 2GHFA 3M99B 2YTIA 2EMZA 2YSOA 1YYOA 1WHNA 1RC7A 2FTXB 1ZBTA 2FV4B 2JOBA 2EP3A 2V83A 1LLMC 5A6JA 2EOYA 4LFCE 3LLHA 2EN3A 2EPKX 2YT4A 2EWLA 2VE7C 3EPHA 1I94E 5KL3A 4JI6E 2FGGA 3EPLA 3HPZA 5KL2A 4X62E 1TF6A 5F3WA 4DV7E 1J5EE 1X6HA 2NUGA 3MHSC 1IMUA 2DB2A 1HR0E 5A6KA 4DV3E 1X49A 4BCAA 2V88A 4M2ZA 2MC5A 2LE2A 4DV5E 4B3RE 2JY9A 2LUQA 1BBOA 2F8BA 5AC4A 2B7VA 2L3JA 3VYXA 2L2KB 2KHXA 1HNZE 1F2IG 2LMZA 3T1HE 1A1KA 1UN6B 1DQ3A 4ZYDA 1TN9A 2LV2A 5KL6A 2L3CA 2EOJA 2YRHA 2YZTA 4IJDA 4JI1E 3KZYA 4BC9A 4ZYEA 2K4VA 1DI2A 1MGTA 2G7HA 2DRPA 4NHRA 4AQYE 2LBSB 1YSAC 1QNTA 1WXRA 3KZZA 2EPMX 4F2JC 1YYKA 4M0VA 1PJTA 5AE1A 4DR3E 2RSMA 2M7QA 2EOFA 2LJUA 4GZNC 4WPYA 3IWCA 4GKJE 2LUPB 3EPKA 2GLIA 4Q35B 5AE2A 2LVHA 1EH6A 2YTPA 1X47A 2VRDA 4OOGC 4LTYA 3VK6A 2CT1A 2WBUA 2EM4A 4RHBB 2N3HA 1O0WA 1J26A 3F6GA 3MSWA 2K7IA 2WBSA 2ZM6E 5IT9C 4N4RB 2V85A 1T4LB 4HTGA 4X8WA 1FJGE 2M1SA 1GZ6A 2I9IA 3DJWA 2YTOA 3HQ1A 1N3GA 2IHR1 2YTEA 2EOOA 4Q28A 3TQMA 1A1HA 3BF2A 5LLQA 4R2PA 1XMOE 1PKPA 2KONA 2N8XA 2EOMA 2EPLX 4WFTA 2EM0A 3ADJA 1IQSA 2EM5A 4R2QA 2YSPA 4WXDA 4R2EA 4NXME 2ENAA 3P1XA 2WBTA 2GPIA 4M30A 4IS1C 3J7AG 2R1FA 2EOXA 4JI3E 1WHQA 2EPCA 3EPJA 5A6BD 1GTKA 4LFBE 2WZOA 4F9CB 4B3SE 3VYYA 2EMAA 4R8OA 1YUIA 4BS9A 5AC5A 2BBGA 2EMFA 2VF1A 2PRTA 4DR2E 2L2NA 2JYAA 2EMIA 2DIXA 2F4VE 2LTSA 2YRMA 4YHHE 4DUZE 2EMYA 1N36E 2YWQA 4F6MA 3AUZA 2EL5A 2LRSA 2B7TA 5KL5A 2L33A 1WJPA 4DUYE 1T39A 2V89A 2EN8A 3DF6A 4B3ME 4DV1E 1XNQE 3BBGA 2EJ4A 2YTFA 4WX9A 2ENHA 4MLQA 2JP9A 2EM8A 2MDGA 3LMLA 2CTDA 4O4KA 3C6MA 3QG5C 1RMDA 2EL4A 4X66E 1UHZA 1XNRE 1AH5A 3AV0A 4O5GA 1HNWE 4DR1E 4DR6E 2M4IA 4LF7E 2RSIA 2LJHA 5KL4A 3L00A 4X65E 4TUIA 3THNA 1ZU1A 2EMLA 5AASA 2DLQA 3ADLA 4OX9E 4HEIA 2RTXA 3C4BA 4ZYGA 1X6EA 2MC6A 3JU0A 4WXCA 2UXCE 1KJKA 2EPUA 2YTNA 4F9AB 2NUFA 1RQ0A 2EN2A 4F9BB 5A69A 4K0KE 2N3GA 4WYQB 4F6NA 2EL6A 2EMKA 2NABA 2NA2A 2ELYA 1A1LA 2Q8UA 2DGCA 4BMJA 1HNXE 1MEYC 2YRKA 5AE3A 2EOZA 1KYQA 2WCC3 4O24A 4L5NC 3ZOQB 1IBKE 2B9DA 4DR5E 