2EN2A

Solution structure of the c2h2 type zinc finger (region 598-626) of human b-cell lymphoma 6 protein
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
42
structure length
42
Chain Sequence
GSSGSSGGEKPYKCETCGARFVQVAHLRAHVLIHTGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords B-cell lymphoma 6 protein
publication title Solution structure of the C2H2 type zinc finger (region 598-626) of human B-cell lymphoma 6 protein
rcsb
source organism Homo sapiens
total genus 6
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2en2A01
2EN1A 1ZR9A 2R1FA 2LT7A 1YUJA 2EMIA 2M9AA 2EM6A 2EN7A 3EPLA 1A1IA 2EM4A 1KJKA 2EL6A 2EPUA 2EP3A 4R2CA 5KL6A 2D9HA 4F2JC 2ADRA 1JK1A 1X6EA 2EM8A 2CT1A 2WBUA 1A1GA 3M99B 2EQ1A 2YTFA 2MKNA 2EOOA 2ELYA 2EMBA 2ENAA 5KL3A 2EL5A 2EN4A 4GZNC 4IS1C 2EOYA 4R2SA 2E72A 2EM2A 2YTDA 1A1HA 2EOHA 2LCEA 1P47A 2EOMA 2EM9A 2LO3A 2YTIA 2NABA 2EORA 2EM7A 2YRKA 2EJ4A 2EN3A 1MEYC 2EPRA 2YTJA 3EPKA 2EQ0A 4R2DA 2EOJA 2EMKA 2WCC3 1YSAC 2YSOA 5KL5A 1NCSA 2ENCA 2EN6A 2GHFA 4IJDA 2EOEA 2GLIA 2EN2A 2ELZA 2EPAA 2EOFA 2CSHA 2EPXA 1X6HA 2EMXA 2YTQA 1F2IG 2RSIA 2YTGA 2EMZA 1ZU1A 4X9JA 2EOXA 2EOIA 1TF6A 1TN9A 2RPCA 4R2RA 2WBTA 2MDGA 2EMFA 2VRDA 2YRMA 2J7JA 2EN8A 2EPZA 2WBSA 2EMGA 2YRHA 1UBDC 1BBOA 1UN6B 2BB8A 4FK5C 4R2PA 4F6MA 2EE8A 1DGCA 2YTEA 2YTPA 3VHTB 1A1LA 2YTNA 2DLKA 2DGCA 2LVHA 1X3CA 1X5WA 4F6NA 2HGHA 2EOQA 2EMHA 1AAYA 2CTDA 4R2QA 2LV2A 5KL7A 2PRTA 4R2EA 2MKDA 5KL2A 2EOSA 2JPAA 2YTOA 1RMDA 2EMWA 1G2DC 3MHSC 3UK3C 2EQ3A 2YSPA 1YUIA 1BB8A 2EMYA 2EMAA 2EMCA 2DLQA 2DMIA 2EMLA 2EOZA 2YU8A 3MHHC 4WSGA 2EPCA 2I13A 2EPPA 4M9VC 2YU5A 1ZAAC 2ENHA 1A1KA 1TF3A 2DRPA 1B69A 1Z1BA 1A1FA 2JP9A 2EM5A 5KL4A 2EM0A 1LLMC 1WJPA 1JK2A 1A1JA 3EPJA 3EPHA 1X6FA 2A25A 2EM3A 2EL4A 4R2AA 1G2FC
chains in the Genus database with same CATH superfamily
