2EN2A

Solution structure of the c2h2 type zinc finger (region 598-626) of human b-cell lymphoma 6 protein
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
42
structure length
42
Chain Sequence
GSSGSSGGEKPYKCETCGARFVQVAHLRAHVLIHTGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords B-cell lymphoma 6 protein
publication title Solution structure of the C2H2 type zinc finger (region 598-626) of human B-cell lymphoma 6 protein
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2en2A01
1RMDA 1A1IA 1X3CA 1MEYC 3EPJA 1JK2A 2EMHA 1KJKA 4R2PA 4F6NA 2M9AA 2EOXA 1YUIA 2WBSA 4IJDA 2EN2A 2LVHA 2J7JA 2YTEA 2JP9A 1YSAC 2EMWA 2YTOA 1A1KA 1A1HA 1G2DC 2CSHA 2EM0A 2MDGA 2GHFA 3UK3C 1YUJA 2DLQA 2EOQA 2YRKA 2GLIA 3MHSC 2EOHA 2EN3A 3VHTB 1B69A 2YRHA 2ELZA 2I13A 1AAYA 2ADRA 2EPRA 3M99B 4R2DA 1TN9A 1TF6A 2HGHA 2EPCA 2LV2A 2ENHA 2EM8A 4FK5C 2EL4A 2EPUA 2DRPA 2EMBA 2LCEA 2EMCA 2EPAA 4GZNC 4M9VC 2MKNA 2EM7A 2EN8A 1TF3A 4X9JA 1A1LA 2YU5A 2EN4A 2EM6A 2EOMA 2EPPA 2YTDA 5KL3A 2EOOA 2EMLA 5KL5A 1BB8A 2YTGA 4R2CA 1F2IG 2EMAA 2EQ3A 2EM5A 2R1FA 2EN6A 2EL6A 2CTDA 2EOFA 2WBTA 4R2SA 1JK1A 2RSIA 2EM9A 5KL2A 4R2RA 1ZR9A 2DGCA 1X5WA 2EORA 2PRTA 2EPZA 2DMIA 4R2AA 2EOZA 4R2EA 2D9HA 1ZU1A 2EN1A 2ELYA 2EM3A 2EE8A 1LLMC 1NCSA 2YTIA 4F2JC 1BBOA 3MHHC 2YTFA 1A1GA 2EM4A 2MKDA 2EMFA 1UN6B 2EMGA 3EPHA 5KL4A 2EQ1A 2EN7A 2EPXA 2ENCA 1X6HA 2YTQA 2YSPA 1G2FC 1P47A 2EJ4A 2WBUA 4IS1C 3EPKA 2YSOA 5KL6A 3EPLA 2EMYA 2DLKA 2ENAA 1DGCA 2E72A 4R2QA 2LO3A 1A1FA 2EQ0A 2YTJA 5KL7A 2VRDA 4F6MA 1X6FA 2EL5A 2LT7A 2EOJA 2RPCA 2YU8A 2A25A 2EMZA 2EMKA 2EOSA 1WJPA 1UBDC 2WCC3 2JPAA 4WSGA 2YRMA 2BB8A 2EOIA 1Z1BA 2EMIA 2EMXA 2EP3A 1ZAAC 2EOEA 2NABA 2YTNA 2EOYA 2CT1A 1A1JA 2YTPA 1X6EA 2EM2A
chains in the Genus database with same CATH superfamily