4LF4E 1BB8A 1IBLE 2LO3A 3T1YE 1JK1A 2L6MA 2UUBE 2E72A 4R2AA 2R76A 3MHHC 2NUEA 4R2DA 2EN4A 4WSGA 2EMGA 2UXBE 2MDRA 4LF9E 2EPXA 3BIDA 3ECRA 2CSHA 1P47A 4LF8E 2VQFE 2HGHA 4LU9A 1IBME 2UU9E 3JTZA 2EZ6A 2YU5A 2I13A 2EOSA 2EN1A 5LMUE 3UK3C 4JI5E 2UUCE 5FLXC 2EPNA 2UXDE 1SFEA 4JI8E 2V87A 1X6FA 4KWYA 4DKKA 2EMXA 2EMHA 5LMNE 1YFHA 1B69A 1A1IA 2EPAA 5A6AA 2LTRA 4LF6E 2HJJA 2JPAA 1UILA 3HPSA 2V8QB 1N33E 1G2DC 5LL6R 2EOQA 4DV0E 2V86A 1YUJA 5IXMB 1T38A 1N32E 5DNYA 2EPZA 2E1MA 2D9HA 2J7JA 1A1JA 1EH7A 2EQ3A 1DGCA 2M9AA 2EM3A 2DMYA 3THOB 2EM9A 4JV5E 2EMBA 4JI0E 2KOUA 3HTXA 4DR7E 4LF5E 4DV2E 4DR4E 2EM2A 2HC5A 1EH8A 4NZVA 2L2MA 1EKZA 2EE8A 1TF3A 5BR8E 1X48A 2ODRC 2ELZA 5IV8B 2YU8A 4BHBA 3KWRA 2EOEA 4JI4E 1Z1BA 4J8ZA 2YTJA 2CPNA 4M9VC 4R2SA 2JWOA 4JYAE 2EQ1A 2JOXA 1UBDC 2UUAE 2JXPA 4ZYHA 3EQ1A 1A1FA 1QU6A 3OMLA 4RH8A 2EPRA 4FK5C 4P7DA 4JI7E 2RS7A 1YZ9A 2LT7A 1PJSA 4R2CA 3OTOE 4JI2E 2MKNA 1ZBQA 2A25A 3C4TA 3FIGA 4DV4E 3HXLA 2E5LE 2EM7A 4DV6E 2EORA 1X5WA 2RS6A 4GKKE 4TUGA 4I8OA 2ENCA 3J7Yp 2RPCA 3IWBA 3BGHA 3ADIA 4MLVA 2EN6A 1ZAAC 1T4OA 1JK2A 2EPOA 5CFFE 2EPPA 1A1GA 4B3TE 4LFAE 3RMPA 4BHCA 2RQLA 2DSYA 2ODRD 1X3CA 2LCEA 4GEQB 1BBGA 1PDAA 5IWAE 1FKAE 2EQ0A 1PJQA 2L92A 2EMWA 3F6HA 3K6QA 4YY3E 1GQEA 2VQEE 3C6KA 4R03A 1NEIA 4F54A 3H09A 1T4NA 3J80C 1ZR9A 2EOIA 2DMIA 1WRJA 4BC7A
chains in the Genus database with same CATH topology
4X9JA 4GZNC 2EOFA 1X6FA 2EMXA 2EMHA 5KL7A 2EJ4A 1B69A 3EPKA 2YTFA 1A1IA 2EPAA 2GLIA 2ENHA 2JP9A 1UN6B 2LVHA 2EM8A 2JPAA 2MDGA 2YTPA 2VRDA 1G2DC 2CTDA 2EM6A 2MKDA 2EOQA 1YUJA 2CT1A 2EN7A 2WBUA 1G2FC 1RMDA 2EL4A 2EPZA 2EM4A 2D9HA 2J7JA 2YTQA 1A1JA 2EQ3A 2WBSA 2M9AA 1DGCA 2EM3A 2EM9A 2EMBA 2RSIA 1NCSA 2EM2A 5KL4A 2YTDA 2YTOA 2EMCA 1ZU1A 2YTEA 1AAYA 2ADRA 2BB8A 2EMLA 2EOOA 2YTGA 2DLQA 4R2RA 2DLKA 2EOHA 2EE8A 2GHFA 2YTIA 3M99B 1A1HA 1TF3A 4R2PA 2EMZA 2YSOA 2ELZA 2EOMA 2EM0A 2YU8A 1X6EA 2EP3A 2EM5A 4R2QA 2YSPA 1KJKA 1LLMC 2EPUA 2EOEA 2YTNA 2EOYA 4R2EA 2ENAA 2YTJA 1Z1BA 2EN3A 