2BB8A

N-terminal dna binding domain from tn916 integrase, nmr, minimized average structure
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
71
structure length
71
Chain Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Site-specific DNA binding using a variation of the double stranded RNA binding motif.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Dna recombination
molecule keywords INTEGRASE
total genus 6
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 1998-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2bb8A00
2DLQA 4R2DA 3MHSC 4R2CA 2R1FA 2WBTA 1A1KA 1A1GA 1JK1A 2EM3A 2ELZA 2YTQA 4F6MA 5KL7A 2EOXA 2EMXA 1TF3A 2D9HA 2YRMA 2RSIA 2EMKA 2RPCA 2DMIA 2EM8A 4R2QA 2YTEA 1X6HA 1B69A 2MKNA 2EN2A 1P47A 1A1JA 2JPAA 2EOSA 2EMHA 5KL6A 2LT7A 2EQ0A 3EPHA 1BBOA 1UN6B 2CSHA 2EN8A 2EMZA 2EMYA 2EOOA 2EQ3A 2ENHA 2YRKA 2EN6A 2ENAA 2EOZA 2YTOA 1AAYA 1ZAAC 3MHHC 2A25A 2LV2A 2MKDA 2EOYA 2WCC3 3VHTB 2EP3A 2WBUA 2EPXA 2YTDA 2EOIA 2VRDA 2ENCA 2EOEA 4GZNC 2YU5A 2EL4A 2EPAA 1YSAC 1G2DC 2ADRA 3EPLA 4F2JC 2EN7A 1YUJA 2YSPA 2EN3A 2YTFA 2EORA 2EJ4A 1ZR9A 2EE8A 1KJKA 1MEYC 2I13A 2EPPA 1TN9A 2E72A 4R2SA 4R2PA 2GLIA 2EMFA 2LO3A 4F6NA 1G2FC 2M9AA 4R2AA 2EMGA 2LCEA 2EOHA 2JP9A 1F2IG 2BB8A 2YTPA 2YTIA 5KL3A 2DGCA 2EOQA 2EPZA 1X6FA 2EOJA 2YTNA 1A1HA 2EM4A 2EMIA 2EPCA 2EOFA 4X9JA 2ELYA 2MDGA 1A1FA 4IJDA 1X6EA 2EL6A 2EMLA 2EM2A 2WBSA 1RMDA 2EPRA 2EMBA 2PRTA 4R2RA 2EM0A 1WJPA 2EN4A 2YSOA 1LLMC 2EMWA 2GHFA 2CTDA 2DLKA 1BB8A 5KL2A 1X3CA 1NCSA 4FK5C 1Z1BA 2EN1A 4IS1C 1TF6A 1DGCA 2EQ1A 4M9VC 2DRPA 2EM9A 2EM7A 1A1LA 1A1IA 2J7JA 2CT1A 1YUIA 2EM6A 2NABA 2HGHA 3EPJA 2YRHA 5KL5A 1X5WA 2EPUA 2YU8A 1UBDC 2EMAA 3M99B 2EL5A 2YTJA 2EMCA 3UK3C 2EM5A 2YTGA 2EOMA 2LVHA 4R2EA 4WSGA 1ZU1A 1JK2A 5KL4A 3EPKA
chains in the Genus database with same CATH superfamily
