2EN2A

Solution structure of the c2h2 type zinc finger (region 598-626) of human b-cell lymphoma 6 protein
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
42
structure length
42
Chain Sequence
GSSGSSGGEKPYKCETCGARFVQVAHLRAHVLIHTGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords B-cell lymphoma 6 protein
publication title Solution structure of the C2H2 type zinc finger (region 598-626) of human B-cell lymphoma 6 protein
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2en2A01
3EPLA 2EL6A 2GLIA 4R2CA 2CT1A 1WJPA 2EOIA 2EOXA 2GHFA 2EP3A 4WSGA 5KL3A 1NCSA 2YTNA 2ELYA 2PRTA 2YSOA 2ELZA 2EOZA 1UBDC 2EOFA 2M9AA 5KL2A 2EMIA 5KL5A 2YTOA 1G2FC 2EL5A 2EM2A 2EMZA 4R2SA 4F6NA 1A1KA 3EPHA 2EE8A 2EPAA 2E72A 2EN7A 1BBOA 2NABA 2DRPA 1ZU1A 2YRHA 1DGCA 4X9JA 3UK3C 2EMXA 2EMBA 2EN8A 2EMYA 2RPCA 2YSPA 3MHSC 1F2IG 1BB8A 4IJDA 2YRKA 4F2JC 2DLKA 1YUJA 2A25A 2RSIA 2YTPA 1P47A 2EPZA 2EPRA 2CSHA 2DMIA 2EN1A 2DLQA 2ADRA 1A1IA 3M99B 1KJKA 1X3CA 2EM3A 4R2RA 3MHHC 5KL6A 1X6FA 4GZNC 2CTDA 2EN6A 2YTIA 5KL7A 2EM7A 2HGHA 1ZR9A 4R2AA 2YTEA 2EN3A 2EMGA 2EM9A 2EM0A 1A1JA 2YTDA 4FK5C 4R2QA 1RMDA 2JPAA 2EMLA 1ZAAC 1A1GA 3EPKA 2EMKA 2YRMA 2EOMA 2EMAA 2LO3A 2LVHA 2EL4A 2EN4A 2EM5A 2EMFA 2EM6A 2EOYA 2EPCA 1JK2A 1X6HA 2EMCA 1B69A 1TN9A 2ENAA 2EM8A 2EOHA 3EPJA 2MKNA 2EORA 1G2DC 2EOQA 2YTJA 2EOJA 2YU8A 3VHTB 1JK1A 1TF3A 2EJ4A 2LV2A 2EOSA 2EQ0A 1MEYC 4M9VC 1X5WA 2WCC3 2DGCA 2EPPA 2WBSA 2EPXA 1A1FA 1Z1BA 2BB8A 2ENCA 2EN2A 2YTGA 2LT7A 2D9HA 4IS1C 2YTFA 2LCEA 2ENHA 2EOOA 2JP9A 1UN6B 2J7JA 2MKDA 1YUIA 2I13A 2EQ1A 2EMHA 1LLMC 1AAYA 1X6EA 2WBUA 4R2PA 2EMWA 2WBTA 2EQ3A 1YSAC 2EM4A 4F6MA 2EPUA 2MDGA 2EOEA 2YTQA 2VRDA 4R2EA 5KL4A 2R1FA 1A1HA 4R2DA 1TF6A 1A1LA 2YU5A
chains in the Genus database with same CATH superfamily