2EN1A 2L3CA 2R1FA 2LT7A 1YUJA 2EN7A 2JVAA 1A1IA 1PKPA 2MC5A 4NXNE 2L33A 4R2CA 2D9HA 4F2JC 1IQOA 4DV2E 2H36X 2B7TA 2HJJA 5AC5A 3M99B 1YFHA 1I94E 4WFTA 5LMNE 3HPSA 4J8ZA 4F9BB 4Q28A 3BF2A 2L2NA 2EOYA 5BR8E 2KONA 3J7AG 2YRKA 2EN3A 2FTXB 1GTKA 2EQ0A 2DSYA 5A6JA 2EMKA 2JOXA 2WCC3 1YSAC 2HHHE 1BBGA 3ADLA 2ENCA 3KWRA 2GHFA 4F54A 2EOEA 1X49A 2EN2A 2FGGA 1YPNA 2Q8UA 2EMXA 2R76A 2EZ6A 2LBSB 4LTYA 4O24A 4BS9A 2L6MA 2LTRA 2KOUA 1HR0E 4B3TE 4BHCA 2RPCA 5IV8B 4R2RA 2EMFA 2YRMA 1T39A 4MLVA 2LUQA 4LU9A 1IMUA 2YRHA 5FLXC 4O43A 4DV1E 2VE7C 4F6MA 1DGCA 2EE8A 2F8BA 4GKKE 4L5NC 3VHTB 2YTNA 2DGCA 2LVHA 1X5WA 5TSEA 2RS7A 3HPZA 4P7DA 2EMHA 4JI2E 2EPMX 1AH5A 4AQYE 2EMWA 3F6GA 1MGTA 2GLIA 2IHR1 4I8OA 1TF3A 1N3GA 4DUZE 1Z1BA 2DB2A 3ADJA 2UU9E 5KL4A 4DR1E 1FKAE 4JI4E 4M30A 3EPJA 3J80C 4KHPE 1X6FA 3ADIA 4DR6E 4BBYA 4DR2E 2L2KB 2EM6A 3AV0A 5A2QC 3EPLA 1KJKA 4OX9E 4TUIA 2EP3A 4NXME 5T6JA 2CT1A 2WBUA 3J81C 5A6BA 2YTFA 1QNTA 1WHQA 4BC9A 2ELYA 3OTOE 5KL3A 2UUBE 1PDAA 4KWYA 4LFAE 2K4VA 2JOBA 2LO3A 3LMLA 4X62E 2CPNA 2EM7A 2DIXA 2YZTA 1WHNA 4N4RB 4DR3E 3C6MA 3EPKA 3VK6A 4O5GA 2UXBE 2EOJA 1NEIA 4DUYE 4K0KE 1KYQA 2ODRC 2M4IA 2EN6A 1HNWE 2LTSA 2FV4B 4IJDA 2CSHA 4DV5E 1X6HA 4ZYDA 3BIDA 1YYOA 2LUPB 2EMZA 2DMYA 2JYAA 4LF7E 2EOIA 4NHRA 1XMOE 2WBTA 2MDGA 2VRDA 2EPKX 3BGHA 2J7JA 2MDRA 3THOB 4JI7E 4DV3E 1BBOA 5IWAE 1UN6B 2BB8A 4R2PA 4BCAA 2ZM6E 2I9IA 3C6KA 5LMUE 2B3TB 2DLKA 4JI6E 2M7QA 3MSWA 2HGHA 2EOQA 4O4KA 1AAYA 4ZYHA 3IWDA 4R2EA 2MKDA 5AE3A 5A6AA 1G2DC 3MHSC 2JWOA 4WXCA 2YSPA 2EMAA 2MC6A 2EMLA 4WSGA 3JAMC 2EPNA 2ENHA 4DV7E 4WXDA 4X8WA 2RQLA 1A1FA 1N32E 5A69A 4LF5E 1T4NA 2EM5A 1PJQA 1UILA 3T1YE 2EM0A 1LLMC 1WJPA 4WPYA 1XMQE 1JK2A 1IBKE 2EPOA 3P1XA 3EPHA 4DR5E 4MLQA 4JI0E 4B3RE 4JV5E 2LMZA 2VQFE 4X64E 2M9AA 4B3ME 5IXMB 2L3JA 4DR4E 4DV0E 2EL6A 2EPUA 3J7Yp 4DMIA 2V86A 4TUGA 2G7HA 1X6EA 2WZOA 2VQEE 1FJGE 4LFBE 1T4LB 2JXPA 1A1GA 4LF9E 2L8TA 2V87A 4L8NA 2MKNA 2LRSA 2EOOA 2EMBA 1RC7A 4GZNC 4F9CB 5AC4A 3ADGA 2LE2A 3VYYA 2EM2A 2UUAE 2M1SA 4OOGC 2YTIA 2NABA 2EORA 2EJ4A 4R8OA 1MEYC 2YT4A 2EPRA 1PJTA 4DV4E 2L2MA 1HNXE 4R2DA 5DNYA 2UXDE 2L92A 2YSOA 2RS6A 5KL5A 5AASA 3HTXA 2ELZA 2EPAA 2LJUA 4KZSA 2EPXA 