4M9VC 2WBTA 4R2SA 2EN2A 2EQ1A 4IS1C 1UBDC 3EPHA 4F6NA 2EL6A 5KL3A 2EMKA 2NABA 2R1FA 2ELYA 3EPLA 2EOXA 5KL2A 1A1FA 1TF6A 1A1LA 2DGCA 2EPCA 1X6HA 2EPRA 4FK5C 3EPJA 1MEYC 3MHSC 2YRKA 2LT7A 2EOZA 4R2CA 2WCC3 2MKNA 2A25A 2EMAA 1YUIA 2EM7A 2EORA 1BB8A 1X5WA 2EMFA 2PRTA 1BBOA 2LO3A 2ENCA 2RPCA 2EMIA 1JK1A 2E72A 4R2AA 1F2IG 2YRMA 2EN6A 3MHHC 2EMYA 1JK2A 1A1KA 4R2DA 1ZAAC 2EN4A 4WSGA 1TN9A 2EPPA 4F6MA 1A1GA 2LV2A 5KL6A 2EMGA 2EOJA 2YRHA 4IJDA 2EPXA 2EL5A 2CSHA 1P47A 1X3CA 2LCEA 2DRPA 2HGHA 5KL5A 2EQ0A 2EMWA 2YU5A 2I13A 1YSAC 2EOSA 2EN1A 3UK3C 1WJPA 4F2JC 1ZR9A 2EN8A 2EOIA 2DMIA 3VHTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X9J A;  4GZN C;  2EOF A;  1X6F A;  2EMX A;  2EMH A;  5KL7 A;  2EJ4 A;  1B69 A;  3EPK A;  2YTF A;  1A1I A;  2EPA A;  2GLI A;  2ENH A;  2JP9 A;  1UN6 B;  2LVH A;  2EM8 A;  2JPA A;  2MDG A;  2YTP A;  2VRD A;  1G2D C;  2CTD A;  2EM6 A;  2MKD A;  2EOQ A;  1YUJ A;  2CT1 A;  2EN7 A;  2WBU A;  1G2F C;  1RMD A;  2EL4 A;  2EPZ A;  2EM4 A;  2D9H A;  2J7J A;  2YTQ A;  1A1J A;  2EQ3 A;  2WBS A;  2M9A A;  1DGC A;  2EM3 A;  2EM9 A;  2EMB A;  2RSI A;  1NCS A;  2EM2 A;  5KL4 A;  2YTD A;  2YTO A;  2EMC A;  1ZU1 A;  2YTE A;  1AAY A;  2ADR A;  2BB8 A;  2EML A;  2EOO A;  2YTG A;  2DLQ A;  4R2R A;  2DLK A;  2EOH A;  2EE8 A;  2GHF A;  2YTI A;  3M99 B;  1A1H A;  1TF3 A;  4R2P A;  2EMZ A;  2YSO A;  2ELZ A;  2EOM A;  2EM0 A;  2YU8 A;  1X6E A;  2EP3 A;  2EM5 A;  4R2Q A;  2YSP A;  1KJK A;  1LLM C;  2EPU A;  2EOE A;  2YTN A;  2EOY A;  4R2E A;  2ENA A;  2YTJ A;  1Z1B A;  2EN3 A;  4M9V C;  2WBT A;  4R2S A;  2EN2 A;  2EQ1 A;  4IS1 C;  1UBD C;  3EPH A;  4F6N A;  2EL6 A;  5KL3 A;  2EMK A;  2NAB A;  2R1F A;  2ELY A;  3EPL A;  2EOX A;  5KL2 A;  1A1F A;  1TF6 A;  1A1L A;  2DGC A;  2EPC A;  1X6H A;  2EPR A;  4FK5 C;  3EPJ A;  1MEY C;  3MHS C;  2YRK A;  2LT7 A;  2EOZ A;  4R2C A;  2WCC 3;  2MKN A;  2A25 A;  2EMA A;  1YUI A;  2EM7 A;  2EOR A;  1BB8 A;  1X5W A;  2EMF A;  2PRT A;  1BBO