2EN2A

Solution structure of the c2h2 type zinc finger (region 598-626) of human b-cell lymphoma 6 protein
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
42
structure length
42
Chain Sequence
GSSGSSGGEKPYKCETCGARFVQVAHLRAHVLIHTGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 598-626) of human B-cell lymphoma 6 protein
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords B-cell lymphoma 6 protein
total genus 6
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2en2A01
2EPCA 2E72A 2EOXA 2GHFA 2EPPA 2EM5A 2NABA 1BB8A 2EMKA 1X6HA 2EQ0A 4IS1C 1TF3A 2I13A 1X3CA 2HGHA 2EN2A 2ENCA 2EN4A 3UK3C 2EOHA 1X6FA 2YTPA 1AAYA 2EL6A 2MDGA 3VHTB 2JPAA 2EMIA 2YRMA 2EN1A 2EN8A 2YRKA 2CSHA 2WBTA 2EOIA 2EM7A 2EOFA 2R1FA 2YTFA 2EL4A 2DGCA 2EOJA 3MHHC 2EM9A 2MKDA 2EOQA 2EMXA 1A1GA 2EQ1A 2A25A 2EPXA 2EMBA 1ZU1A 2EPZA 4R2CA 1TF6A 2EPRA 1A1IA 4X9JA 3EPHA 2EN7A 5KL2A 2J7JA 4WSGA 4R2SA 4R2AA 2EP3A 2EOMA 2EJ4A 2EOYA 2CTDA 1YUIA 2EM3A 2EORA 1A1FA 1JK1A 2YU8A 2YTGA 1P47A 2EOZA 2LCEA 4F2JC 2YTOA 2YU5A 2WCC3 2YTNA 2EOOA 1TN9A 2D9HA 3MHSC 2EMWA 1G2FC 2YTDA 2EMHA 4IJDA 4R2RA 2EE8A 2EMZA 2RPCA 2RSIA 4R2EA 2EM6A 2DLKA 2ENHA 2EQ3A 1A1JA 2ENAA 3EPJA 2DRPA 2EPUA 2YTIA 1BBOA 5KL5A 2WBSA 3EPLA 1A1HA 5KL6A 2GLIA 4M9VC 1ZR9A 2MKNA 1G2DC 2ADRA 1NCSA 2YTJA 2LV2A 4R2PA 1X6EA 2EMAA 2JP9A 2EMGA 2YTEA 3M99B 1JK2A 1RMDA 1B69A 2CT1A 2LT7A 4F6MA 1X5WA 2WBUA 2EL5A 2LO3A 2YTQA 2EMYA 2ELYA 4GZNC 2EMCA 2ELZA 1MEYC 1A1KA 2EM8A 2EOSA 1KJKA 2EM0A 1UBDC 2EM4A 1DGCA 2M9AA 4R2DA 2EMLA 1LLMC 4FK5C 2EOEA 5KL7A 1ZAAC 3EPKA 2YSPA 2EMFA 2VRDA 1WJPA 2EM2A 2YSOA 5KL3A 4R2QA 5KL4A 2EPAA 2PRTA 1A1LA 2EN3A 1YUJA 2EN6A 2BB8A 1UN6B 2LVHA 2DMIA 2YRHA 4F6NA 1F2IG 1Z1BA 2DLQA 1YSAC
chains in the Genus database with same CATH superfamily