4HEIA 1T4LB 2BBGA 3MHSC 1A1KA 2N3HA 2F8BA 4DV6E 3C6KA 2EM3A 3AUZA 1MGTA 3ADIA 2EOXA 3VYXA 1HNXE 5AC4A 3KZYA 4BCAA 1B69A 2EN2A 5A6JA 4WX9A 1P47A 4DV3E 4DR4E 2RS7A 5KL6A 3EPHA 5T6JA 2WZOA 3J7Yp 2CSHA 2EMZA 1FKAE 2JOXA 1PJTA 2EQ3A 2V8QB 4HTGA 1O0WA 2EWLA 2V86A 3LLHA 2YTOA 3JTZA 1N34E 2M7QA 2MKDA 2EOYA 2B3TB 1KYQA 3VK6A 1IQSA 2YTDA 2EOEA 4I8OA 2EPLX 2YU5A 4F54A 2L3CA 1T38A 1YUJA 2IHR1 5LMNE 1IMUA 2V85A 2DSYA 4BHBA 2YTFA 2G7HA 4DR3E 2NUEA 1KJKA 3QG5C 1MEYC 2I13A 2ODRC 4JI6E 2NUGA 2L2MA 2EOHA 1F2IG 2YTPA 2YTIA 3IWDA 1ZBQA 4ZYDA 2EOQA 4DV5E 1X6FA 3OTOE 2YTNA 2FGGA 2YWQA 1A1FA 2M4IA 5CFFE 1L4SA 5FLXC 4BBYA 2WBSA 2LJHA 1RMDA 2JY9A 4JI8E 4BHCA 2B7TA 2YSOA 2DIXA 2YT4A 4M30A 4ZYHA 2CTDA 4B3SE 1DQ3A 4JI1E 5KL2A 1X3CA 4O4KA 5F3WA 4WPYA 2EN1A 1Z1BA 3JAMC 2DMYA 2J7JA 1YUIA 2HJJA 2YU8A 3T1YE 1WHQA 5A6BA 4P78A 3M99B 4MLQA 3ADLA 3UK3C 2YTGA 4RHBB 3VYYA 2V87A 4WSGA 4WXDA 2JVAA 4R2EA 1JK2A 5KL4A 5LLQA 1ZBTA 3EPKA 3J7AG 4KHPE 1XMOE 4TUGA 2LTSA 1YFHA 2VF1A 1EH6A 2R1FA 1JK1A 2DB2A 4X64E 2M1SA 1YYOA 4MLVA 5KL7A 2EMXA 5A69A 1N36E 4F9BB 2YRMA 2RSIA 2RPCA 1IBME 4LF4E 4F9CB 2DMIA 2EM8A 4GKKE 4BC9A 4LTYA 2E1MA 2YTEA 3BIDA 2L3JA 4M0VA 3RMPA 2UUCE 1GZ6A 3AV0A 1A1JA 2JPAA 5LL6R 1IBLE 2EMYA 2YRKA 2R76A 2LE2A 1YPNA 3L00A 2B9DA 2L2KB 1X47A 3VHTB 5TSEA 5AE3A 2EPXA 2EOIA 2VRDA 2MDRA 3TQMA 4L8NA 2JOBA 2YPNA 5IT9C 3ADJA 3HPSA 2EN7A 2YSPA 3DF6A 1YZ9A 2EJ4A 3MSWA 4R2SA 1G2FC 4DV4E 4LF5E 1PDAA 3FIGA 4R2AA 2EMGA 2LCEA 4NXME 5A6AA 1GQEA 2EPKX 2BB8A 3LMLA 1WRJA 5AE1A 2FV4B 4LFAE 3BGHA 2EOJA 4R8OA 2RS6A 4DV7E 4X66E 2ELYA 2GPIA 4O24A 4X62E 4J8ZA 4O43A 4BS9A 3KZZA 4WXCA 2EM0A 2L33A 1WJPA 2KOUA 2EN4A 5ADZA 4AQYE 1N33E 1LLMC 2GHFA 1NCSA 2HHHE 4WFTA 1TF6A 1DGCA 3C6MA 1J26A 2DRPA 3EQ1A 1A1IA 2K7IA 3THOB 3T1HE 5KL5A 4JI3E 3THNA 4NXNE 2LMZA 2V88A 4JI4E 1ZU1A 2RQLA 3C4TA 5A6BD 4B3ME 4DV0E 4DR5E 1SFEA 2VQEE 2DLQA 2MC5A 4LFBE 3K6QA 4R2DA 2JR1A 1X48A 2L6MA 4DR2E 1NEIA 2ELZA 2LJUA 4TUIA 4F6MA 2LUPB 4YY3E 5AC5A 2EMKA 1N3GA 2JYAA 2UU9E 1AH5A 3J80C 1X6HA 4JI7E 4LF8E 1STUA 4X65E 2LRSA 3J81C 4DUZE 1FJGE 2LT7A 1PJQA 4ZYEA 2EQ0A 1BBOA 1WXRA 4LF6E 4DR6E 2EN8A 1BBGA 5A6KA 1UHZA 2EOOA 2JWOA 2EN6A 2ENAA 1ZAAC 4GEQB 4Q28A 3MHHC 4X8WA 2LV2A 3DJWA 3HXLA 4KZSA 4JV5E 2UXBE 5IWAE 2H36X 2ENCA 4WSPA 5LMUE 4ZYGA 1XNQE 5IV8B 1G2DC 1YSAC 2ADRA 3EPLA 4F2JC 1UILA 4JI5E 1ZR9A 4JI0E 1XNRE 