3C4TA 2UUCE 2YTQA 1F2IG 2GPIA 1EKZA 1UHZA 2YTGA 1WRJA 2YWQA 1N34E 3VYXA 3THNA 1SR9A 4JI5E 1ZU1A 5A6BD 4X9JA 1TF6A 1ZBTA 4BMJA 1HNZE 1N36E 2EN8A 4RH8A 2WBSA 1GQEA 2KHXA 1UBDC 1XNQE 2EWLA 2NUEA 2EPLX 4FK5C 3KZZA 1DQ3A 2ODRD 1A1LA 3QG5C 1X3CA 4F6NA 5F3WA 1ZBQA 1J26A 4ZYEA 4HEIA 3BBGA 4B3SE 1EH7A 4JI8E 5KL2A 1YYKA 2EOSA 2JPAA 4JI3E 4LF8E 1RMDA 2VF1A 2F4VE 3UK3C 2EQ3A 4ZYGA 1YUIA 1BB8A 2DMIA 2B7VA 2I13A 1SFEA 4P78A 5A6KA 2EPPA 4M9VC 2YU5A 1ZAAC 4GEQB 2DRPA 1B69A 4R03A 1DI2A 4WX9A 2V88A 2RSMA 1IBME 4LF6E 1A1JA 2B9DA 2E1MA 4M2ZA 2HC5A 2A25A 4Q35B 4R2AA 1P47A 3HXLA 1ZR9A 4BC7A 2EMIA 2LJHA 4HTGA 5LLQA 5LL6R 4NZVA 2EM4A 4DV6E 3EQ1A 3T1HE 5CFFE 2NUGA 5KL6A 2ADRA 1JK1A 2EM8A 1T4OA 1O0WA 2NA2A 1J5EE 2EQ1A 3JU0A 2N3GA 3ZOQB 2UXCE 2ENAA 1GZ6A 1XNRE 2EL5A 2EN4A 4IS1C 4R2SA 2E72A 2YTDA 2BBGA 1A1HA 2EOHA 4X66E 2E5LE 2LCEA 2EOMA 2EM9A 3LLHA 4BHBA 2YTJA 4JYAE 3DJWA 1NCSA 2EOFA 1WXRA 1RQ0A 3C4BA 1L4SA 2RSIA 2V83A 3F6HA 2JY9A 3DF6A 2EOXA 4RHBB 1STUA 1X47A 1TN9A 4LFCE 1YZ9A 4YY3E 1N33E 2EPZA 4X65E 2EMGA 3AUZA 1IQSA 3IWCA 5AE1A 2RTXA 2YTEA 4DR7E 2V85A 2YTPA 3JTZA 4DKKA 3FIGA 2K7IA 3K6QA 4F9AB 2JR1A 4WSPA 1YYWA 2CTDA 1IBLE 4R2QA 2LV2A 5KL7A 1EH8A 3OMLA 2PRTA 1T38A 2YTOA 1EH6A 1X48A 5IT9C 2N3HA 2NUFA 2EMYA 2EMCA 2YU8A 2DLQA 2EOZA 4JI1E 3KZYA 3MHHC 2EPCA 4YHHE 3HQ1A 2N8XA 5AE2A 4LF4E 3L00A 1PJSA 1A1KA 3H09A 2JP9A 4WYQB 2YPNA 3RMPA 3IWBA 5ADZA 2V8QB 2V89A 4GKJE 3ECRA 2EM3A 1QU6A 2EL4A 3TQMA 1G2FC 4M0VA
chains in the Genus database with same CATH topology
2EN1A 1ZR9A 2R1FA 2LT7A 1YUJA 2EMIA 2M9AA 2EM6A 2EN7A 3EPLA 1A1IA 2EM4A 1KJKA 2EL6A 2EPUA 2EP3A 4R2CA 5KL6A 2D9HA 4F2JC 2ADRA 1JK1A 1X6EA 2EM8A 2CT1A 2WBUA 1A1GA 3M99B 2EQ1A 2YTFA 2MKNA 2EOOA 2ELYA 2EMBA 2ENAA 5KL3A 2EL5A 2EN4A 4GZNC 4IS1C 2EOYA 4R2SA 2E72A 2EM2A 2YTDA 1A1HA 2EOHA 2LCEA 1P47A 2EOMA 2EM9A 2LO3A 2YTIA 2NABA 2EORA 2EM7A 2YRKA 2EJ4A 2EN3A 1MEYC 2EPRA 2YTJA 3EPKA 2EQ0A 4R2DA 2EOJA 2EMKA 2WCC3 1YSAC 2YSOA 5KL5A 1NCSA 2ENCA 2EN6A 2GHFA 4IJDA 2EOEA 2GLIA 