4DV4E 4R2CA 2EOIA 5DNYA 3C6MA 4DV1E 3C4BA 4WSGA 4L5NC 2ELYA 4X65E 2EPMX 2YSOA 1HR0E 2EOZA 5KL2A 4RH8A 3T1HE 4B3RE 2LRSA 4LF9E 4F6NA 1A1KA 2MC6A 1N34E 2RQLA 1PJTA 2YRHA 4JI1E 3ADLA 2YSPA 2RPCA 3MHSC 4DV0E 4GKJE 3ADIA 4F2JC 3C4TA 4DR1E 1ZBTA 1GZ6A 1T4OA 5A69A 2JOXA 4F9CB 5A6AA 3J81C 3MHHC 1PDAA 2CPNA 2HGHA 2UUCE 4R2AA 1A1JA 2EMGA 2EM0A 2YTDA 3VYXA 4R2QA 2JPAA 2NUEA 2JOBA 2LJUA 2YRMA 4O5GA 4F54A 5AE1A 5AE2A 1YYKA 2ODRD 3BIDA 5TSEA 3F6GA 2EMFA 4HTGA 1X6HA 4JI6E 2N3GA 1B69A 1YZ9A 4KHPE 2ENAA 3TQMA 4KZSA 3IWBA 3THOB 1WRJA 2EOHA 2V8QB 2MKNA 4LFBE 2UU9E 2EORA 2YTJA 2EOJA 3BBGA 2VF1A 4LF5E 2V88A 3VHTB 4X66E 4B3SE 2EQ0A 2DGCA 4X62E 1J26A 2LUQA 5A6KA 2EN2A 1FKAE 4IS1C 1HNWE 2VQEE 2DMYA 2EOOA 2FTXB 3VK6A 1RC7A 3KWRA 4O43A 2FGGA 2WBUA 2VQFE 2EQ3A 1XMQE 4LF4E 1YSAC 2IHR1 4JI5E 3J7AG 1NEIA 2EM4A 2DIXA 2VRDA 3IWCA 2N8XA 2K7IA 3EPLA 2GLIA 4HEIA 3JTZA 2JY9A 2YTNA 2PRTA 2F8BA 2L6MA 2MDRA 4LF6E 4JV5E 1N36E 2YTOA 1G2FC 1O0WA 4ZYEA 3T1YE 3FIGA 4JI2E 2M1SA 2R76A 4ZYHA 5A2QC 2E72A 1BBOA 4I8OA 3P1XA 4J8ZA 4X9JA 2EMXA 5LL6R 4B3TE 2EMYA 2YPNA 1F2IG 4B3ME 1BB8A 1PJSA 2B9DA 2DLKA 4DR6E 1GTKA 4DR7E 1SR9A 3IWDA 1EH8A 4WX9A 2ADRA 1A1IA 3M99B 4NXME 1L4SA 2EM3A 1YYOA 2I9IA 2CTDA 2EPLX 4O24A 2RS7A 4JI3E 5IXMB 1ZR9A 2EN3A 1PJQA 1HNZE 2MC5A 2V89A 2RSMA 3DJWA 1A1GA 2UUBE 2EMAA 2HJJA 1IMUA 1QNTA 2B7VA 2EM5A 2EM6A 2EOYA 3HQ1A 5LMNE 2LE2A 2L3CA 4LTYA 4BS9A 2E1MA 4TUIA 1T38A 2JWOA 4DR3E 2H36X 2LV2A 4ZYGA 2LBSB 3HTXA 1X5WA 4BMJA 2EPPA 2WBSA 4DV5E 2V86A 1Z1BA 2BB8A 3VYYA 2RTXA 1MGTA 2LT7A 1X49A 2UXDE 2JXPA 4JI7E 2YTFA 2L33A 2JP9A 2KONA 5LMUE 4GEQB 2EMHA 2JYAA 4MLVA 1AAYA 1X6EA 4R2PA 2EMWA 5IV8B 3L00A 4P7DA 3DF6A 4M2ZA 2EOEA 2YTQA 4GKKE 4WXCA 2EWLA 1N3GA 4LFCE 1A1LA 2YU5A 2EL6A 2FV4B 2L3JA 1WJPA 2EPOA 5KL3A 1NCSA 1FJGE 4AQYE 4DV3E 2ELZA 1UBDC 3RMPA 2M9AA 2EMIA 1N32E 5KL5A 4M30A 3JAMC 5A6BA 2EL5A 2EM2A 2EMZA 4R2SA 1XNRE 2YZTA 2EE8A 2UXBE 4LF8E 4OOGC 2F4VE 3C6KA 3K6QA 3UK3C 2EMBA 2KHXA 2EN8A 2M7QA 4WFTA 1HNXE 1YUJA 4P78A 3BF2A 2RSIA 2N3HA 2EPNA 2EPZA 2HC5A 2EPRA 1GQEA 2CSHA 4N4RB 3J80C 2HHHE 2YT4A 2EN1A 4LFAE 2EPKX 4JI0E 1WXRA 1DI2A 1XMOE 1X3CA 2L2MA 4NZVA 1KYQA 4WYQB 5KL6A 1STUA 4GZNC 2LMZA 2EN6A 2YTIA 1ZBQA 5KL7A 1UHZA 