A;  2LO3 A;  2ENC A;  2RPC A;  2EMI A;  1JK1 A;  2E72 A;  4R2A A;  1F2I G;  2YRM A;  2EN6 A;  3MHH C;  2EMY A;  1JK2 A;  1A1K A;  4R2D A;  1ZAA C;  2EN4 A;  4WSG A;  1TN9 A;  2EPP A;  4F6M A;  1A1G A;  2LV2 A;  5KL6 A;  2EMG A;  2EOJ A;  2YRH A;  4IJD A;  2EPX A;  2EL5 A;  2CSH A;  1P47 A;  1X3C A;  2LCE A;  2DRP A;  2HGH A;  5KL5 A;  2EQ0 A;  2EMW A;  2YU5 A;  2I13 A;  1YSA C;  2EOS A;  2EN1 A;  3UK3 C;  1WJP A;  4F2J C;  1ZR9 A;  2EN8 A;  2EOI A;  2DMI A;  3VHT B; 
#chains in the Genus database with same CATH topology
 4X9J A;  1YYW A;  2JR1 A;  4O43 A;  5KL7 A;  5A6B A;  3VHT B;  2YPN A;  1N34 E;  1XMQ E;  4P78 A;  4KZS A;  3JAM C;  2MKD A;  2EM6 A;  3J81 C;  2L8T A;  1G2F C;  2EN7 A;  4L8N A;  3ADG A;  5TSE A;  1SR9 A;  1YPN A;  5T6J A;  2YTQ A;  2B3T B;  1IQO A;  5A2Q C;  4DMI A;  4WSP A;  2H36 X;  1NCS A;  4BBY A;  4X64 E;  1L4S A;  2JVA A;  4KHP E;  2YTD A;  4NXN E;  1STU A;  2EMC A;  1AAY A;  2HHH E;  2ADR A;  2BB8 A;  3IWD A;  2YTG A;  5ADZ A;  4R2R A;  2DLK A;  2EOH A;  2GHF A;  3M99 B;  2YTI A;  2EMZ A;  2YSO A;  1YYO A;  1WHN A;  1RC7 A;  2FTX B;  1ZBT A;  2FV4 B;  2JOB A;  2EP3 A;  2V83 A;  1LLM C;  5A6J A;  2EOY A;  4LFC E;  3LLH A;  2EN3 A;  2EPK X;  2YT4 A;  2EWL A;  2VE7 C;  3EPH A;  1I94 E;  5KL3 A;  4JI6 E;  2FGG A;  3EPL A;  3HPZ A;  5KL2 A;  4X62 E;  1TF6 A;  5F3W A;  4DV7 E;  1J5E E;  1X6H A;  2NUG A;  3MHS C;  1IMU A;  2DB2 A;  1HR0 E;  5A6K A;  4DV3 E;  1X49 A;  4BCA A;  2V88 A;  4M2Z A;  2MC5 A;  2LE2 A;  4DV5 E;  4B3R E;  2JY9 A;  2LUQ A;  1BBO A;  2F8B A;  5AC4 A;  2B7V A;  2L3J A;  3VYX A;  2L2K B;  2KHX A;  1HNZ E;  1F2I G;  2LMZ A;  3T1H E;  1A1K A;  1UN6 B;  1DQ3 A;  4ZYD A;  1TN9 A;  2LV2 A;  5KL6 A;  2L3C A;  2EOJ A;  2YRH A;  2YZT A;  4IJD A;  4JI1 E;  3KZY A;  4BC9 A;  4ZYE A;  2K4V A;  1DI2 A;  1MGT A;  2G7H A;  2DRP A;  4NHR A;  4AQY E;  2LBS B;  1YSA C;  1QNT A;  1WXR A;  3KZZ A;  2EPM X;  4F2J C;  1YYK A;  4M0V A;  1PJT A;  