2EN2A 2ELZA 2EPAA 2EOFA 2CSHA 2EPXA 1X6HA 2EMXA 2YTQA 1F2IG 2RSIA 2YTGA 2EMZA 1ZU1A 4X9JA 2EOXA 2EOIA 1TF6A 1TN9A 2RPCA 4R2RA 2WBTA 2MDGA 2EMFA 2VRDA 2YRMA 2J7JA 2EN8A 2EPZA 2WBSA 2EMGA 2YRHA 1UBDC 1BBOA 1UN6B 2BB8A 4FK5C 4R2PA 4F6MA 2EE8A 1DGCA 2YTEA 2YTPA 3VHTB 1A1LA 2YTNA 2DLKA 2DGCA 2LVHA 1X3CA 1X5WA 4F6NA 2HGHA 2EOQA 2EMHA 1AAYA 2CTDA 4R2QA 2LV2A 5KL7A 2PRTA 4R2EA 2MKDA 5KL2A 2EOSA 2JPAA 2YTOA 1RMDA 2EMWA 1G2DC 3MHSC 3UK3C 2EQ3A 2YSPA 1YUIA 1BB8A 2EMYA 2EMAA 2EMCA 2DLQA 2DMIA 2EMLA 2EOZA 2YU8A 3MHHC 4WSGA 2EPCA 2I13A 2EPPA 4M9VC 2YU5A 1ZAAC 2ENHA 1A1KA 1TF3A 2DRPA 1B69A 1Z1BA 1A1FA 2JP9A 2EM5A 5KL4A 2EM0A 1LLMC 1WJPA 1JK2A 1A1JA 3EPJA 3EPHA 1X6FA 2A25A 2EM3A 2EL4A 4R2AA 1G2FC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EN1 A;  1ZR9 A;  2R1F A;  2LT7 A;  1YUJ A;  2EMI A;  2M9A A;  2EM6 A;  2EN7 A;  3EPL A;  1A1I A;  2EM4 A;  1KJK A;  2EL6 A;  2EPU A;  2EP3 A;  4R2C A;  5KL6 A;  2D9H A;  4F2J C;  2ADR A;  1JK1 A;  1X6E A;  2EM8 A;  2CT1 A;  2WBU A;  1A1G A;  3M99 B;  2EQ1 A;  2YTF A;  2MKN A;  2EOO A;  2ELY A;  2EMB A;  2ENA A;  5KL3 A;  2EL5 A;  2EN4 A;  4GZN C;  4IS1 C;  2EOY A;  4R2S A;  2E72 A;  2EM2 A;  2YTD A;  1A1H A;  2EOH A;  2LCE A;  1P47 A;  2EOM A;  2EM9 A;  2LO3 A;  2YTI A;  2NAB A;  2EOR A;  2EM7 A;  2YRK A;  2EJ4 A;  2EN3 A;  1MEY C;  2EPR A;  2YTJ A;  3EPK A;  2EQ0 A;  4R2D A;  2EOJ A;  2EMK A;  2WCC 3;  1YSA C;  2YSO A;  5KL5 A;  1NCS A;  2ENC A;  2EN6 A;  2GHF A;  4IJD A;  2EOE A;  2GLI A;  2EN2 A;  2ELZ A;  2EPA A;  2EOF A;  2CSH A;  2EPX A;  1X6H A;  2EMX A;  2YTQ A;  1F2I G;  2RSI A;  2YTG A;  2EMZ A;  1ZU1 A;  4X9J A;  2EOX A;  2EOI A;  1TF6 A;  1TN9 A;  2RPC A;  4R2R A;  2WBT A;  2MDG A;  2EMF A;  2VRD A;  2YRM A;  2J7J A;  2EN8 A;  2EPZ A;  2WBS A;  2EMG A;  2YRH A;  1UBD C;  1BBO A;  1UN6 B;  2BB8 A;  4FK5 C;  4R2P A;  4F6M A;  2EE8 A;  1DGC A;  2YTE A;  2YTP A;  3VHT B;  1A1L A;  2YTN A;  2DLK A;  2DGC A;  2LVH A;  1X3C A;  1X5W A;  4F6N A;  2HGH A;  