2K7IA 3FIGA 2E72A 2EOXA 3ADGA 1SFEA 3HPSA 2FTXB 4TUIA 1BB8A 3KZZA 1X6HA 4WYQB 4X8WA 4M30A 2E1MA 4L8NA 2LUQA 4KWYA 4BC7A 2Q8UA 4DV0E 4NZVA 2JPAA 2EMIA 2YRKA 2CSHA 2JYAA 2DGCA 5A2QC 1T38A 4HTGA 3ECRA 5T6JA 2EM9A 1A1GA 2EQ1A 2EPXA 1EH6A 2EMBA 1ZU1A 4X62E 2EPKX 4R2CA 3IWDA 4BBYA 4L5NC 4X9JA 1EKZA 2LJHA 2RTXA 3BGHA 4WSGA 4R2SA 1PJQA 5LL6R 2EP3A 2EJ4A 1IMUA 4MLQA 3HXLA 4MLVA 2YT4A 3OMLA 3BBGA 1JK1A 2GPIA 2YTGA 5LMUE 1P47A 2N8XA 2EWLA 2EOZA 2LCEA 1X47A 2YU5A 2L2MA 4Q28A 2EOOA 1TN9A 3MHSC 2EMWA 4IJDA 2EMHA 4KHPE 1DQ3A 4R2RA 2EE8A 2RSIA 2E5LE 1A1JA 4BS9A 3QG5C 2YTIA 1O0WA 4DR2E 4JV5E 4WPYA 4O24A 2F4VE 1NEIA 4ZYGA 2DIXA 1HR0E 2L2NA 2MKNA 1NCSA 1KYQA 2LV2A 3EQ1A 3VK6A 2EMGA 2YTEA 2VQFE 1T39A 2LT7A 4F6MA 1XMQE 4DV5E 2LO3A 2V87A 2YTQA 5IV8B 4YHHE 2ELZA 1A1KA 4JI7E 1KJKA 1I94E 4LF4E 2CPNA 1XMOE 4NXME 1DGCA 1LLMC 2EMLA 2EOEA 3EPKA 2EMFA 1HNZE 1YUJA 4R2QA 1A1LA 2EN3A 2ODRD 2NUFA 3J80C 1UN6B 4DR6E 2YRHA 3L00A 4BMJA 1J5EE 4DV3E 1Z1BA 2KHXA 2DLQA 5IT9C 2EPCA 2V8QB 1UILA 2LJUA 4P7DA 2VF1A 2UXBE 2G7HA 1IBKE 4JI1E 2DSYA 5A6BD 2EQ0A 1TF3A 4DR7E 2EN2A 1X48A 4DR5E 2LUPB 4DKKA 2WZOA 5AC4A 4DV6E 2UUCE 1X6FA 2EL6A 4DV4E 1YYKA 4DV1E 3VHTB 2YRMA 2EN8A 4K0KE 2EL4A 4O4KA 2JR1A 1SR9A 2R76A 4F9AB 2A25A 3LMLA 5A69A 1DI2A 4WFTA 3J7AG 3BF2A 2EPZA 4LTYA 2M1SA 4WXCA 2EPNA 2UUAE 3AUZA 5AC5A 1ZBQA 4M0VA 1FKAE 5IWAE 2EPMX 4F54A 1YUIA 1A1FA 2LBSB 4LF5E 1XNRE 4F2JC 2YTOA 2LMZA 2DMYA 2M7QA 2YTNA 4DR3E 2V86A 1GTKA 1YFHA 2EMZA 2IHR1 4R2EA 1WHQA 2MDRA 2B9DA 2LE2A 5BR8E 4M2ZA 1FJGE 3HTXA 2HC5A 5KL6A 1EH8A 4LF8E 3C6KA 2NA2A 5IXMB 1PJTA 5AE2A 2UXCE 1QU6A 1G2DC 2ADRA 5AE3A 2YPNA 2LTRA 3JTZA 4R2PA 3OTOE 3THNA 5A6BA 3ADJA 3ADLA 1GZ6A 4GKJE 1XNQE 4X66E 4BC9A 2ELYA 3VYYA 2EMCA 2L2KB 2EM0A 4DUYE 1UHZA 2JY9A 1UBDC 2M9AA 3JU0A 4R2DA 3ADIA 4FK5C 2RS6A 5KL7A 2EM2A 5KL3A 2PRTA 4GEQB 2EN6A 1AH5A 1PKPA 3T1HE 4JI4E 1F2IG 1QNTA 2UXDE 2JVAA 1N34E 2MC6A 2GHFA 2NABA 4R8OA 4DV2E 3DJWA 2EMKA 1PJSA 2UUBE 2RSMA 4NXNE 2DB2A 3J81C 1X3CA 4O43A 4DUZE 2ENCA 2EN4A 3UK3C 2EOHA 3AV0A 1AAYA 4LF6E 1N3GA 2B7TA 2EN1A 2WBTA 2EM7A 2EOFA 4F9BB 1T4LB 2RS7A 2B7VA 3MSWA 1RC7A 2EOQA 2EMXA 4DR1E 3F6GA 2ZM6E 5ADZA 1N36E 1TF6A 2N3GA 4BHCA 2EPRA 1A1IA 2UU9E 2VQEE 2I9IA 4F9CB 