2EE8A 2CPNA 3KWRA 1PKPA 3IWCA 4BMJA 2EPPA 1TN9A 4DR1E 3BBGA 2L92A 4NZVA 5KL3A 2VQFE 2EPNA 1A1HA 2EM4A 2EMIA 1SR9A 2EOFA 2EPCA 4Q35B 2MDGA 4X9JA 2N3GA 5DNYA 2EMLA 2EM2A 4JYAE 2EPRA 2PRTA 4R2RA 1YYKA 4OX9E 4R03A 2UUAE 2EMWA 2N8XA 1EH8A 4KWYA 2DLKA 2EPOA 4YHHE 4FK5C 2EQ1A 4M9VC 4OOGC 1A1LA 3HQ1A 2KONA 2CT1A 2EM6A 2NABA 3P1XA 2YRHA 4DV1E 1I94E 1X5WA 2EPMX 1QU6A 1T4OA 2EMAA 2NA2A 2YTJA 2EMCA 4NHRA 5IXMB 3C4BA 2B7VA 2L8TA 2VE7C 1HNZE 4R2CA 2KHXA 2EZ6A 2WBTA 1A1GA 1DI2A 1N32E 1EKZA 2I9IA 2YTQA 4K0KE 1TF3A 2D9HA 3BF2A 4DMIA 2RSMA 4B3TE 4R2QA 1QNTA 1HNWE 2MKNA 2EOSA 4DUYE 2EMHA 2MC6A 2E5LE 1UN6B 1WHNA 4RH8A 4O5GA 1PJSA 2ENHA 2NUFA 1T4NA 2EOZA 1T39A 1AAYA 5BR8E 2A25A 1GTKA 2ZM6E 2WCC3 2EP3A 2WBUA 4GZNC 4LU9A 2EL4A 2EPAA 2RTXA 3HPZA 2L2NA 3JU0A 2FTXB 4B3RE 1X49A 3ZOQB 2EN3A 2EORA 3ADGA 2E72A 2LTRA 2UXCE 4N4RB 4R2PA 2EMFA 2LO3A 4F6NA 1XMQE 2GLIA 4GKJE 1IQOA 2M9AA 1RC7A 2JP9A 4LF7E 2UXDE 2YZTA 4BC7A 2DGCA 2EPZA 2V83A 3F6HA 4IJDA 1X6EA 2EL6A 4JI2E 4LFCE 4LF9E 1J5EE 2EMBA 2LBSB 3F6GA 4M2ZA 4DV2E 1EH7A 2JXPA 3ECRA 1HR0E 2K4VA 1BB8A 5AE2A 2F4VE 1IBKE 1YYWA 3OMLA 4IS1C 2Q8UA 4WYQB 2V89A 2EM9A 2EM7A 4L5NC 2HGHA 3EPJA 3H09A 4F9AB 2EPUA 5AASA 1UBDC 4DKKA 2HC5A 2LUQA 4DR7E 2EL5A 2ODRD 4P7DA 2EM5A 2EOMA 3HTXA 2LVHA 1RQ0A 5A2QC 2UUBE 3IWBA
chains in the Genus database with same CATH topology
2DLQA 4R2DA 3MHSC 4R2CA 2R1FA 2WBTA 1A1KA 1A1GA 1JK1A 2EM3A 2ELZA 2YTQA 4F6MA 5KL7A 2EOXA 2EMXA 1TF3A 2D9HA 2YRMA 2RSIA 2EMKA 2RPCA 2DMIA 2EM8A 4R2QA 2YTEA 1X6HA 1B69A 2MKNA 2EN2A 1P47A 1A1JA 2JPAA 2EOSA 2EMHA 5KL6A 2LT7A 2EQ0A 3EPHA 1BBOA 1UN6B 2CSHA 2EN8A 2EMZA 2EMYA 2EOOA 2EQ3A 2ENHA 2YRKA 2EN6A 2ENAA 2EOZA 2YTOA 1AAYA 1ZAAC 3MHHC 2A25A 2LV2A 2MKDA 2EOYA 2WCC3 3VHTB 2EP3A 2WBUA 2EPXA 2YTDA 2EOIA 2VRDA 2ENCA 2EOEA 4GZNC 2YU5A 2EL4A 2EPAA 1YSAC 1G2DC 2ADRA 3EPLA 4F2JC 2EN7A 1YUJA 2YSPA 2EN3A 2YTFA 2EORA 2EJ4A 1ZR9A 2EE8A 1KJKA 1MEYC 2I13A 2EPPA 1TN9A 2E72A 4R2SA 4R2PA 2GLIA 2EMFA 2LO3A 4F6NA 1G2FC 2M9AA 4R2AA 2EMGA 2LCEA 2EOHA 2JP9A 1F2IG 2BB8A 2YTPA 2YTIA 5KL3A 2DGCA 2EOQA 2EPZA 1X6FA 2EOJA 2YTNA 1A1HA 