4DV2E 2YTEA 4O4KA 4FK5C 3ZOQB 4JYAE 3EPKA 4L8NA 5IT9C 2EOMA 1J5EE 3J7Yp 5LLQA 2EL4A 1EH7A 1JK2A 2EMCA 1AH5A 4WXDA 2K4VA 2EM8A 4LU9A 5T6JA 3EPJA 4BC7A 2KOUA 1G2DC 2B7TA 4DR4E 4JI4E 4DMIA 2YU8A 5F3WA 1TF3A 2EJ4A 1MEYC 2EOSA 4M9VC 2BBGA 4RHBB 1WHNA 4DV7E 4WSPA 2ENCA 2YTGA 4YY3E 4BC9A 2D9HA 1T39A 4K0KE 3H09A 1YPNA 2LCEA 2ENHA 1YYWA 2J7JA 2MKDA 3EQ1A 2RS6A 5AC4A 3LMLA 5AC5A 5IWAE 2DB2A 1LLMC 5A6JA 2L8TA 4R8OA 3HXLA 3MSWA 2MDGA 4Q28A 4R2EA 1EKZA 2UUAE 4BHCA 4BCAA 4R2DA 3ADGA 5AE3A 2LJHA 1TF6A 3QG5C 5BR8E 2L2KB 2CT1A 4DR5E 2LTSA 2EOXA 2GHFA 2EP3A 2WZOA 1DQ3A 2V83A 4BHBA 2L92A 1X47A 2UXCE 4X8WA 1EH6A 2EOFA 3KZYA 4YHHE 2M4IA 3HPZA 3ADJA 3THNA 3EPHA 2B3TB 2EPAA 2GPIA 4WPYA 2NA2A 2EN7A 2NABA 2DRPA 1ZU1A 4R03A 1WHQA 1DGCA 4F9BB 2L2NA 4IJDA 4Q35B 2YRKA 2A25A 3ECRA 2ODRC 2YTPA 1T4LB 1P47A 2NUFA 2DMIA 5AASA 4DKKA 2DLQA 3F6HA 1IQSA 1X48A 2VE7C 3KZZA 1KJKA 1UILA 4TUGA 4R2RA 2YWQA 5ADZA 1X6FA 1XNQE 2Q8UA 4DUZE 2EM7A 1RQ0A 4MLQA 2EM9A 1RMDA 3OTOE 2EMLA 1ZAAC 5A6BD 4NHRA 2G7HA 2EMKA 2LO3A 1SFEA 2LVHA 3HPSA 3OMLA 2EN4A 2EPCA 5CFFE 4BBYA 1TN9A 1QU6A 4M0VA 4DR2E 1T4NA 4NXNE 2ZM6E 4F9AB 1I94E 4DV6E 4OX9E 2EOQA 4JI8E 4X64E 4DUYE 2EZ6A 2LUPB 1JK1A 1YFHA 3AV0A 3BGHA 1BBGA 1IBME 2WCC3 1IBKE 1N33E 2EPXA 1A1FA 2JVAA 4KWYA 1IQOA 5FLXC 1IBLE 4ZYDA 1UN6B 2DSYA 1YUIA 2JR1A 2I13A 2EQ1A 3LLHA 4LF7E 2V87A 2WBTA 1PKPA 2LTRA 4F6MA 2EPUA 5KL4A 2R1FA 2NUGA 1A1HA 3AUZA 2E5LE 2V85A 3JU0A
chains in the Genus database with same CATH topology
3EPLA 2EL6A 2GLIA 4R2CA 2CT1A 1WJPA 2EOIA 2EOXA 2GHFA 2EP3A 4WSGA 5KL3A 1NCSA 2YTNA 2ELYA 2PRTA 2YSOA 2ELZA 2EOZA 1UBDC 2EOFA 2M9AA 5KL2A 2EMIA 5KL5A 2YTOA 1G2FC 2EL5A 2EM2A 2EMZA 4R2SA 4F6NA 1A1KA 3EPHA 2EE8A 2EPAA 2E72A 2EN7A 1BBOA 2NABA 2DRPA 1ZU1A 2YRHA 1DGCA 4X9JA 3UK3C 2EMXA 2EMBA 2EN8A 2EMYA 2RPCA 2YSPA 3MHSC 1F2IG 1BB8A 4IJDA 2YRKA 4F2JC 2DLKA 1YUJA 2A25A 2RSIA 2YTPA 1P47A 2EPZA 2EPRA 2CSHA 2DMIA 2EN1A 2DLQA 2ADRA 1A1IA 3M99B 1KJKA 1X3CA 2EM3A 4R2RA 3MHHC 5KL6A 1X6FA 4GZNC 2CTDA 