2EN7A 5KL2A 1IBME 2EOMA 2EM3A 1L4SA 4WXDA 4GKKE 2B3TB 2YU8A 1HNXE 3BIDA 4TUGA 1RQ0A 4J8ZA 3C6MA 4B3RE 2D9HA 1G2FC 2ODRC 4DV7E 2ENHA 2JOBA 4ZYEA 4OX9E 2ENAA 3EPJA 4JI0E 4YY3E 3IWBA 1WRJA 2LTSA 2EPOA 2EPLX 1ZR9A 3KWRA 4P78A 2EMAA 2JP9A 3M99B 1JK2A 2WBUA 5AE1A 3F6HA 3TQMA 5A6AA 4RHBB 1IBLE 1WXRA 4JI8E 2EM8A 5LLQA 2EM4A 2FV4B 4JI5E 2NUGA 2YSPA 2VRDA 1WJPA 1YPNA 4BHBA 5A6KA 2EPAA 4O5GA 1PDAA 2BB8A 2H36X 1YYWA 4F6NA 2NUEA 2VE7C 4AQYE 5FLXC 1YSAC 4DR4E 5DNYA 2L6MA 2L92A 2RQLA 3HQ1A 4BCAA 3KZYA 2EPPA 4X65E 2EM5A 4B3TE 4WX9A 4I8OA 2HHHE 2I13A 4IS1C 2HGHA 1T4OA 5TSEA 3C4BA 3LLHA 1STUA 2YTPA 4LU9A 4B3ME 4X64E 5F3WA 3RMPA 1N33E 2MDGA 1YYOA 5A6JA 2L33A 4HEIA 4LFAE 2EOIA 2R1FA 2YTFA 3H09A 3C4TA 2EOJA 3MHHC 5LMNE 2MKDA 1MGTA 2L8TA 1GQEA 2V88A 2V85A 2M4IA 3T1YE 2K4VA 3EPHA 2J7JA 4R2AA 2V89A 2EOYA 2CTDA 4LFCE 2EORA 2MC5A 2FGGA 2N3HA 4RH8A 1BBGA 1ZBTA 2L3JA 2WCC3 3K6QA 2YTDA 2JXPA 2L3CA 2RPCA 2EM6A 2DLKA 2EQ3A 2EZ6A 2DRPA 1J26A 2EPUA 1YZ9A 4Q35B 5KL5A 2WBSA 3EPLA 1A1HA 1BBOA 2LRSA 3JAMC 4LF7E 5CFFE 2GLIA 4M9VC 3P1XA 4NHRA 4JI3E 2JOXA 2YTJA 4LF9E 2JWOA 1X6EA 1IQSA 3VYXA 1WHNA 4JI2E 4ZYDA 1IQOA 1RMDA 1B69A 2CT1A 3DF6A 1HNWE 2V83A 1X5WA 2EL5A 2F8BA 2EMYA 2YZTA 3ZOQB 4JYAE 4GZNC 1T4NA 4LFBE 1MEYC 2EOSA 4OOGC 1EH7A 2KOUA 4ZYHA 1X49A 3IWCA 3THOB 4R03A 2BBGA 5AASA 4DMIA 1ZAAC 2YSOA 4N4RB 4KZSA 3HPZA 5KL4A 4WSPA 4JI6E 4B3SE 3J7Yp 2LVHA 2DMIA 2YWQA 1N32E 2KONA 2HJJA
chains in the Genus database with same CATH topology
2EPCA 2E72A 2EOXA 2GHFA 2EPPA 2EM5A 2NABA 1BB8A 2EMKA 1X6HA 2EQ0A 4IS1C 1TF3A 2I13A 1X3CA 2HGHA 2EN2A 2ENCA 2EN4A 3UK3C 2EOHA 1X6FA 2YTPA 1AAYA 2EL6A 2MDGA 3VHTB 2JPAA 2EMIA 2YRMA 2EN1A 2EN8A 2YRKA 2CSHA 2WBTA 2EOIA 2EM7A 2EOFA 2R1FA 2YTFA 2EL4A 2DGCA 2EOJA 3MHHC 2EM9A 2MKDA 2EOQA 2EMXA 1A1GA 2EQ1A 2A25A 2EPXA 2EMBA 1ZU1A 2EPZA 4R2CA 1TF6A 2EPRA 1A1IA 4X9JA 3EPHA 2EN7A 5KL2A 2J7JA 4WSGA 4R2SA 4R2AA 2EP3A 2EOMA 2EJ4A 2EOYA 2CTDA 1YUIA 2EM3A 2EORA 1A1FA 1JK1A 2YU8A 2YTGA 1P47A 2EOZA 2LCEA 4F2JC 