5A6KA 3H09A 2FV4B 1MEYC 2JXPA 1IMUA 3L00A 1JK2A 3RMPA 2B9DA 2JWOA 2M9AA 2V83A 2KONA 2WBSA 2JVAA 2YWQA 3VYXA 3ADLA 2JP9A 1IBKE 2B7VA 3AV0A 4J8ZA 2CSHA 3HPZA 2GHFA 2VF1A 2YRKA 4DR5E 4BMJA 3IWCA 3JTZA 5ADZA 4DV5E 2EN3A 4DV1E 3THNA 2YRHA 3DJWA 1AAYA 2JY9A 2EPRA 1STUA 4R2DA 1YFHA 3BBGA 2F8BA 2MDRA 2N8XA 4BS9A 5A6BA 2UXBE 4BCAA 2YT4A 2EMCA 2L33A 3J80C 2EN8A 3BIDA 2EN4A 2F4VE 4NXNE 1XMOE 5CFFE 2HC5A 2NUFA 2HHHE 2EOOA 2EMLA 5KL5A 1BB8A 4DUYE 2EZ6A 2R1FA 2EM5A 2EN6A 4NHRA 2UUAE 2K4VA 3LLHA 2CTDA 2WBTA 2ODRD 1J5EE 2RSIA 3AUZA 2EM9A 1RQ0A 4YY3E 2DGCA 1SFEA 1BBGA 2PRTA 4WXDA 5IWAE 4GKKE 4R2AA 5LMNE 4DUZE 3VYYA 3ADGA 3K6QA 4DR6E 4BC9A 5BR8E 1NCSA 4KHPE 1BBOA 4GKJE 4ZYEA 2MKDA 3LMLA 5KL4A 4DMIA 3KZZA 2ENCA 2YTQA 1G2FC 2WBUA 5F3WA 3EPKA 1FJGE 5TSEA 1QNTA 4DR4E 5A69A 2V89A 3HXLA 2ZM6E 2R76A 4JI4E 2DLKA 3C6MA 2EWLA 1A1FA 3BF2A 5IT9C 1N36E 2VRDA 3HPSA 1IBLE 1MGTA 4DV3E 4RH8A 3JU0A 2EOSA 1GZ6A 3ADIA 2KHXA 2EOIA 5T6JA 2UXDE 4LF7E 4M2ZA 2EOEA 2N3GA 2M7QA 2EOYA 2VQFE 2VQEE 3QG5C 1A1JA 2YTPA 5KL2A 1RMDA 4NZVA 1X3CA 3EPJA 1PJTA 1X47A 1YYWA 4JI8E 3TQMA 4DV0E 4R2PA 4F6NA 2RQLA 2YTEA 1EKZA 5LLQA 2RTXA 4P7DA 1YYOA 1A1KA 2MDGA 3F6GA 4DV7E 3UK3C 2L2MA 4JV5E 4MLQA 2GLIA 2E5LE 2UUCE 2LTSA 1DQ3A 4LF8E 3VHTB 4R8OA 2LUPB 2ADRA 3M99B 2EPLX 4WX9A 1IBME 5LMUE 2FGGA 4M0VA 4WSPA 4DV2E 1RC7A 4LF6E 2EL4A 1XNQE 2DRPA 4M9VC 3MSWA 2EPAA 4WYQB 3OTOE 1YZ9A 2L92A 2YTDA 4R2CA 1F2IG 2EQ3A 4N4RB 1JK1A 4R2RA 1X49A 2VE7C 2D9HA 1GQEA 3ZOQB 4O43A 1PJQA 2EN1A 4OOGC 2DB2A 1UILA 4JI7E 1LLMC 4F2JC 2IHR1 3MHHC 3HTXA 4L5NC 2DSYA 2EMGA 2UXCE 3ECRA 4LFAE 1P47A 2EJ4A 4B3RE 1EH6A 5IXMB 4WXCA 4IS1C 3J7AG 1T38A 3FIGA 3EPLA 2EMYA 1DGCA 2E72A 4R2QA 2LO3A 4HTGA 1UHZA 5KL7A 2LMZA 4O4KA 4JI6E 1X6FA 5AE3A 1EH8A 4JI0E 2G7HA 1ZBQA 2YU8A 3P1XA 4AQYE 2EMKA 4Q28A 1UBDC 4O5GA 2L6MA 1Z1BA 4X8WA 1HNZE 1XMQE 2M1SA 2EM2A 4X65E 1GTKA 3J81C 4LF4E 2LJHA 4F9AB 1XNRE 4F54A 1KYQA 2B3TB 2EMHA 4LTYA 4BHCA 5A2QC 2EOXA 1YUIA 4IJDA 4I8OA 2J7JA 2JOBA 1YSAC 2DIXA 1A1HA 2LBSB 1WHQA 2KOUA 2EM0A 5A6BD 2EOQA 4BC7A 1HNXE 2V88A 4DR1E 1PDAA 2RS6A 1SR9A 4DKKA 4WPYA 2GPIA 2ELZA 4DV4E 2I13A 2H36X 1YYKA 1TF6A 4F9CB 2YPNA 4FK5C 4X64E 2MC6A 4ZYHA 4GZNC 4NXME 4K0KE 1TF3A 4X9JA 4BHBA 