5AE1 A;  4DR3 E;  2RSM A;  2M7Q A;  2EOF A;  2LJU A;  4GZN C;  4WPY A;  3IWC A;  4GKJ E;  2LUP B;  3EPK A;  2GLI A;  4Q35 B;  5AE2 A;  2LVH A;  1EH6 A;  2YTP A;  1X47 A;  2VRD A;  4OOG C;  4LTY A;  3VK6 A;  2CT1 A;  2WBU A;  2EM4 A;  4RHB B;  2N3H A;  1O0W A;  1J26 A;  3F6G A;  3MSW A;  2K7I A;  2WBS A;  2ZM6 E;  5IT9 C;  4N4R B;  2V85 A;  1T4L B;  4HTG A;  4X8W A;  1FJG E;  2M1S A;  1GZ6 A;  2I9I A;  3DJW A;  2YTO A;  3HQ1 A;  1N3G A;  2IHR 1;  2YTE A;  2EOO A;  4Q28 A;  3TQM A;  1A1H A;  3BF2 A;  5LLQ A;  4R2P A;  1XMO E;  1PKP A;  2KON A;  2N8X A;  2EOM A;  2EPL X;  4WFT A;  2EM0 A;  3ADJ A;  1IQS A;  2EM5 A;  4R2Q A;  2YSP A;  4WXD A;  4R2E A;  4NXM E;  2ENA A;  3P1X A;  2WBT A;  2GPI A;  4M30 A;  4IS1 C;  3J7A G;  2R1F A;  2EOX A;  4JI3 E;  1WHQ A;  2EPC A;  3EPJ A;  5A6B D;  1GTK A;  4LFB E;  2WZO A;  4F9C B;  4B3S E;  3VYY A;  2EMA A;  4R8O A;  1YUI A;  4BS9 A;  5AC5 A;  2BBG A;  2EMF A;  2VF1 A;  2PRT A;  4DR2 E;  2L2N A;  2JYA A;  2EMI A;  2DIX A;  2F4V E;  2LTS A;  2YRM A;  4YHH E;  4DUZ E;  2EMY A;  1N36 E;  2YWQ A;  4F6M A;  3AUZ A;  2EL5 A;  2LRS A;  2B7T A;  5KL5 A;  2L33 A;  1WJP A;  4DUY E;  1T39 A;  2V89 A;  2EN8 A;  3DF6 A;  4B3M E;  4DV1 E;  1XNQ E;  3BBG A;  2EJ4 A;  2YTF A;  4WX9 A;  2ENH A;  4MLQ A;  2JP9 A;  2EM8 A;  2MDG A;  3LML A;  2CTD A;  4O4K A;  3C6M A;  3QG5 C;  1RMD A;  2EL4 A;  4X66 E;  1UHZ A;  1XNR E;  1AH5 A;  3AV0 A;  4O5G A;  1HNW E;  4DR1 E;  4DR6 E;  2M4I A;  4LF7 E;  2RSI A;  2LJH A;  5KL4 A;  3L00 A;  4X65 E;  4TUI A;  3THN A;  1ZU1 A;  2EML A;  5AAS A;  2DLQ A;  3ADL A;  4OX9 E;  4HEI A;  2RTX A;  3C4B A;  4ZYG A;  1X6E A;  2MC6 A;  3JU0 A;  4WXC A;  2UXC E;  1KJK A;  2EPU A;  2YTN A;  4F9A B;  2NUF A;  1RQ0 A;  2EN2 A;  4F9B B;  5A69 A;  4K0K E;  2N3G A;  4WYQ B;  4F6N A;  2EL6 A;  2EMK A;  2NAB A;  2NA2 A;  2ELY A;  1A1L A;  2Q8U A;  2DGC A;  4BMJ A;  1HNX E;  1MEY C;  2YRK A;  5AE3 A;  2EOZ A;  1KYQ A;  2WCC 3;  4O24 A;  