2YTOA 2YU5A 2WCC3 2YTNA 2EOOA 1TN9A 2D9HA 3MHSC 2EMWA 1G2FC 2YTDA 2EMHA 4IJDA 4R2RA 2EE8A 2EMZA 2RPCA 2RSIA 4R2EA 2EM6A 2DLKA 2ENHA 2EQ3A 1A1JA 2ENAA 3EPJA 2DRPA 2EPUA 2YTIA 1BBOA 5KL5A 2WBSA 3EPLA 1A1HA 5KL6A 2GLIA 4M9VC 1ZR9A 2MKNA 1G2DC 2ADRA 1NCSA 2YTJA 2LV2A 4R2PA 1X6EA 2EMAA 2JP9A 2EMGA 2YTEA 3M99B 1JK2A 1RMDA 1B69A 2CT1A 2LT7A 4F6MA 1X5WA 2WBUA 2EL5A 2LO3A 2YTQA 2EMYA 2ELYA 4GZNC 2EMCA 2ELZA 1MEYC 1A1KA 2EM8A 2EOSA 1KJKA 2EM0A 1UBDC 2EM4A 1DGCA 2M9AA 4R2DA 2EMLA 1LLMC 4FK5C 2EOEA 5KL7A 1ZAAC 3EPKA 2YSPA 2EMFA 2VRDA 1WJPA 2EM2A 2YSOA 5KL3A 4R2QA 5KL4A 2EPAA 2PRTA 1A1LA 2EN3A 1YUJA 2EN6A 2BB8A 1UN6B 2LVHA 2DMIA 2YRHA 4F6NA 1F2IG 1Z1BA 2DLQA 1YSAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EPC A;  2E72 A;  2EOX A;  2GHF A;  2EPP A;  2EM5 A;  2NAB A;  1BB8 A;  2EMK A;  1X6H A;  2EQ0 A;  4IS1 C;  1TF3 A;  2I13 A;  1X3C A;  2HGH A;  2EN2 A;  2ENC A;  2EN4 A;  3UK3 C;  2EOH A;  1X6F A;  2YTP A;  1AAY A;  2EL6 A;  2MDG A;  3VHT B;  2JPA A;  2EMI A;  2YRM A;  2EN1 A;  2EN8 A;  2YRK A;  2CSH A;  2WBT A;  2EOI A;  2EM7 A;  2EOF A;  2R1F A;  2YTF A;  2EL4 A;  2DGC A;  2EOJ A;  3MHH C;  2EM9 A;  2MKD A;  2EOQ A;  2EMX A;  1A1G A;  2EQ1 A;  2A25 A;  2EPX A;  2EMB A;  1ZU1 A;  2EPZ A;  4R2C A;  1TF6 A;  2EPR A;  1A1I A;  4X9J A;  3EPH A;  2EN7 A;  5KL2 A;  2J7J A;  4WSG A;  4R2S A;  4R2A A;  2EP3 A;  2EOM A;  2EJ4 A;  2EOY A;  2CTD A;  1YUI A;  2EM3 A;  2EOR A;  1A1F A;  1JK1 A;  2YU8 A;  2YTG A;  1P47 A;  2EOZ A;  2LCE A;  4F2J C;  2YTO A;  2YU5 A;  2WCC 3;  2YTN A;  2EOO A;  1TN9 A;  2D9H A;  3MHS C;  2EMW A;  1G2F C;  2YTD A;  2EMH A;  4IJD A;  4R2R A;  2EE8 A;  2EMZ A;  2RPC A;  2RSI A;  4R2E A;  2EM6 A;  2DLK A;  2ENH A;  2EQ3 A;  1A1J A;  2ENA A;  3EPJ A;  2DRP A;  2EPU A;  2YTI A;  1BBO A;  5KL5 A;  2WBS A;  3EPL A;  1A1H A;  5KL6 A;  2GLI A;  4M9V C;  1ZR9 A;  2MKN A;  1G2D C;  2ADR A;  1NCS A;  2YTJ A;  2LV2 A;  4R2P A;  1X6E A;  2EMA A;  2JP9 A;  2EMG A;  2YTE A;  3M99 