1ZBTA 1A1LA 2YU5A 4B3SE 4OX9E 2EM6A 2EOMA 1IQSA 5A6AA 2ODRC 2YTGA 4JYAE 1O0WA 4R2SA 3HQ1A 2CPNA 1L4SA 1ZR9A 3KZYA 4YHHE 1X5WA 2EPZA 1X48A 2DMIA 2EPNA 1ZU1A 1PKPA 2BBGA 2ELYA 3DF6A 2YTIA 3IWBA 3KWRA 1FKAE 3EPHA 2K7IA 2UUBE 2EN7A 4RHBB 2M4IA 1N34E 1X6HA 4JI5E 2YSPA 2NA2A 3BGHA 2YSOA 3EQ1A 4ZYDA 2L3JA 4GEQB 5A6JA 1HNWE 4JI3E 2EPOA 1NEIA 2EQ0A 2LJUA 5AE1A 2L8TA 2E1MA 4LFBE 2EL5A 4L8NA 2I9IA 2RPCA 2A25A 4TUGA 1N33E 5AC4A 4WSGA 2YRMA 1DI2A 3C4BA 5LL6R 2EMIA 3THOB 1YPNA 2EMXA 2EP3A 3JAMC 1ZAAC 4Q35B 5DNYA 2NABA 3C4TA 3T1YE 1B69A 1A1IA 1X6EA 4DR7E 4P78A 2MC5A 3IWDA 1J26A 2WZOA 1QU6A 3ADJA 2L2NA 4JI2E 4KWYA 2NUGA 3VK6A 4HEIA 1KJKA 1EH7A 2V87A 5IV8B 4O24A 2EN2A 2LVHA 3T1HE 4F9BB 4LF9E 2EMWA 1N3GA 2YTOA 3F6HA 1WXRA 1G2DC 5AE2A 1YUJA 2DLQA 3MHSC 2JR1A 3OMLA 4DR3E 4DR2E 1HR0E 4LF5E 2L2KB 1TN9A 1AH5A 2HGHA 2EPCA 2LV2A 2ENHA 1IQOA 4X62E 2Q8UA 2EM8A 4R03A 3J7Yp 2EPUA 2EMBA 2LCEA 2LTRA 2MKNA 2EM7A 2V86A 4M30A 2UU9E 4B3TE 2EPPA 5KL3A 1T4NA 2HJJA 1T39A 2EMAA 2B7TA 2EL6A 2EOFA 4WFTA 1T4OA 1WRJA 2DMYA 1I94E 4B3ME 4JI1E 2V85A 1WHNA 2EORA 2EOZA 4R2EA 3C6KA 4ZYGA 2EM3A 2EE8A 2RS7A 5AASA 2LUQA 2YTFA 1A1GA 2EM4A 2EMFA 2L3CA 1UN6B 2RSMA 2FTXB 2EQ1A 2EPXA 4DV6E 4LFCE 4KZSA 2EPKX 5KL6A 4X66E 5AC5A 2ENAA 4TUIA 2N3HA 2EPMX 2YTJA 4MLVA 2JOXA 2LRSA 4F6MA 2LT7A 2EOJA 1PJSA 4BBYA 2EMZA 2JYAA 1WJPA 2WCC3 2JPAA 2V8QB 2BB8A 2NUEA 1N32E 2YZTA 5FLXC 2YTNA 1T4LB 2LE2A 4LU9A 2CT1A 2EOHA
chains in the Genus database with same CATH topology
1RMDA 1A1IA 1X3CA 1MEYC 3EPJA 1JK2A 2EMHA 1KJKA 4R2PA 4F6NA 2M9AA 2EOXA 1YUIA 2WBSA 4IJDA 2EN2A 2LVHA 2J7JA 2YTEA 2JP9A 1YSAC 2EMWA 2YTOA 1A1KA 1A1HA 1G2DC 2CSHA 2EM0A 2MDGA 2GHFA 3UK3C 1YUJA 2DLQA 2EOQA 2YRKA 2GLIA 3MHSC 2EOHA 2EN3A 3VHTB 1B69A 2YRHA 2ELZA 2I13A 1AAYA 2ADRA 2EPRA 3M99B 4R2DA 1TN9A 1TF6A 2HGHA 2EPCA 2LV2A 2ENHA 2EM8A 4FK5C 2EL4A 2EPUA 2DRPA 2EMBA 2LCEA 2EMCA 2EPAA 4GZNC 4M9VC 2MKNA 2EM7A 2EN8A 1TF3A 4X9JA 1A1LA 2YU5A 2EN4A 2EM6A 2EOMA 2EPPA 2YTDA 5KL3A 2EOOA 2EMLA 5KL5A 