4L5N C;  3ZOQ B;  1IBK E;  2B9D A;  4DR5 E;  4LF4 E;  1BB8 A;  1IBL E;  2LO3 A;  3T1Y E;  1JK1 A;  2L6M A;  2UUB E;  2E72 A;  4R2A A;  2R76 A;  3MHH C;  2NUE A;  4R2D A;  2EN4 A;  4WSG A;  2EMG A;  2UXB E;  2MDR A;  4LF9 E;  2EPX A;  3BID A;  3ECR A;  2CSH A;  1P47 A;  4LF8 E;  2VQF E;  2HGH A;  4LU9 A;  1IBM E;  2UU9 E;  3JTZ A;  2EZ6 A;  2YU5 A;  2I13 A;  2EOS A;  2EN1 A;  5LMU E;  3UK3 C;  4JI5 E;  2UUC E;  5FLX C;  2EPN A;  2UXD E;  1SFE A;  4JI8 E;  2V87 A;  1X6F A;  4KWY A;  4DKK A;  2EMX A;  2EMH A;  5LMN E;  1YFH A;  1B69 A;  1A1I A;  2EPA A;  5A6A A;  2LTR A;  4LF6 E;  2HJJ A;  2JPA A;  1UIL A;  3HPS A;  2V8Q B;  1N33 E;  1G2D C;  5LL6 R;  2EOQ A;  4DV0 E;  2V86 A;  1YUJ A;  5IXM B;  1T38 A;  1N32 E;  5DNY A;  2EPZ A;  2E1M A;  2D9H A;  2J7J A;  1A1J A;  1EH7 A;  2EQ3 A;  1DGC A;  2M9A A;  2EM3 A;  2DMY A;  3THO B;  2EM9 A;  4JV5 E;  2EMB A;  4JI0 E;  2KOU A;  3HTX A;  4DR7 E;  4LF5 E;  4DV2 E;  4DR4 E;  2EM2 A;  2HC5 A;  1EH8 A;  4NZV A;  2L2M A;  1EKZ A;  2EE8 A;  1TF3 A;  5BR8 E;  1X48 A;  2ODR C;  2ELZ A;  5IV8 B;  2YU8 A;  4BHB A;  3KWR A;  2EOE A;  4JI4 E;  1Z1B A;  4J8Z A;  2YTJ A;  2CPN A;  4M9V C;  4R2S A;  2JWO A;  4JYA E;  2EQ1 A;  2JOX A;  1UBD C;  2UUA E;  2JXP A;  4ZYH A;  3EQ1 A;  1A1F A;  1QU6 A;  3OML A;  4RH8 A;  2EPR A;  4FK5 C;  4P7D A;  4JI7 E;  2RS7 A;  1YZ9 A;  2LT7 A;  1PJS A;  4R2C A;  3OTO E;  4JI2 E;  2MKN A;  1ZBQ A;  2A25 A;  3C4T A;  3FIG A;  4DV4 E;  3HXL A;  2E5L E;  2EM7 A;  4DV6 E;  2EOR A;  1X5W A;  2RS6 A;  4GKK E;  4TUG A;  4I8O A;  2ENC A;  3J7Y p;  2RPC A;  3IWB A;  3BGH A;  3ADI A;  4MLV A;  2EN6 A;  1ZAA C;  1T4O A;  1JK2 A;  2EPO A;  5CFF E;  2EPP A;  1A1G A;  4B3T E;  4LFA E;  3RMP A;  4BHC A;  2RQL A;  2DSY A;  2ODR D;  1X3C A;  2LCE A;  4GEQ B;  1BBG A;  1PDA A;  5IWA E;  1FKA E;  2EQ0 A;  1PJQ A;  2L92 A;  2EMW A;  3F6H A;  3K6Q A;  4YY3 E;  1GQE A;  2VQE E;  3C6K A;  4R03 A;  1NEI A;  4F54 A;  3H09 A;  1T4N A;  3J80 C;  1ZR9 A;  2EOI A;  2DMI A;  1WRJ A;  4BC7 A; 