B;  1JK2 A;  1RMD A;  1B69 A;  2CT1 A;  2LT7 A;  4F6M A;  1X5W A;  2WBU A;  2EL5 A;  2LO3 A;  2YTQ A;  2EMY A;  2ELY A;  4GZN C;  2EMC A;  2ELZ A;  1MEY C;  1A1K A;  2EM8 A;  2EOS A;  1KJK A;  2EM0 A;  1UBD C;  2EM4 A;  1DGC A;  2M9A A;  4R2D A;  2EML A;  1LLM C;  4FK5 C;  2EOE A;  5KL7 A;  1ZAA C;  3EPK A;  2YSP A;  2EMF A;  2VRD A;  1WJP A;  2EM2 A;  2YSO A;  5KL3 A;  4R2Q A;  5KL4 A;  2EPA A;  2PRT A;  1A1L A;  2EN3 A;  1YUJ A;  2EN6 A;  2BB8 A;  1UN6 B;  2LVH A;  2DMI A;  2YRH A;  4F6N A;  1F2I G;  1Z1B A;  2DLQ A;  1YSA C; 
#chains in the Genus database with same CATH topology
 2K7I A;  3FIG A;  2E72 A;  2EOX A;  3ADG A;  1SFE A;  3HPS A;  2FTX B;  4TUI A;  1BB8 A;  3KZZ A;  1X6H A;  4WYQ B;  4X8W A;  4M30 A;  2E1M A;  4L8N A;  2LUQ A;  4KWY A;  4BC7 A;  2Q8U A;  4DV0 E;  4NZV A;  2JPA A;  2EMI A;  2YRK A;  2CSH A;  2JYA A;  2DGC A;  5A2Q C;  1T38 A;  4HTG A;  3ECR A;  5T6J A;  2EM9 A;  1A1G A;  2EQ1 A;  2EPX A;  1EH6 A;  2EMB A;  1ZU1 A;  4X62 E;  2EPK X;  4R2C A;  3IWD A;  4BBY A;  4L5N C;  4X9J A;  1EKZ A;  2LJH A;  2RTX A;  3BGH A;  4WSG A;  4R2S A;  1PJQ A;  5LL6 R;  2EP3 A;  2EJ4 A;  1IMU A;  4MLQ A;  3HXL A;  4MLV A;  2YT4 A;  3OML A;  3BBG A;  1JK1 A;  2GPI A;  2YTG A;  5LMU E;  1P47 A;  2N8X A;  2EWL A;  2EOZ A;  2LCE A;  1X47 A;  2YU5 A;  2L2M A;  4Q28 A;  2EOO A;  1TN9 A;  3MHS C;  2EMW A;  4IJD A;  2EMH A;  4KHP E;  1DQ3 A;  4R2R A;  2EE8 A;  2RSI A;  2E5L E;  1A1J A;  4BS9 A;  3QG5 C;  2YTI A;  1O0W A;  4DR2 E;  4JV5 E;  4WPY A;  4O24 A;  2F4V E;  1NEI A;  4ZYG A;  2DIX A;  1HR0 E;  2L2N A;  2MKN A;  1NCS A;  1KYQ A;  2LV2 A;  3EQ1 A;  3VK6 A;  2EMG A;  2YTE A;  2VQF E;  1T39 A;  2LT7 A;  4F6M A;  1XMQ E;  4DV5 E;  2LO3 A;  2V87 A;  2YTQ A;  5IV8 B;  4YHH E;  2ELZ A;  1A1K A;  4JI7 E;  1KJK A;  1I94 E;  4LF4 E;  2CPN A;  1XMO E;  4NXM E;  1DGC A;  1LLM C;  2EML A;  2EOE A;  3EPK A;  2EMF A;  1HNZ E;  1YUJ A;  4R2Q A;  1A1L A;  2EN3 A;  2ODR D;  2NUF A;  3J80 C;  