1BB8A 2YTGA 4R2CA 1F2IG 2EMAA 2EQ3A 2EM5A 2R1FA 2EN6A 2EL6A 2CTDA 2EOFA 2WBTA 4R2SA 1JK1A 2RSIA 2EM9A 5KL2A 4R2RA 1ZR9A 2DGCA 1X5WA 2EORA 2PRTA 2EPZA 2DMIA 4R2AA 2EOZA 4R2EA 2D9HA 1ZU1A 2EN1A 2ELYA 2EM3A 2EE8A 1LLMC 1NCSA 2YTIA 4F2JC 1BBOA 3MHHC 2YTFA 1A1GA 2EM4A 2MKDA 2EMFA 1UN6B 2EMGA 3EPHA 5KL4A 2EQ1A 2EN7A 2EPXA 2ENCA 1X6HA 2YTQA 2YSPA 1G2FC 1P47A 2EJ4A 2WBUA 4IS1C 3EPKA 2YSOA 5KL6A 3EPLA 2EMYA 2DLKA 2ENAA 1DGCA 2E72A 4R2QA 2LO3A 1A1FA 2EQ0A 2YTJA 5KL7A 2VRDA 4F6MA 1X6FA 2EL5A 2LT7A 2EOJA 2RPCA 2YU8A 2A25A 2EMZA 2EMKA 2EOSA 1WJPA 1UBDC 2WCC3 2JPAA 4WSGA 2YRMA 2BB8A 2EOIA 1Z1BA 2EMIA 2EMXA 2EP3A 1ZAAC 2EOEA 2NABA 2YTNA 2EOYA 2CT1A 1A1JA 2YTPA 1X6EA 2EM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RMD A;  1A1I A;  1X3C A;  1MEY C;  3EPJ A;  1JK2 A;  2EMH A;  1KJK A;  4R2P A;  4F6N A;  2M9A A;  2EOX A;  1YUI A;  2WBS A;  4IJD A;  2EN2 A;  2LVH A;  2J7J A;  2YTE A;  2JP9 A;  1YSA C;  2EMW A;  2YTO A;  1A1K A;  1A1H A;  1G2D C;  2CSH A;  2EM0 A;  2MDG A;  2GHF A;  3UK3 C;  1YUJ A;  2DLQ A;  2EOQ A;  2YRK A;  2GLI A;  3MHS C;  2EOH A;  2EN3 A;  3VHT B;  1B69 A;  2YRH A;  2ELZ A;  2I13 A;  1AAY A;  2ADR A;  2EPR A;  3M99 B;  4R2D A;  1TN9 A;  1TF6 A;  2HGH A;  2EPC A;  2LV2 A;  2ENH A;  2EM8 A;  4FK5 C;  2EL4 A;  2EPU A;  2DRP A;  2EMB A;  2LCE A;  2EMC A;  2EPA A;  4GZN C;  4M9V C;  2MKN A;  2EM7 A;  2EN8 A;  1TF3 A;  4X9J A;  1A1L A;  2YU5 A;  2EN4 A;  2EM6 A;  2EOM A;  2EPP A;  2YTD A;  5KL3 A;  2EOO A;  2EML A;  5KL5 A;  1BB8 A;  2YTG A;  4R2C A;  1F2I G;  2EMA A;  2EQ3 A;  2EM5 A;  2R1F A;  2EN6 A;  2EL6 A;  2CTD A;  2EOF A;  2WBT A;  4R2S A;  1JK1 A;  2RSI A;  2EM9 A;  5KL2 A;  4R2R A;  1ZR9 A;  2DGC A;  1X5W A;  2EOR A;  2PRT A;  2EPZ A;  2DMI A;  4R2A A;  2EOZ A;  4R2E A;  2D9H A;  1ZU1 A;  2EN1 A;  2ELY A;  2EM3 A;  2EE8 A;  1LLM C;  1NCS A;  2YTI A;  4F2J C;  1BBO A;  3MHH C;  2YTF A;  1A1G A;  2EM4 A;  2MKD A;  2EMF A;  1UN6 B;  2EMG A;  3EPH A;  5KL4 A;  2EQ1 A;  2EN7 