2EN6A 2YTIA 5KL7A 2EM7A 2HGHA 1ZR9A 4R2AA 2YTEA 2EN3A 2EMGA 2EM9A 2EM0A 1A1JA 2YTDA 4FK5C 4R2QA 1RMDA 2JPAA 2EMLA 1ZAAC 1A1GA 3EPKA 2EMKA 2YRMA 2EOMA 2EMAA 2LO3A 2LVHA 2EL4A 2EN4A 2EM5A 2EMFA 2EM6A 2EOYA 2EPCA 1JK2A 1X6HA 2EMCA 1B69A 1TN9A 2ENAA 2EM8A 2EOHA 3EPJA 2MKNA 2EORA 1G2DC 2EOQA 2YTJA 2EOJA 2YU8A 3VHTB 1JK1A 1TF3A 2EJ4A 2LV2A 2EOSA 2EQ0A 1MEYC 4M9VC 1X5WA 2WCC3 2DGCA 2EPPA 2WBSA 2EPXA 1A1FA 1Z1BA 2BB8A 2ENCA 2EN2A 2YTGA 2LT7A 2D9HA 4IS1C 2YTFA 2LCEA 2ENHA 2EOOA 2JP9A 1UN6B 2J7JA 2MKDA 1YUIA 2I13A 2EQ1A 2EMHA 1LLMC 1AAYA 1X6EA 2WBUA 4R2PA 2EMWA 2WBTA 2EQ3A 1YSAC 2EM4A 4F6MA 2EPUA 2MDGA 2EOEA 2YTQA 2VRDA 4R2EA 5KL4A 2R1FA 1A1HA 4R2DA 1TF6A 1A1LA 2YU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EPL A;  2EL6 A;  2GLI A;  4R2C A;  2CT1 A;  1WJP A;  2EOI A;  2EOX A;  2GHF A;  2EP3 A;  4WSG A;  5KL3 A;  1NCS A;  2YTN A;  2ELY A;  2PRT A;  2YSO A;  2ELZ A;  2EOZ A;  1UBD C;  2EOF A;  2M9A A;  5KL2 A;  2EMI A;  5KL5 A;  2YTO A;  1G2F C;  2EL5 A;  2EM2 A;  2EMZ A;  4R2S A;  4F6N A;  1A1K A;  3EPH A;  2EE8 A;  2EPA A;  2E72 A;  2EN7 A;  1BBO A;  2NAB A;  2DRP A;  1ZU1 A;  2YRH A;  1DGC A;  4X9J A;  3UK3 C;  2EMX A;  2EMB A;  2EN8 A;  2EMY A;  2RPC A;  2YSP A;  3MHS C;  1F2I G;  1BB8 A;  4IJD A;  2YRK A;  4F2J C;  2DLK A;  1YUJ A;  2A25 A;  2RSI A;  2YTP A;  1P47 A;  2EPZ A;  2EPR A;  2CSH A;  2DMI A;  2EN1 A;  2DLQ A;  2ADR A;  1A1I A;  3M99 B;  1KJK A;  1X3C A;  2EM3 A;  4R2R A;  3MHH C;  5KL6 A;  1X6F A;  4GZN C;  2CTD A;  2EN6 A;  2YTI A;  5KL7 A;  2EM7 A;  2HGH A;  1ZR9 A;  4R2A A;  2YTE A;  2EN3 A;  2EMG A;  2EM9 A;  2EM0 A;  1A1J A;  2YTD A;  4FK5 C;  4R2Q A;  1RMD A;  2JPA A;  2EML A;  1ZAA C;  1A1G A;  3EPK A;  2EMK A;  2YRM A;  2EOM A;  2EMA A;  2LO3 A;  2LVH A;  2EL4 A;  2EN4 A;  2EM5 A;  2EMF A;  2EM6 A;  2EOY A;  2EPC A;  1JK2 A;  1X6H A;  2EMC A;  1B69 A;  1TN9 A;  2ENA A;  2EM8 A;  2EOH A;  3EPJ A;  2MKN A;  2EOR A;  1G2D C;  2EOQ A;  2YTJ A;  2EOJ A;  2YU8 A;  3VHT