2EM4A 2EMIA 2EPCA 2EOFA 4X9JA 2ELYA 2MDGA 1A1FA 4IJDA 1X6EA 2EL6A 2EMLA 2EM2A 2WBSA 1RMDA 2EPRA 2EMBA 2PRTA 4R2RA 2EM0A 1WJPA 2EN4A 2YSOA 1LLMC 2EMWA 2GHFA 2CTDA 2DLKA 1BB8A 5KL2A 1X3CA 1NCSA 4FK5C 1Z1BA 2EN1A 4IS1C 1TF6A 1DGCA 2EQ1A 4M9VC 2DRPA 2EM9A 2EM7A 1A1LA 1A1IA 2J7JA 2CT1A 1YUIA 2EM6A 2NABA 2HGHA 3EPJA 2YRHA 5KL5A 1X5WA 2EPUA 2YU8A 1UBDC 2EMAA 3M99B 2EL5A 2YTJA 2EMCA 3UK3C 2EM5A 2YTGA 2EOMA 2LVHA 4R2EA 4WSGA 1ZU1A 1JK2A 5KL4A 3EPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DLQ A;  4R2D A;  3MHS C;  4R2C A;  2R1F A;  2WBT A;  1A1K A;  1A1G A;  1JK1 A;  2EM3 A;  2ELZ A;  2YTQ A;  4F6M A;  5KL7 A;  2EOX A;  2EMX A;  1TF3 A;  2D9H A;  2YRM A;  2RSI A;  2EMK A;  2RPC A;  2DMI A;  2EM8 A;  4R2Q A;  2YTE A;  1X6H A;  1B69 A;  2MKN A;  2EN2 A;  1P47 A;  1A1J A;  2JPA A;  2EOS A;  2EMH A;  5KL6 A;  2LT7 A;  2EQ0 A;  3EPH A;  1BBO A;  1UN6 B;  2CSH A;  2EN8 A;  2EMZ A;  2EMY A;  2EOO A;  2EQ3 A;  2ENH A;  2YRK A;  2EN6 A;  2ENA A;  2EOZ A;  2YTO A;  1AAY A;  1ZAA C;  3MHH C;  2A25 A;  2LV2 A;  2MKD A;  2EOY A;  2WCC 3;  3VHT B;  2EP3 A;  2WBU A;  2EPX A;  2YTD A;  2EOI A;  2VRD A;  2ENC A;  2EOE A;  4GZN C;  2YU5 A;  2EL4 A;  2EPA A;  1YSA C;  1G2D C;  2ADR A;  3EPL A;  4F2J C;  2EN7 A;  1YUJ A;  2YSP A;  2EN3 A;  2YTF A;  2EOR A;  2EJ4 A;  1ZR9 A;  2EE8 A;  1KJK A;  1MEY C;  2I13 A;  2EPP A;  1TN9 A;  2E72 A;  4R2S A;  4R2P A;  2GLI A;  2EMF A;  2LO3 A;  4F6N A;  1G2F C;  2M9A A;  4R2A A;  2EMG A;  2LCE A;  2EOH A;  2JP9 A;  1F2I G;  2BB8 A;  2YTP A;  2YTI A;  5KL3 A;  2DGC A;  2EOQ A;  2EPZ A;  1X6F A;  2EOJ A;  2YTN A;  1A1H A;  2EM4 A;  2EMI A;  2EPC A;  2EOF A;  4X9J A;  2ELY A;  2MDG A;  1A1F A;  4IJD A;  1X6E A;  2EL6 A;  2EML A;  2EM2 A;  2WBS A;  1RMD A;  2EPR A;  2EMB A;  2PRT A;  4R2R A;  2EM0 A;  1WJP A;  2EN4 A;  2YSO A;  1LLM C;  2EMW A;  2GHF A;  2CTD A;  2DLK A;  1BB8 A;  5KL2 A;  1X3C A;  1NCS A;  4FK5 C;  1Z1B A;  2EN1 A;  4IS1 C;  1TF6 A;  1DGC A;  2EQ1 A;  4M9V C;  2DRP A;  2EM9 A;  2EM7 A;  1A1L A;  1A1I A;  2J7J A;  2CT1 A;  1YUI A;  2EM6 A;  2NAB A;  2HGH A;  3EPJ A;  2YRH A;  5KL5 A;  1X5W A;  2EPU A;  2YU8 A;  1UBD C;  2EMA A;  3M99 B;  2EL5 A;  2YTJ A;  2EMC A;  3UK3 C;  2EM5 A;  2YTG A;  2EOM A;  2LVH A;  4R2E A;  4WSG A;  1ZU1 A;  1JK2 A;  5KL4 A;  3EPK A; 