2EOQ A;  2EMH A;  1AAY A;  2CTD A;  4R2Q A;  2LV2 A;  5KL7 A;  2PRT A;  4R2E A;  2MKD A;  5KL2 A;  2EOS A;  2JPA A;  2YTO A;  1RMD A;  2EMW A;  1G2D C;  3MHS C;  3UK3 C;  2EQ3 A;  2YSP A;  1YUI A;  1BB8 A;  2EMY A;  2EMA A;  2EMC A;  2DLQ A;  2DMI A;  2EML A;  2EOZ A;  2YU8 A;  3MHH C;  4WSG A;  2EPC A;  2I13 A;  2EPP A;  4M9V C;  2YU5 A;  1ZAA C;  2ENH A;  1A1K A;  1TF3 A;  2DRP A;  1B69 A;  1Z1B A;  1A1F A;  2JP9 A;  2EM5 A;  5KL4 A;  2EM0 A;  1LLM C;  1WJP A;  1JK2 A;  1A1J A;  3EPJ A;  3EPH A;  1X6F A;  2A25 A;  2EM3 A;  2EL4 A;  4R2A A;  1G2F C; 
#chains in the Genus database with same CATH topology
 2EN1 A;  2L3C A;  2R1F A;  2LT7 A;  1YUJ A;  2EN7 A;  2JVA A;  1A1I A;  1PKP A;  2MC5 A;  4NXN E;  2L33 A;  4R2C A;  2D9H A;  4F2J C;  1IQO A;  4DV2 E;  2H36 X;  2B7T A;  2HJJ A;  5AC5 A;  3M99 B;  1YFH A;  1I94 E;  4WFT A;  5LMN E;  3HPS A;  4J8Z A;  4F9B B;  4Q28 A;  3BF2 A;  2L2N A;  2EOY A;  5BR8 E;  2KON A;  3J7A G;  2YRK A;  2EN3 A;  2FTX B;  1GTK A;  2EQ0 A;  2DSY A;  5A6J A;  2EMK A;  2JOX A;  2WCC 3;  1YSA C;  2HHH E;  1BBG A;  3ADL A;  2ENC A;  3KWR A;  2GHF A;  4F54 A;  2EOE A;  1X49 A;  2EN2 A;  2FGG A;  1YPN A;  2Q8U A;  2EMX A;  2R76 A;  2EZ6 A;  2LBS B;  4LTY A;  4O24 A;  4BS9 A;  2L6M A;  2LTR A;  2KOU A;  1HR0 E;  4B3T E;  4BHC A;  2RPC A;  5IV8 B;  4R2R A;  2EMF A;  2YRM A;  1T39 A;  4MLV A;  2LUQ A;  4LU9 A;  1IMU A;  2YRH A;  5FLX C;  4O43 A;  4DV1 E;  2VE7 C;  4F6M A;  1DGC A;  2EE8 A;  2F8B A;  4GKK E;  4L5N C;  3VHT B;  2YTN A;  2DGC A;  2LVH A;  1X5W A;  5TSE A;  2RS7 A;  3HPZ A;  4P7D A;  2EMH A;  4JI2 E;  2EPM X;  1AH5 A;  4AQY E;  2EMW A;  3F6G A;  1MGT A;  2GLI A;  2IHR 1;  4I8O A;  1TF3 A;  1N3G A;  4DUZ E;  1Z1B A;  2DB2 A;  3ADJ A;  2UU9 E;  5KL4 A;  4DR1 E;  1FKA E;  4JI4 E;  4M30 A;  3EPJ A;  3J80 C;  4KHP E;  1X6F A;  3ADI A;  4DR6 E;  4BBY A;  4DR2 E;  2L2K B;  2EM6 A;  3AV0 A;  5A2Q C;  3EPL A;  1KJK A;  4OX9 E;  4TUI A;  2EP3 A;  4NXM E;  5T6J A;  