#chains in the Genus database with same CATH homology
 4X9J A;  4GZN C;  2EOF A;  1X6F A;  2EMX A;  2EMH A;  5KL7 A;  2EJ4 A;  1B69 A;  3EPK A;  2YTF A;  1A1I A;  2EPA A;  2GLI A;  2ENH A;  2JP9 A;  1UN6 B;  2LVH A;  2EM8 A;  2JPA A;  2MDG A;  2YTP A;  2VRD A;  1G2D C;  2CTD A;  2EM6 A;  2MKD A;  2EOQ A;  1YUJ A;  2CT1 A;  2EN7 A;  2WBU A;  1G2F C;  1RMD A;  2EL4 A;  2EPZ A;  2EM4 A;  2D9H A;  2J7J A;  2YTQ A;  1A1J A;  2EQ3 A;  2WBS A;  2M9A A;  1DGC A;  2EM3 A;  2EM9 A;  2EMB A;  2RSI A;  1NCS A;  2EM2 A;  5KL4 A;  2YTD A;  2YTO A;  2EMC A;  1ZU1 A;  2YTE A;  1AAY A;  2ADR A;  2BB8 A;  2EML A;  2EOO A;  2YTG A;  2DLQ A;  4R2R A;  2DLK A;  2EOH A;  2EE8 A;  2GHF A;  2YTI A;  3M99 B;  1A1H A;  1TF3 A;  4R2P A;  2EMZ A;  2YSO A;  2ELZ A;  2EOM A;  2EM0 A;  2YU8 A;  1X6E A;  2EP3 A;  2EM5 A;  4R2Q A;  2YSP A;  1KJK A;  1LLM C;  2EPU A;  2EOE A;  2YTN A;  2EOY A;  4R2E A;  2ENA A;  2YTJ A;  1Z1B A;  2EN3 A;  4M9V C;  2WBT A;  4R2S A;  2EN2 A;  2EQ1 A;  4IS1 C;  1UBD C;  3EPH A;  4F6N A;  2EL6 A;  5KL3 A;  2EMK A;  2NAB A;  2R1F A;  2ELY A;  3EPL A;  2EOX A;  5KL2 A;  1A1F A;  1TF6 A;  1A1L A;  2DGC A;  2EPC A;  1X6H A;  2EPR A;  4FK5 C;  3EPJ A;  1MEY C;  3MHS C;  2YRK A;  2LT7 A;  2EOZ A;  4R2C A;  2WCC 3;  2MKN A;  2A25 A;  2EMA A;  1YUI A;  2EM7 A;  2EOR A;  1BB8 A;  1X5W A;  2EMF A;  2PRT A;  1BBO A;  2LO3 A;  2ENC A;  2RPC A;  2EMI A;  1JK1 A;  2E72 A;  4R2A A;  1F2I G;  2YRM A;  2EN6 A;  3MHH C;  2EMY A;  1JK2 A;  1A1K A;  4R2D A;  1ZAA C;  2EN4 A;  4WSG A;  1TN9 A;  2EPP A;  4F6M A;  1A1G A;  2LV2 A;  5KL6 A;  2EMG A;  2EOJ A;  2YRH A;  4IJD A;  2EPX A;  2EL5 A;  2CSH A;  1P47 A;  1X3C A;  2LCE A;  2DRP A;  2HGH A;  5KL5 A;  2EQ0 A;  2EMW A;  2YU5 A;  2I13 A;  1YSA C;  2EOS A;  2EN1 A;  3UK3 C;  1WJP A;  4F2J C;  1ZR9 A;  2EN8 A;  2EOI A;  2DMI A;  3VHT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...