B;  1JK1 A;  1TF3 A;  2EJ4 A;  2LV2 A;  2EOS A;  2EQ0 A;  1MEY C;  4M9V C;  1X5W A;  2WCC 3;  2DGC A;  2EPP A;  2WBS A;  2EPX A;  1A1F A;  1Z1B A;  2BB8 A;  2ENC A;  2EN2 A;  2YTG A;  2LT7 A;  2D9H A;  4IS1 C;  2YTF A;  2LCE A;  2ENH A;  2EOO A;  2JP9 A;  1UN6 B;  2J7J A;  2MKD A;  1YUI A;  2I13 A;  2EQ1 A;  2EMH A;  1LLM C;  1AAY A;  1X6E A;  2WBU A;  4R2P A;  2EMW A;  2WBT A;  2EQ3 A;  1YSA C;  2EM4 A;  4F6M A;  2EPU A;  2MDG A;  2EOE A;  2YTQ A;  2VRD A;  4R2E A;  5KL4 A;  2R1F A;  1A1H A;  4R2D A;  1TF6 A;  1A1L A;  2YU5 A; 
#chains in the Genus database with same CATH topology
 4DV4 E;  4R2C A;  2EOI A;  5DNY A;  3C6M A;  4DV1 E;  3C4B A;  4WSG A;  4L5N C;  2ELY A;  4X65 E;  2EPM X;  2YSO A;  1HR0 E;  2EOZ A;  5KL2 A;  4RH8 A;  3T1H E;  4B3R E;  2LRS A;  4LF9 E;  4F6N A;  1A1K A;  2MC6 A;  1N34 E;  2RQL A;  1PJT A;  2YRH A;  4JI1 E;  3ADL A;  2YSP A;  2RPC A;  3MHS C;  4DV0 E;  4GKJ E;  3ADI A;  4F2J C;  3C4T A;  4DR1 E;  1ZBT A;  1GZ6 A;  1T4O A;  5A69 A;  2JOX A;  4F9C B;  5A6A A;  3J81 C;  3MHH C;  1PDA A;  2CPN A;  2HGH A;  2UUC E;  4R2A A;  1A1J A;  2EMG A;  2EM0 A;  2YTD A;  3VYX A;  4R2Q A;  2JPA A;  2NUE A;  2JOB A;  2LJU A;  2YRM A;  4O5G A;  4F54 A;  5AE1 A;  5AE2 A;  1YYK A;  2ODR D;  3BID A;  5TSE A;  3F6G A;  2EMF A;  4HTG A;  1X6H A;  4JI6 E;  2N3G A;  1B69 A;  1YZ9 A;  4KHP E;  2ENA A;  3TQM A;  4KZS A;  3IWB A;  3THO B;  1WRJ A;  2EOH A;  2V8Q B;  2MKN A;  4LFB E;  2UU9 E;  2EOR A;  2YTJ A;  2EOJ A;  3BBG A;  2VF1 A;  4LF5 E;  2V88 A;  3VHT B;  4X66 E;  4B3S E;  2EQ0 A;  2DGC A;  4X62 E;  1J26 A;  2LUQ A;  5A6K A;  2EN2 A;  1FKA E;  4IS1 C;  1HNW E;  2VQE E;  2DMY A;  2EOO A;  2FTX B;  3VK6 A;  1RC7 A;  3KWR A;  4O43 A;  2FGG A;  2WBU A;  2VQF E;  2EQ3 A;  1XMQ E;  4LF4 E;  1YSA C;  2IHR 1;  4JI5 E;  3J7A G;  1NEI A;  2EM4 A;  2DIX A;  2VRD A;  3IWC A;  2N8X A;  2K7I A;  3EPL A;  2GLI A;  4HEI A;  3JTZ A;  2JY9 A;  2YTN A;  2PRT A;  2F8B A;  2L6M A;  2MDR A;  