#chains in the Genus database with same CATH topology
 4HEI A;  1T4L B;  2BBG A;  3MHS C;  1A1K A;  2N3H A;  2F8B A;  4DV6 E;  3C6K A;  2EM3 A;  3AUZ A;  1MGT A;  3ADI A;  2EOX A;  3VYX A;  1HNX E;  5AC4 A;  3KZY A;  4BCA A;  1B69 A;  2EN2 A;  5A6J A;  4WX9 A;  1P47 A;  4DV3 E;  4DR4 E;  2RS7 A;  5KL6 A;  3EPH A;  5T6J A;  2WZO A;  3J7Y p;  2CSH A;  2EMZ A;  1FKA E;  2JOX A;  1PJT A;  2EQ3 A;  2V8Q B;  4HTG A;  1O0W A;  2EWL A;  2V86 A;  3LLH A;  2YTO A;  3JTZ A;  1N34 E;  2M7Q A;  2MKD A;  2EOY A;  2B3T B;  1KYQ A;  3VK6 A;  1IQS A;  2YTD A;  2EOE A;  4I8O A;  2EPL X;  2YU5 A;  4F54 A;  2L3C A;  1T38 A;  1YUJ A;  2IHR 1;  5LMN E;  1IMU A;  2V85 A;  2DSY A;  4BHB A;  2YTF A;  2G7H A;  4DR3 E;  2NUE A;  1KJK A;  3QG5 C;  1MEY C;  2I13 A;  2ODR C;  4JI6 E;  2NUG A;  2L2M A;  2EOH A;  1F2I G;  2YTP A;  2YTI A;  3IWD A;  1ZBQ A;  4ZYD A;  2EOQ A;  4DV5 E;  1X6F A;  3OTO E;  2YTN A;  2FGG A;  2YWQ A;  1A1F A;  2M4I A;  5CFF E;  1L4S A;  5FLX C;  4BBY A;  2WBS A;  2LJH A;  1RMD A;  2JY9 A;  4JI8 E;  4BHC A;  2B7T A;  2YSO A;  2DIX A;  2YT4 A;  4M30 A;  4ZYH A;  2CTD A;  4B3S E;  1DQ3 A;  4JI1 E;  5KL2 A;  1X3C A;  4O4K A;  5F3W A;  4WPY A;  2EN1 A;  1Z1B A;  3JAM C;  2DMY A;  2J7J A;  1YUI A;  2HJJ A;  2YU8 A;  3T1Y E;  1WHQ A;  5A6B A;  4P78 A;  3M99 B;  4MLQ A;  3ADL A;  3UK3 C;  2YTG A;  4RHB B;  3VYY A;  2V87 A;  4WSG A;  4WXD A;  2JVA A;  4R2E A;  1JK2 A;  5KL4 A;  5LLQ A;  1ZBT A;  3EPK A;  3J7A G;  4KHP E;  1XMO E;  4TUG A;  2LTS A;  1YFH A;  2VF1 A;  1EH6 A;  2R1F A;  1JK1 A;  2DB2 A;  4X64 E;  2M1S A;  1YYO A;  4MLV A;  5KL7 A;  2EMX A;  5A69 A;  1N36 E;  4F9B B;  2YRM A;  2RSI A;  2RPC A;  1IBM E;  4LF4 E;  4F9C B;  2DMI A;  2EM8 A;  4GKK E;  4BC9 A;  4LTY A;  2E1M A;  2YTE A;  3BID A;  2L3J A;  4M0V A;  3RMP A;  2UUC E;  1GZ6 A;  3AV0 A;  