1UN6 B;  4DR6 E;  2YRH A;  3L00 A;  4BMJ A;  1J5E E;  4DV3 E;  1Z1B A;  2KHX A;  2DLQ A;  5IT9 C;  2EPC A;  2V8Q B;  1UIL A;  2LJU A;  4P7D A;  2VF1 A;  2UXB E;  2G7H A;  1IBK E;  4JI1 E;  2DSY A;  5A6B D;  2EQ0 A;  1TF3 A;  4DR7 E;  2EN2 A;  1X48 A;  4DR5 E;  2LUP B;  4DKK A;  2WZO A;  5AC4 A;  4DV6 E;  2UUC E;  1X6F A;  2EL6 A;  4DV4 E;  1YYK A;  4DV1 E;  3VHT B;  2YRM A;  2EN8 A;  4K0K E;  2EL4 A;  4O4K A;  2JR1 A;  1SR9 A;  2R76 A;  4F9A B;  2A25 A;  3LML A;  5A69 A;  1DI2 A;  4WFT A;  3J7A G;  3BF2 A;  2EPZ A;  4LTY A;  2M1S A;  4WXC A;  2EPN A;  2UUA E;  3AUZ A;  5AC5 A;  1ZBQ A;  4M0V A;  1FKA E;  5IWA E;  2EPM X;  4F54 A;  1YUI A;  1A1F A;  2LBS B;  4LF5 E;  1XNR E;  4F2J C;  2YTO A;  2LMZ A;  2DMY A;  2M7Q A;  2YTN A;  4DR3 E;  2V86 A;  1GTK A;  1YFH A;  2EMZ A;  2IHR 1;  4R2E A;  1WHQ A;  2MDR A;  2B9D A;  2LE2 A;  5BR8 E;  4M2Z A;  1FJG E;  3HTX A;  2HC5 A;  5KL6 A;  1EH8 A;  4LF8 E;  3C6K A;  2NA2 A;  5IXM B;  1PJT A;  5AE2 A;  2UXC E;  1QU6 A;  1G2D C;  2ADR A;  5AE3 A;  2YPN A;  2LTR A;  3JTZ A;  4R2P A;  3OTO E;  3THN A;  5A6B A;  3ADJ A;  3ADL A;  1GZ6 A;  4GKJ E;  1XNQ E;  4X66 E;  4BC9 A;  2ELY A;  3VYY A;  2EMC A;  2L2K B;  2EM0 A;  4DUY E;  1UHZ A;  2JY9 A;  1UBD C;  2M9A A;  3JU0 A;  4R2D A;  3ADI A;  4FK5 C;  2RS6 A;  5KL7 A;  2EM2 A;  5KL3 A;  2PRT A;  4GEQ B;  2EN6 A;  1AH5 A;  1PKP A;  3T1H E;  4JI4 E;  1F2I G;  1QNT A;  2UXD E;  2JVA A;  1N34 E;  2MC6 A;  2GHF A;  2NAB A;  4R8O A;  4DV2 E;  3DJW A;  2EMK A;  1PJS A;  2UUB E;  2RSM A;  4NXN E;  2DB2 A;  3J81 C;  1X3C A;  4O43 A;  4DUZ E;  2ENC A;  2EN4 A;  3UK3 C;  2EOH A;  3AV0 A;  1AAY A;  4LF6 E;  1N3G A;  2B7T A;  2EN1 A;  2WBT A;  2EM7 A;  2EOF A;  4F9B B;  1T4L B;  2RS7 A;  2B7V A;  3MSW A;  1RC7 A;  2EOQ A;  2EMX A;  4DR1 E;  3F6G A;  2ZM6 E;  5ADZ A;  1N36 E;  1TF6 A;  2N3G A;  4BHC A;  2EPR A;  1A1I A;  2UU9 E;  2VQE E;  2I9I A;  4F9C B;  2EN7 A;  5KL2 A;  1IBM E;  2EOM A;  2EM3 A;  1L4S A;  4WXD