A;  2EPX A;  2ENC A;  1X6H A;  2YTQ A;  2YSP A;  1G2F C;  1P47 A;  2EJ4 A;  2WBU A;  4IS1 C;  3EPK A;  2YSO A;  5KL6 A;  3EPL A;  2EMY A;  2DLK A;  2ENA A;  1DGC A;  2E72 A;  4R2Q A;  2LO3 A;  1A1F A;  2EQ0 A;  2YTJ A;  5KL7 A;  2VRD A;  4F6M A;  1X6F A;  2EL5 A;  2LT7 A;  2EOJ A;  2RPC A;  2YU8 A;  2A25 A;  2EMZ A;  2EMK A;  2EOS A;  1WJP A;  1UBD C;  2WCC 3;  2JPA A;  4WSG A;  2YRM A;  2BB8 A;  2EOI A;  1Z1B A;  2EMI A;  2EMX A;  2EP3 A;  1ZAA C;  2EOE A;  2NAB A;  2YTN A;  2EOY A;  2CT1 A;  1A1J A;  2YTP A;  1X6E A;  2EM2 A; 
#chains in the Genus database with same CATH topology
 5A6K A;  3H09 A;  2FV4 B;  1MEY C;  2JXP A;  1IMU A;  3L00 A;  1JK2 A;  3RMP A;  2B9D A;  2JWO A;  2M9A A;  2V83 A;  2KON A;  2WBS A;  2JVA A;  2YWQ A;  3VYX A;  3ADL A;  2JP9 A;  1IBK E;  2B7V A;  3AV0 A;  4J8Z A;  2CSH A;  3HPZ A;  2GHF A;  2VF1 A;  2YRK A;  4DR5 E;  4BMJ A;  3IWC A;  3JTZ A;  5ADZ A;  4DV5 E;  2EN3 A;  4DV1 E;  3THN A;  2YRH A;  3DJW A;  1AAY A;  2JY9 A;  2EPR A;  1STU A;  4R2D A;  1YFH A;  3BBG A;  2F8B A;  2MDR A;  2N8X A;  4BS9 A;  5A6B A;  2UXB E;  4BCA A;  2YT4 A;  2EMC A;  2L33 A;  3J80 C;  2EN8 A;  3BID A;  2EN4 A;  2F4V E;  4NXN E;  1XMO E;  5CFF E;  2HC5 A;  2NUF A;  2HHH E;  2EOO A;  2EML A;  5KL5 A;  1BB8 A;  4DUY E;  2EZ6 A;  2R1F A;  2EM5 A;  2EN6 A;  4NHR A;  2UUA E;  2K4V A;  3LLH A;  2CTD A;  2WBT A;  2ODR D;  1J5E E;  2RSI A;  3AUZ A;  2EM9 A;  1RQ0 A;  4YY3 E;  2DGC A;  1SFE A;  1BBG A;  2PRT A;  4WXD A;  5IWA E;  4GKK E;  4R2A A;  5LMN E;  4DUZ E;  3VYY A;  3ADG A;  3K6Q A;  4DR6 E;  4BC9 A;  5BR8 E;  1NCS A;  4KHP E;  1BBO A;  4GKJ E;  4ZYE A;  2MKD A;  3LML A;  5KL4 A;  4DMI A;  3KZZ A;  2ENC A;  2YTQ A;  1G2F C;  2WBU A;  5F3W A;  3EPK A;  1FJG E;  5TSE A;  1QNT A;  4DR4 E;  5A69 A;  2V89 A;  3HXL A;  2ZM6 E;  2R76 A;  4JI4 E;  2DLK A;  3C6M A;  2EWL A;  1A1F A;  3BF2 A;  5IT9 C;  1N36 E;  2VRD A;  3HPS A;  1IBL E;  1MGT A;  4DV3 E;  4RH8 A;  3JU0 A;  2EOS A;  