4LF6 E;  4JV5 E;  1N36 E;  2YTO A;  1G2F C;  1O0W A;  4ZYE A;  3T1Y E;  3FIG A;  4JI2 E;  2M1S A;  2R76 A;  4ZYH A;  5A2Q C;  2E72 A;  1BBO A;  4I8O A;  3P1X A;  4J8Z A;  4X9J A;  2EMX A;  5LL6 R;  4B3T E;  2EMY A;  2YPN A;  1F2I G;  4B3M E;  1BB8 A;  1PJS A;  2B9D A;  2DLK A;  4DR6 E;  1GTK A;  4DR7 E;  1SR9 A;  3IWD A;  1EH8 A;  4WX9 A;  2ADR A;  1A1I A;  3M99 B;  4NXM E;  1L4S A;  2EM3 A;  1YYO A;  2I9I A;  2CTD A;  2EPL X;  4O24 A;  2RS7 A;  4JI3 E;  5IXM B;  1ZR9 A;  2EN3 A;  1PJQ A;  1HNZ E;  2MC5 A;  2V89 A;  2RSM A;  3DJW A;  1A1G A;  2UUB E;  2EMA A;  2HJJ A;  1IMU A;  1QNT A;  2B7V A;  2EM5 A;  2EM6 A;  2EOY A;  3HQ1 A;  5LMN E;  2LE2 A;  2L3C A;  4LTY A;  4BS9 A;  2E1M A;  4TUI A;  1T38 A;  2JWO A;  4DR3 E;  2H36 X;  2LV2 A;  4ZYG A;  2LBS B;  3HTX A;  1X5W A;  4BMJ A;  2EPP A;  2WBS A;  4DV5 E;  2V86 A;  1Z1B A;  2BB8 A;  3VYY A;  2RTX A;  1MGT A;  2LT7 A;  1X49 A;  2UXD E;  2JXP A;  4JI7 E;  2YTF A;  2L33 A;  2JP9 A;  2KON A;  5LMU E;  4GEQ B;  2EMH A;  2JYA A;  4MLV A;  1AAY A;  1X6E A;  4R2P A;  2EMW A;  5IV8 B;  3L00 A;  4P7D A;  3DF6 A;  4M2Z A;  2EOE A;  2YTQ A;  4GKK E;  4WXC A;  2EWL A;  1N3G A;  4LFC E;  1A1L A;  2YU5 A;  2EL6 A;  2FV4 B;  2L3J A;  1WJP A;  2EPO A;  5KL3 A;  1NCS A;  1FJG E;  4AQY E;  4DV3 E;  2ELZ A;  1UBD C;  3RMP A;  2M9A A;  2EMI A;  1N32 E;  5KL5 A;  4M30 A;  3JAM C;  5A6B A;  2EL5 A;  2EM2 A;  2EMZ A;  4R2S A;  1XNR E;  2YZT A;  2EE8 A;  2UXB E;  4LF8 E;  4OOG C;  2F4V E;  3C6K A;  3K6Q A;  3UK3 C;  2EMB A;  2KHX A;  2EN8 A;  2M7Q A;  4WFT A;  1HNX E;  1YUJ A;  4P78 A;  3BF2 A;  2RSI A;  2N3H A;  2EPN A;  2EPZ A;  2HC5 A;  2EPR A;  1GQE A;  2CSH A;  4N4R B;  3J80 C;  2HHH E;  2YT4 A;  2EN1 A;  4LFA E;  2EPK X;  4JI0 E;  1WXR A;  1DI2 A;  1XMO E;  1X3C A;  2L2M A;  4NZV A;  1KYQ A;  4WYQ B;  5KL6 A;  1STU A;  4GZN C;  2LMZ A;  2EN6 A;  2YTI A;  1ZBQ A;  5KL7 A;  1UHZ A;  4DV2 E;  2YTE A;  4O4K A;  4FK5 C;  3ZOQ B;  4JYA E;  3EPK A;  4L8N