A;  4GKK E;  2B3T B;  2YU8 A;  1HNX E;  3BID A;  4TUG A;  1RQ0 A;  4J8Z A;  3C6M A;  4B3R E;  2D9H A;  1G2F C;  2ODR C;  4DV7 E;  2ENH A;  2JOB A;  4ZYE A;  4OX9 E;  2ENA A;  3EPJ A;  4JI0 E;  4YY3 E;  3IWB A;  1WRJ A;  2LTS A;  2EPO A;  2EPL X;  1ZR9 A;  3KWR A;  4P78 A;  2EMA A;  2JP9 A;  3M99 B;  1JK2 A;  2WBU A;  5AE1 A;  3F6H A;  3TQM A;  5A6A A;  4RHB B;  1IBL E;  1WXR A;  4JI8 E;  2EM8 A;  5LLQ A;  2EM4 A;  2FV4 B;  4JI5 E;  2NUG A;  2YSP A;  2VRD A;  1WJP A;  1YPN A;  4BHB A;  5A6K A;  2EPA A;  4O5G A;  1PDA A;  2BB8 A;  2H36 X;  1YYW A;  4F6N A;  2NUE A;  2VE7 C;  4AQY E;  5FLX C;  1YSA C;  4DR4 E;  5DNY A;  2L6M A;  2L92 A;  2RQL A;  3HQ1 A;  4BCA A;  3KZY A;  2EPP A;  4X65 E;  2EM5 A;  4B3T E;  4WX9 A;  4I8O A;  2HHH E;  2I13 A;  4IS1 C;  2HGH A;  1T4O A;  5TSE A;  3C4B A;  3LLH A;  1STU A;  2YTP A;  4LU9 A;  4B3M E;  4X64 E;  5F3W A;  3RMP A;  1N33 E;  2MDG A;  1YYO A;  5A6J A;  2L33 A;  4HEI A;  4LFA E;  2EOI A;  2R1F A;  2YTF A;  3H09 A;  3C4T A;  2EOJ A;  3MHH C;  5LMN E;  2MKD A;  1MGT A;  2L8T A;  1GQE A;  2V88 A;  2V85 A;  2M4I A;  3T1Y E;  2K4V A;  3EPH A;  2J7J A;  4R2A A;  2V89 A;  2EOY A;  2CTD A;  4LFC E;  2EOR A;  2MC5 A;  2FGG A;  2N3H A;  4RH8 A;  1BBG A;  1ZBT A;  2L3J A;  2WCC 3;  3K6Q A;  2YTD A;  2JXP A;  2L3C A;  2RPC A;  2EM6 A;  2DLK A;  2EQ3 A;  2EZ6 A;  2DRP A;  1J26 A;  2EPU A;  1YZ9 A;  4Q35 B;  5KL5 A;  2WBS A;  3EPL A;  1A1H A;  1BBO A;  2LRS A;  3JAM C;  4LF7 E;  5CFF E;  2GLI A;  4M9V C;  3P1X A;  4NHR A;  4JI3 E;  2JOX A;  2YTJ A;  4LF9 E;  2JWO A;  1X6E A;  1IQS A;  3VYX A;  1WHN A;  4JI2 E;  4ZYD A;  1IQO A;  1RMD A;  1B69 A;  2CT1 A;  3DF6 A;  1HNW E;  2V83 A;  1X5W A;  2EL5 A;  2F8B A;  2EMY A;  2YZT A;  3ZOQ B;  4JYA E;  4GZN C;  1T4N A;  4LFB E;  1MEY C;  2EOS A;  4OOG C;  1EH7 A;  2KOU A;  4ZYH A;  1X49 A;  3IWC A;  3THO B;  4R03 A;  2BBG A;  5AAS A;  4DMI A;  1ZAA C;  2YSO A;  4N4R B;  4KZS A;  3HPZ A;  5KL4 A;  4WSP A;  4JI6 E;  4B3S E;  3J7Y p;  2LVH A;  2DMI A;  2YWQ A;  1N32 E;  2KON A;  2HJJ A; 