1GZ6 A;  3ADI A;  2KHX A;  2EOI A;  5T6J A;  2UXD E;  4LF7 E;  4M2Z A;  2EOE A;  2N3G A;  2M7Q A;  2EOY A;  2VQF E;  2VQE E;  3QG5 C;  1A1J A;  2YTP A;  5KL2 A;  1RMD A;  4NZV A;  1X3C A;  3EPJ A;  1PJT A;  1X47 A;  1YYW A;  4JI8 E;  3TQM A;  4DV0 E;  4R2P A;  4F6N A;  2RQL A;  2YTE A;  1EKZ A;  5LLQ A;  2RTX A;  4P7D A;  1YYO A;  1A1K A;  2MDG A;  3F6G A;  4DV7 E;  3UK3 C;  2L2M A;  4JV5 E;  4MLQ A;  2GLI A;  2E5L E;  2UUC E;  2LTS A;  1DQ3 A;  4LF8 E;  3VHT B;  4R8O A;  2LUP B;  2ADR A;  3M99 B;  2EPL X;  4WX9 A;  1IBM E;  5LMU E;  2FGG A;  4M0V A;  4WSP A;  4DV2 E;  1RC7 A;  4LF6 E;  2EL4 A;  1XNQ E;  2DRP A;  4M9V C;  3MSW A;  2EPA A;  4WYQ B;  3OTO E;  1YZ9 A;  2L92 A;  2YTD A;  4R2C A;  1F2I G;  2EQ3 A;  4N4R B;  1JK1 A;  4R2R A;  1X49 A;  2VE7 C;  2D9H A;  1GQE A;  3ZOQ B;  4O43 A;  1PJQ A;  2EN1 A;  4OOG C;  2DB2 A;  1UIL A;  4JI7 E;  1LLM C;  4F2J C;  2IHR 1;  3MHH C;  3HTX A;  4L5N C;  2DSY A;  2EMG A;  2UXC E;  3ECR A;  4LFA E;  1P47 A;  2EJ4 A;  4B3R E;  1EH6 A;  5IXM B;  4WXC A;  4IS1 C;  3J7A G;  1T38 A;  3FIG A;  3EPL A;  2EMY A;  1DGC A;  2E72 A;  4R2Q A;  2LO3 A;  4HTG A;  1UHZ A;  5KL7 A;  2LMZ A;  4O4K A;  4JI6 E;  1X6F A;  5AE3 A;  1EH8 A;  4JI0 E;  2G7H A;  1ZBQ A;  2YU8 A;  3P1X A;  4AQY E;  2EMK A;  4Q28 A;  1UBD C;  4O5G A;  2L6M A;  1Z1B A;  4X8W A;  1HNZ E;  1XMQ E;  2M1S A;  2EM2 A;  4X65 E;  1GTK A;  3J81 C;  4LF4 E;  2LJH A;  4F9A B;  1XNR E;  4F54 A;  1KYQ A;  2B3T B;  2EMH A;  4LTY A;  4BHC A;  5A2Q C;  2EOX A;  1YUI A;  4IJD A;  4I8O A;  2J7J A;  2JOB A;  1YSA C;  2DIX A;  1A1H A;  2LBS B;  1WHQ A;  2KOU A;  2EM0 A;  5A6B D;  2EOQ A;  4BC7 A;  1HNX E;  2V88 A;  4DR1 E;  1PDA A;  2RS6 A;  1SR9 A;  4DKK A;  4WPY A;  2GPI A;  2ELZ A;  4DV4 E;  2I13 A;  2H36 X;  1YYK A;  1TF6 A;  4F9C B;  2YPN A;  4FK5 C;  4X64 E;  2MC6 A;  4ZYH A;  4GZN C;  4NXM E;  4K0K E;  1TF3 A;  4X9J A;  4BHB A;  1ZBT A;  1A1L A;  2YU5 A;  4B3S E;  4OX9 E;  2EM6 A;  2EOM A;  1IQS