A;  5IT9 C;  2EOM A;  1J5E E;  3J7Y p;  5LLQ A;  2EL4 A;  1EH7 A;  1JK2 A;  2EMC A;  1AH5 A;  4WXD A;  2K4V A;  2EM8 A;  4LU9 A;  5T6J A;  3EPJ A;  4BC7 A;  2KOU A;  1G2D C;  2B7T A;  4DR4 E;  4JI4 E;  4DMI A;  2YU8 A;  5F3W A;  1TF3 A;  2EJ4 A;  1MEY C;  2EOS A;  4M9V C;  2BBG A;  4RHB B;  1WHN A;  4DV7 E;  4WSP A;  2ENC A;  2YTG A;  4YY3 E;  4BC9 A;  2D9H A;  1T39 A;  4K0K E;  3H09 A;  1YPN A;  2LCE A;  2ENH A;  1YYW A;  2J7J A;  2MKD A;  3EQ1 A;  2RS6 A;  5AC4 A;  3LML A;  5AC5 A;  5IWA E;  2DB2 A;  1LLM C;  5A6J A;  2L8T A;  4R8O A;  3HXL A;  3MSW A;  2MDG A;  4Q28 A;  4R2E A;  1EKZ A;  2UUA E;  4BHC A;  4BCA A;  4R2D A;  3ADG A;  5AE3 A;  2LJH A;  1TF6 A;  3QG5 C;  5BR8 E;  2L2K B;  2CT1 A;  4DR5 E;  2LTS A;  2EOX A;  2GHF A;  2EP3 A;  2WZO A;  1DQ3 A;  2V83 A;  4BHB A;  2L92 A;  1X47 A;  2UXC E;  4X8W A;  1EH6 A;  2EOF A;  3KZY A;  4YHH E;  2M4I A;  3HPZ A;  3ADJ A;  3THN A;  3EPH A;  2B3T B;  2EPA A;  2GPI A;  4WPY A;  2NA2 A;  2EN7 A;  2NAB A;  2DRP A;  1ZU1 A;  4R03 A;  1WHQ A;  1DGC A;  4F9B B;  2L2N A;  4IJD A;  4Q35 B;  2YRK A;  2A25 A;  3ECR A;  2ODR C;  2YTP A;  1T4L B;  1P47 A;  2NUF A;  2DMI A;  5AAS A;  4DKK A;  2DLQ A;  3F6H A;  1IQS A;  1X48 A;  2VE7 C;  3KZZ A;  1KJK A;  1UIL A;  4TUG A;  4R2R A;  2YWQ A;  5ADZ A;  1X6F A;  1XNQ E;  2Q8U A;  4DUZ E;  2EM7 A;  1RQ0 A;  4MLQ A;  2EM9 A;  1RMD A;  3OTO E;  2EML A;  1ZAA C;  5A6B D;  4NHR A;  2G7H A;  2EMK A;  2LO3 A;  1SFE A;  2LVH A;  3HPS A;  3OML A;  2EN4 A;  2EPC A;  5CFF E;  4BBY A;  1TN9 A;  1QU6 A;  4M0V A;  4DR2 E;  1T4N A;  4NXN E;  2ZM6 E;  4F9A B;  1I94 E;  4DV6 E;  4OX9 E;  2EOQ A;  4JI8 E;  4X64 E;  4DUY E;  2EZ6 A;  2LUP B;  1JK1 A;  1YFH A;  3AV0 A;  3BGH A;  1BBG A;  1IBM E;  2WCC 3;  1IBK E;  1N33 E;  2EPX A;  1A1F A;  2JVA A;  4KWY A;  1IQO A;  5FLX C;  1IBL E;  4ZYD A;  1UN6 B;  2DSY A;  1YUI A;  2JR1 A;  2I13 A;  2EQ1 A;  3LLH A;  4LF7 E;  2V87 A;  2WBT A;  1PKP A;  2LTR A;  4F6M A;  2EPU A;  5KL4 A;  2R1F A;  2NUG A;  1A1H A;  3AUZ A;  2E5L E;  2V85 A;  3JU0 A; 