#chains in the Genus database with same CATH homology
 2EPC A;  2E72 A;  2EOX A;  2GHF A;  2EPP A;  2EM5 A;  2NAB A;  1BB8 A;  2EMK A;  1X6H A;  2EQ0 A;  4IS1 C;  1TF3 A;  2I13 A;  1X3C A;  2HGH A;  2EN2 A;  2ENC A;  2EN4 A;  3UK3 C;  2EOH A;  1X6F A;  2YTP A;  1AAY A;  2EL6 A;  2MDG A;  3VHT B;  2JPA A;  2EMI A;  2YRM A;  2EN1 A;  2EN8 A;  2YRK A;  2CSH A;  2WBT A;  2EOI A;  2EM7 A;  2EOF A;  2R1F A;  2YTF A;  2EL4 A;  2DGC A;  2EOJ A;  3MHH C;  2EM9 A;  2MKD A;  2EOQ A;  2EMX A;  1A1G A;  2EQ1 A;  2A25 A;  2EPX A;  2EMB A;  1ZU1 A;  2EPZ A;  4R2C A;  1TF6 A;  2EPR A;  1A1I A;  4X9J A;  3EPH A;  2EN7 A;  5KL2 A;  2J7J A;  4WSG A;  4R2S A;  4R2A A;  2EP3 A;  2EOM A;  2EJ4 A;  2EOY A;  2CTD A;  1YUI A;  2EM3 A;  2EOR A;  1A1F A;  1JK1 A;  2YU8 A;  2YTG A;  1P47 A;  2EOZ A;  2LCE A;  4F2J C;  2YTO A;  2YU5 A;  2WCC 3;  2YTN A;  2EOO A;  1TN9 A;  2D9H A;  3MHS C;  2EMW A;  1G2F C;  2YTD A;  2EMH A;  4IJD A;  4R2R A;  2EE8 A;  2EMZ A;  2RPC A;  2RSI A;  4R2E A;  2EM6 A;  2DLK A;  2ENH A;  2EQ3 A;  1A1J A;  2ENA A;  3EPJ A;  2DRP A;  2EPU A;  2YTI A;  1BBO A;  5KL5 A;  2WBS A;  3EPL A;  1A1H A;  5KL6 A;  2GLI A;  4M9V C;  1ZR9 A;  2MKN A;  1G2D C;  2ADR A;  1NCS A;  2YTJ A;  2LV2 A;  4R2P A;  1X6E A;  2EMA A;  2JP9 A;  2EMG A;  2YTE A;  3M99 B;  1JK2 A;  1RMD A;  1B69 A;  2CT1 A;  2LT7 A;  4F6M A;  1X5W A;  2WBU A;  2EL5 A;  2LO3 A;  2YTQ A;  2EMY A;  2ELY A;  4GZN C;  2EMC A;  2ELZ A;  1MEY C;  1A1K A;  2EM8 A;  2EOS A;  1KJK A;  2EM0 A;  1UBD C;  2EM4 A;  1DGC A;  2M9A A;  4R2D A;  2EML A;  1LLM C;  4FK5 C;  2EOE A;  5KL7 A;  1ZAA C;  3EPK A;  2YSP A;  2EMF A;  2VRD A;  1WJP A;  2EM2 A;  2YSO A;  5KL3 A;  4R2Q A;  5KL4 A;  2EPA A;  2PRT A;  1A1L A;  2EN3 A;  1YUJ A;  2EN6 A;  2BB8 A;  1UN6 B;  2LVH A;  2DMI A;  2YRH A;  4F6N A;  1F2I G;  1Z1B A;  2DLQ A;  1YSA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...