A;  5A6A A;  2ODR C;  2YTG A;  4JYA E;  1O0W A;  4R2S A;  3HQ1 A;  2CPN A;  1L4S A;  1ZR9 A;  3KZY A;  4YHH E;  1X5W A;  2EPZ A;  1X48 A;  2DMI A;  2EPN A;  1ZU1 A;  1PKP A;  2BBG A;  2ELY A;  3DF6 A;  2YTI A;  3IWB A;  3KWR A;  1FKA E;  3EPH A;  2K7I A;  2UUB E;  2EN7 A;  4RHB B;  2M4I A;  1N34 E;  1X6H A;  4JI5 E;  2YSP A;  2NA2 A;  3BGH A;  2YSO A;  3EQ1 A;  4ZYD A;  2L3J A;  4GEQ B;  5A6J A;  1HNW E;  4JI3 E;  2EPO A;  1NEI A;  2EQ0 A;  2LJU A;  5AE1 A;  2L8T A;  2E1M A;  4LFB E;  2EL5 A;  4L8N A;  2I9I A;  2RPC A;  2A25 A;  4TUG A;  1N33 E;  5AC4 A;  4WSG A;  2YRM A;  1DI2 A;  3C4B A;  5LL6 R;  2EMI A;  3THO B;  1YPN A;  2EMX A;  2EP3 A;  3JAM C;  1ZAA C;  4Q35 B;  5DNY A;  2NAB A;  3C4T A;  3T1Y E;  1B69 A;  1A1I A;  1X6E A;  4DR7 E;  4P78 A;  2MC5 A;  3IWD A;  1J26 A;  2WZO A;  1QU6 A;  3ADJ A;  2L2N A;  4JI2 E;  4KWY A;  2NUG A;  3VK6 A;  4HEI A;  1KJK A;  1EH7 A;  2V87 A;  5IV8 B;  4O24 A;  2EN2 A;  2LVH A;  3T1H E;  4F9B B;  4LF9 E;  2EMW A;  1N3G A;  2YTO A;  3F6H A;  1WXR A;  1G2D C;  5AE2 A;  1YUJ A;  2DLQ A;  3MHS C;  2JR1 A;  3OML A;  4DR3 E;  4DR2 E;  1HR0 E;  4LF5 E;  2L2K B;  1TN9 A;  1AH5 A;  2HGH A;  2EPC A;  2LV2 A;  2ENH A;  1IQO A;  4X62 E;  2Q8U A;  2EM8 A;  4R03 A;  3J7Y p;  2EPU A;  2EMB A;  2LCE A;  2LTR A;  2MKN A;  2EM7 A;  2V86 A;  4M30 A;  2UU9 E;  4B3T E;  2EPP A;  5KL3 A;  1T4N A;  2HJJ A;  1T39 A;  2EMA A;  2B7T A;  2EL6 A;  2EOF A;  4WFT A;  1T4O A;  1WRJ A;  2DMY A;  1I94 E;  4B3M E;  4JI1 E;  2V85 A;  1WHN A;  2EOR A;  2EOZ A;  4R2E A;  3C6K A;  4ZYG A;  2EM3 A;  2EE8 A;  2RS7 A;  5AAS A;  2LUQ A;  2YTF A;  1A1G A;  2EM4 A;  2EMF A;  2L3C A;  1UN6 B;  2RSM A;  2FTX B;  2EQ1 A;  2EPX A;  4DV6 E;  4LFC E;  4KZS A;  2EPK X;  5KL6 A;  4X66 E;  5AC5 A;  2ENA A;  4TUI A;  2N3H A;  2EPM X;  2YTJ A;  4MLV A;  2JOX A;  2LRS A;  4F6M A;  2LT7 A;  2EOJ A;  1PJS A;  4BBY A;  2EMZ A;  2JYA A;  1WJP A;  2WCC 3;  2JPA A;  2V8Q B;  2BB8 A;  2NUE A;  1N32 E;  2YZT A;  5FLX C;  2YTN A;  1T4L B;  2LE2 A;  4LU9 A;  2CT1 A;  2EOH A; 