2CT1 A;  2WBU A;  3J81 C;  5A6B A;  2YTF A;  1QNT A;  1WHQ A;  4BC9 A;  2ELY A;  3OTO E;  5KL3 A;  2UUB E;  1PDA A;  4KWY A;  4LFA E;  2K4V A;  2JOB A;  2LO3 A;  3LML A;  4X62 E;  2CPN A;  2EM7 A;  2DIX A;  2YZT A;  1WHN A;  4N4R B;  4DR3 E;  3C6M A;  3EPK A;  3VK6 A;  4O5G A;  2UXB E;  2EOJ A;  1NEI A;  4DUY E;  4K0K E;  1KYQ A;  2ODR C;  2M4I A;  2EN6 A;  1HNW E;  2LTS A;  2FV4 B;  4IJD A;  2CSH A;  4DV5 E;  1X6H A;  4ZYD A;  3BID A;  1YYO A;  2LUP B;  2EMZ A;  2DMY A;  2JYA A;  4LF7 E;  2EOI A;  4NHR A;  1XMO E;  2WBT A;  2MDG A;  2VRD A;  2EPK X;  3BGH A;  2J7J A;  2MDR A;  3THO B;  4JI7 E;  4DV3 E;  1BBO A;  5IWA E;  1UN6 B;  2BB8 A;  4R2P A;  4BCA A;  2ZM6 E;  2I9I A;  3C6K A;  5LMU E;  2B3T B;  2DLK A;  4JI6 E;  2M7Q A;  3MSW A;  2HGH A;  2EOQ A;  4O4K A;  1AAY A;  4ZYH A;  3IWD A;  4R2E A;  2MKD A;  5AE3 A;  5A6A A;  1G2D C;  3MHS C;  2JWO A;  4WXC A;  2YSP A;  2EMA A;  2MC6 A;  2EML A;  4WSG A;  3JAM C;  2EPN A;  2ENH A;  4DV7 E;  4WXD A;  4X8W A;  2RQL A;  1A1F A;  1N32 E;  5A69 A;  4LF5 E;  1T4N A;  2EM5 A;  1PJQ A;  1UIL A;  3T1Y E;  2EM0 A;  1LLM C;  1WJP A;  4WPY A;  1XMQ E;  1JK2 A;  1IBK E;  2EPO A;  3P1X A;  3EPH A;  4DR5 E;  4MLQ A;  4JI0 E;  4B3R E;  4JV5 E;  2LMZ A;  2VQF E;  4X64 E;  2M9A A;  4B3M E;  5IXM B;  2L3J A;  4DR4 E;  4DV0 E;  2EL6 A;  2EPU A;  3J7Y p;  4DMI A;  2V86 A;  4TUG A;  2G7H A;  1X6E A;  2WZO A;  2VQE E;  1FJG E;  4LFB E;  1T4L B;  2JXP A;  1A1G A;  4LF9 E;  2L8T A;  2V87 A;  4L8N A;  2MKN A;  2LRS A;  2EOO A;  2EMB A;  1RC7 A;  4GZN C;  4F9C B;  5AC4 A;  3ADG A;  2LE2 A;  3VYY A;  2EM2 A;  2UUA E;  2M1S A;  4OOG C;  2YTI A;  2NAB A;  2EOR A;  2EJ4 A;  4R8O A;  1MEY C;  2YT4 A;  2EPR A;  1PJT A;  4DV4 E;  2L2M A;  1HNX E;  4R2D A;  5DNY A;  2UXD E;  2L92 A;  2YSO A;  2RS6 A;  5KL5 A;  5AAS A;  3HTX A;  2ELZ A;  2EPA A;  2LJU A;  4KZS A;  2EPX A;  3C4T A;  2UUC E;  2YTQ A;  1F2I G;  2GPI A;  1EKZ A;  1UHZ A;  2YTG A;  1WRJ A;  2YWQ A;  1N34 E;  3VYX