#chains in the Genus database with same CATH homology
 3EPL A;  2EL6 A;  2GLI A;  4R2C A;  2CT1 A;  1WJP A;  2EOI A;  2EOX A;  2GHF A;  2EP3 A;  4WSG A;  5KL3 A;  1NCS A;  2YTN A;  2ELY A;  2PRT A;  2YSO A;  2ELZ A;  2EOZ A;  1UBD C;  2EOF A;  2M9A A;  5KL2 A;  2EMI A;  5KL5 A;  2YTO A;  1G2F C;  2EL5 A;  2EM2 A;  2EMZ A;  4R2S A;  4F6N A;  1A1K A;  3EPH A;  2EE8 A;  2EPA A;  2E72 A;  2EN7 A;  1BBO A;  2NAB A;  2DRP A;  1ZU1 A;  2YRH A;  1DGC A;  4X9J A;  3UK3 C;  2EMX A;  2EMB A;  2EN8 A;  2EMY A;  2RPC A;  2YSP A;  3MHS C;  1F2I G;  1BB8 A;  4IJD A;  2YRK A;  4F2J C;  2DLK A;  1YUJ A;  2A25 A;  2RSI A;  2YTP A;  1P47 A;  2EPZ A;  2EPR A;  2CSH A;  2DMI A;  2EN1 A;  2DLQ A;  2ADR A;  1A1I A;  3M99 B;  1KJK A;  1X3C A;  2EM3 A;  4R2R A;  3MHH C;  5KL6 A;  1X6F A;  4GZN C;  2CTD A;  2EN6 A;  2YTI A;  5KL7 A;  2EM7 A;  2HGH A;  1ZR9 A;  4R2A A;  2YTE A;  2EN3 A;  2EMG A;  2EM9 A;  2EM0 A;  1A1J A;  2YTD A;  4FK5 C;  4R2Q A;  1RMD A;  2JPA A;  2EML A;  1ZAA C;  1A1G A;  3EPK A;  2EMK A;  2YRM A;  2EOM A;  2EMA A;  2LO3 A;  2LVH A;  2EL4 A;  2EN4 A;  2EM5 A;  2EMF A;  2EM6 A;  2EOY A;  2EPC A;  1JK2 A;  1X6H A;  2EMC A;  1B69 A;  1TN9 A;  2ENA A;  2EM8 A;  2EOH A;  3EPJ A;  2MKN A;  2EOR A;  1G2D C;  2EOQ A;  2YTJ A;  2EOJ A;  2YU8 A;  3VHT B;  1JK1 A;  1TF3 A;  2EJ4 A;  2LV2 A;  2EOS A;  2EQ0 A;  1MEY C;  4M9V C;  1X5W A;  2WCC 3;  2DGC A;  2EPP A;  2WBS A;  2EPX A;  1A1F A;  1Z1B A;  2BB8 A;  2ENC A;  2EN2 A;  2YTG A;  2LT7 A;  2D9H A;  4IS1 C;  2YTF A;  2LCE A;  2ENH A;  2EOO A;  2JP9 A;  1UN6 B;  2J7J A;  2MKD A;  1YUI A;  2I13 A;  2EQ1 A;  2EMH A;  1LLM C;  1AAY A;  1X6E A;  2WBU A;  4R2P A;  2EMW A;  2WBT A;  2EQ3 A;  1YSA C;  2EM4 A;  4F6M A;  2EPU A;  2MDG A;  2EOE A;  2YTQ A;  2VRD A;  4R2E A;  5KL4 A;  2R1F A;  1A1H A;  4R2D A;  1TF6 A;  1A1L A;  2YU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...