#chains in the Genus database with same CATH homology
 1RMD A;  1A1I A;  1X3C A;  1MEY C;  3EPJ A;  1JK2 A;  2EMH A;  1KJK A;  4R2P A;  4F6N A;  2M9A A;  2EOX A;  1YUI A;  2WBS A;  4IJD A;  2EN2 A;  2LVH A;  2J7J A;  2YTE A;  2JP9 A;  1YSA C;  2EMW A;  2YTO A;  1A1K A;  1A1H A;  1G2D C;  2CSH A;  2EM0 A;  2MDG A;  2GHF A;  3UK3 C;  1YUJ A;  2DLQ A;  2EOQ A;  2YRK A;  2GLI A;  3MHS C;  2EOH A;  2EN3 A;  3VHT B;  1B69 A;  2YRH A;  2ELZ A;  2I13 A;  1AAY A;  2ADR A;  2EPR A;  3M99 B;  4R2D A;  1TN9 A;  1TF6 A;  2HGH A;  2EPC A;  2LV2 A;  2ENH A;  2EM8 A;  4FK5 C;  2EL4 A;  2EPU A;  2DRP A;  2EMB A;  2LCE A;  2EMC A;  2EPA A;  4GZN C;  4M9V C;  2MKN A;  2EM7 A;  2EN8 A;  1TF3 A;  4X9J A;  1A1L A;  2YU5 A;  2EN4 A;  2EM6 A;  2EOM A;  2EPP A;  2YTD A;  5KL3 A;  2EOO A;  2EML A;  5KL5 A;  1BB8 A;  2YTG A;  4R2C A;  1F2I G;  2EMA A;  2EQ3 A;  2EM5 A;  2R1F A;  2EN6 A;  2EL6 A;  2CTD A;  2EOF A;  2WBT A;  4R2S A;  1JK1 A;  2RSI A;  2EM9 A;  5KL2 A;  4R2R A;  1ZR9 A;  2DGC A;  1X5W A;  2EOR A;  2PRT A;  2EPZ A;  2DMI A;  4R2A A;  2EOZ A;  4R2E A;  2D9H A;  1ZU1 A;  2EN1 A;  2ELY A;  2EM3 A;  2EE8 A;  1LLM C;  1NCS A;  2YTI A;  4F2J C;  1BBO A;  3MHH C;  2YTF A;  1A1G A;  2EM4 A;  2MKD A;  2EMF A;  1UN6 B;  2EMG A;  3EPH A;  5KL4 A;  2EQ1 A;  2EN7 A;  2EPX A;  2ENC A;  1X6H A;  2YTQ A;  2YSP A;  1G2F C;  1P47 A;  2EJ4 A;  2WBU A;  4IS1 C;  3EPK A;  2YSO A;  5KL6 A;  3EPL A;  2EMY A;  2DLK A;  2ENA A;  1DGC A;  2E72 A;  4R2Q A;  2LO3 A;  1A1F A;  2EQ0 A;  2YTJ A;  5KL7 A;  2VRD A;  4F6M A;  1X6F A;  2EL5 A;  2LT7 A;  2EOJ A;  2RPC A;  2YU8 A;  2A25 A;  2EMZ A;  2EMK A;  2EOS A;  1WJP A;  1UBD C;  2WCC 3;  2JPA A;  4WSG A;  2YRM A;  2BB8 A;  2EOI A;  1Z1B A;  2EMI A;  2EMX A;  2EP3 A;  1ZAA C;  2EOE A;  2NAB A;  2YTN A;  2EOY A;  2CT1 A;  1A1J A;  2YTP A;  1X6E A;  2EM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...