A;  3THN A;  1SR9 A;  4JI5 E;  1ZU1 A;  5A6B D;  4X9J A;  1TF6 A;  1ZBT A;  4BMJ A;  1HNZ E;  1N36 E;  2EN8 A;  4RH8 A;  2WBS A;  1GQE A;  2KHX A;  1UBD C;  1XNQ E;  2EWL A;  2NUE A;  2EPL X;  4FK5 C;  3KZZ A;  1DQ3 A;  2ODR D;  1A1L A;  3QG5 C;  1X3C A;  4F6N A;  5F3W A;  1ZBQ A;  1J26 A;  4ZYE A;  4HEI A;  3BBG A;  4B3S E;  1EH7 A;  4JI8 E;  5KL2 A;  1YYK A;  2EOS A;  2JPA A;  4JI3 E;  4LF8 E;  1RMD A;  2VF1 A;  2F4V E;  3UK3 C;  2EQ3 A;  4ZYG A;  1YUI A;  1BB8 A;  2DMI A;  2B7V A;  2I13 A;  1SFE A;  4P78 A;  5A6K A;  2EPP A;  4M9V C;  2YU5 A;  1ZAA C;  4GEQ B;  2DRP A;  1B69 A;  4R03 A;  1DI2 A;  4WX9 A;  2V88 A;  2RSM A;  1IBM E;  4LF6 E;  1A1J A;  2B9D A;  2E1M A;  4M2Z A;  2HC5 A;  2A25 A;  4Q35 B;  4R2A A;  1P47 A;  3HXL A;  1ZR9 A;  4BC7 A;  2EMI A;  2LJH A;  4HTG A;  5LLQ A;  5LL6 R;  4NZV A;  2EM4 A;  4DV6 E;  3EQ1 A;  3T1H E;  5CFF E;  2NUG A;  5KL6 A;  2ADR A;  1JK1 A;  2EM8 A;  1T4O A;  1O0W A;  2NA2 A;  1J5E E;  2EQ1 A;  3JU0 A;  2N3G A;  3ZOQ B;  2UXC E;  2ENA A;  1GZ6 A;  1XNR E;  2EL5 A;  2EN4 A;  4IS1 C;  4R2S A;  2E72 A;  2YTD A;  2BBG A;  1A1H A;  2EOH A;  4X66 E;  2E5L E;  2LCE A;  2EOM A;  2EM9 A;  3LLH A;  4BHB A;  2YTJ A;  4JYA E;  3DJW A;  1NCS A;  2EOF A;  1WXR A;  1RQ0 A;  3C4B A;  1L4S A;  2RSI A;  2V83 A;  3F6H A;  2JY9 A;  3DF6 A;  2EOX A;  4RHB B;  1STU A;  1X47 A;  1TN9 A;  4LFC E;  1YZ9 A;  4YY3 E;  1N33 E;  2EPZ A;  4X65 E;  2EMG A;  3AUZ A;  1IQS A;  3IWC A;  5AE1 A;  2RTX A;  2YTE A;  4DR7 E;  2V85 A;  2YTP A;  3JTZ A;  4DKK A;  3FIG A;  2K7I A;  3K6Q A;  4F9A B;  2JR1 A;  4WSP A;  1YYW A;  2CTD A;  1IBL E;  4R2Q A;  2LV2 A;  5KL7 A;  1EH8 A;  3OML A;  2PRT A;  1T38 A;  2YTO A;  1EH6 A;  1X48 A;  5IT9 C;  2N3H A;  2NUF A;  2EMY A;  2EMC A;  2YU8 A;  2DLQ A;  2EOZ A;  4JI1 E;  3KZY A;  3MHH C;  2EPC A;  4YHH E;  3HQ1 A;  2N8X A;  5AE2 A;  4LF4 E;  3L00 A;  1PJS A;  1A1K A;  3H09 A;  2JP9 A;  4WYQ B;  2YPN A;  3RMP A;  3IWB A;  5ADZ A;  2V8Q B;  2V89 A;  4GKJ E;  3ECR A;  2EM3 A;  1QU6 A;  2EL4 A;  3TQM A;  1G2F C;  4M0V A; 
#chains in the Genus database with same CATH homology
 2EN1 A;  1ZR9 A;  2R1F A;  2LT7 A;  1YUJ A;  2EMI A;  2M9A A;  2EM6 A;  2EN7 A;  3EPL A;  1A1I A;  2EM4 A;  1KJK A;  2EL6 A;  2EPU A;  2EP3 A;  4R2C A;  5KL6 A;  2D9H A;  4F2J C;  2ADR A;  1JK1 A;  1X6E A;  2EM8 A;  2CT1 A;  2WBU A;  1A1G A;  3M99 B;  2EQ1 A;  2YTF A;  2MKN A;  2EOO A;  2ELY A;  2EMB A;  2ENA A;  5KL3 A;  2EL5 A;  2EN4 A;  4GZN C;  4IS1 C;  2EOY A;  4R2S A;  2E72 A;  2EM2 A;  2YTD A;  1A1H A;  2EOH A;  2LCE A;  1P47 A;  2EOM A;  2EM9 A;  2LO3 A;  2YTI A;  2NAB A;  2EOR A;  2EM7 A;  2YRK A;  2EJ4 A;  2EN3 A;  1MEY C;  2EPR A;  2YTJ A;  3EPK A;  2EQ0 A;  4R2D A;  2EOJ A;  2EMK A;  2WCC 3;  1YSA C;  2YSO A;  5KL5 A;  1NCS A;  2ENC A;  2EN6 A;  2GHF A;  4IJD A;  2EOE A;  2GLI A;  2EN2 A;  2ELZ A;  2EPA A;  2EOF A;  2CSH A;  2EPX A;  1X6H A;  2EMX A;  2YTQ A;  1F2I G;  2RSI A;  2YTG A;  2EMZ A;  1ZU1 A;  4X9J A;  2EOX A;  2EOI A;  1TF6 A;  1TN9 A;  2RPC A;  4R2R A;  2WBT A;  2MDG A;  2EMF A;  2VRD A;  2YRM A;  2J7J A;  2EN8 A;  2EPZ A;  2WBS A;  2EMG A;  2YRH A;  1UBD C;  1BBO A;  1UN6 B;  2BB8 A;  4FK5 C;  4R2P A;  4F6M A;  2EE8 A;  1DGC A;  2YTE A;  2YTP A;  3VHT B;  1A1L A;  2YTN A;  2DLK A;  2DGC A;  2LVH A;  1X3C A;  1X5W A;  4F6N A;  2HGH A;  2EOQ A;  2EMH A;  1AAY A;  2CTD A;  4R2Q A;  2LV2 A;  5KL7 A;  2PRT A;  4R2E A;  2MKD A;  5KL2 A;  2EOS A;  2JPA A;  2YTO A;  1RMD A;  2EMW A;  1G2D C;  3MHS C;  3UK3 C;  2EQ3 A;  2YSP A;  1YUI A;  1BB8 A;  2EMY A;  2EMA A;  2EMC A;  2DLQ A;  2DMI A;  2EML A;  2EOZ A;  2YU8 A;  3MHH C;  4WSG A;  2EPC A;  2I13 A;  2EPP A;  4M9V C;  2YU5 A;  1ZAA C;  2ENH A;  1A1K A;  1TF3 A;  2DRP A;  1B69 A;  1Z1B A;  1A1F A;  2JP9 A;  2EM5 A;  5KL4 A;  2EM0 A;  1LLM C;  1WJP A;  1JK2 A;  1A1J A;  3EPJ A;  3EPH A;  1X6F A;  2A25 A;  2EM3 A;  2EL4 A;  4R2A A;  1G2F C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...