1A1J A;  2JPA A;  5LL6 R;  1IBL E;  2EMY A;  2YRK A;  2R76 A;  2LE2 A;  1YPN A;  3L00 A;  2B9D A;  2L2K B;  1X47 A;  3VHT B;  5TSE A;  5AE3 A;  2EPX A;  2EOI A;  2VRD A;  2MDR A;  3TQM A;  4L8N A;  2JOB A;  2YPN A;  5IT9 C;  3ADJ A;  3HPS A;  2EN7 A;  2YSP A;  3DF6 A;  1YZ9 A;  2EJ4 A;  3MSW A;  4R2S A;  1G2F C;  4DV4 E;  4LF5 E;  1PDA A;  3FIG A;  4R2A A;  2EMG A;  2LCE A;  4NXM E;  5A6A A;  1GQE A;  2EPK X;  2BB8 A;  3LML A;  1WRJ A;  5AE1 A;  2FV4 B;  4LFA E;  3BGH A;  2EOJ A;  4R8O A;  2RS6 A;  4DV7 E;  4X66 E;  2ELY A;  2GPI A;  4O24 A;  4X62 E;  4J8Z A;  4O43 A;  4BS9 A;  3KZZ A;  4WXC A;  2EM0 A;  2L33 A;  1WJP A;  2KOU A;  2EN4 A;  5ADZ A;  4AQY E;  1N33 E;  1LLM C;  2GHF A;  1NCS A;  2HHH E;  4WFT A;  1TF6 A;  1DGC A;  3C6M A;  1J26 A;  2DRP A;  3EQ1 A;  1A1I A;  2K7I A;  3THO B;  3T1H E;  5KL5 A;  4JI3 E;  3THN A;  4NXN E;  2LMZ A;  2V88 A;  4JI4 E;  1ZU1 A;  2RQL A;  3C4T A;  5A6B D;  4B3M E;  4DV0 E;  4DR5 E;  1SFE A;  2VQE E;  2DLQ A;  2MC5 A;  4LFB E;  3K6Q A;  4R2D A;  2JR1 A;  1X48 A;  2L6M A;  4DR2 E;  1NEI A;  2ELZ A;  2LJU A;  4TUI A;  4F6M A;  2LUP B;  4YY3 E;  5AC5 A;  2EMK A;  1N3G A;  2JYA A;  2UU9 E;  1AH5 A;  3J80 C;  1X6H A;  4JI7 E;  4LF8 E;  1STU A;  4X65 E;  2LRS A;  3J81 C;  4DUZ E;  1FJG E;  2LT7 A;  1PJQ A;  4ZYE A;  2EQ0 A;  1BBO A;  1WXR A;  4LF6 E;  4DR6 E;  2EN8 A;  1BBG A;  5A6K A;  1UHZ A;  2EOO A;  2JWO A;  2EN6 A;  2ENA A;  1ZAA C;  4GEQ B;  4Q28 A;  3MHH C;  4X8W A;  2LV2 A;  3DJW A;  3HXL A;  4KZS A;  4JV5 E;  2UXB E;  5IWA E;  2H36 X;  2ENC A;  4WSP A;  5LMU E;  4ZYG A;  1XNQ E;  5IV8 B;  1G2D C;  1YSA C;  2ADR A;  3EPL A;  4F2J C;  1UIL A;  4JI5 E;  1ZR9 A;  4JI0 E;  1XNR E;  2EE8 A;  2CPN A;  3KWR A;  1PKP A;  3IWC A;  4BMJ A;  2EPP A;  1TN9 A;  4DR1 E;  3BBG A;  2L92 A;  4NZV A;  5KL3 A;  2VQF E;  2EPN A;  1A1H A;  2EM4 A;  2EMI A;  1SR9 A;  2EOF A;  2EPC A;  4Q35 B;  2MDG A;  4X9J A;  2N3G A;  5DNY A;  2EML A;  2EM2 A;  4JYA E;  2EPR A;  2PRT A;  4R2R A;  1YYK A;  4OX9 E;  4R03 A;  2UUA E;  2EMW A;  2N8X A;  1EH8 A;  4KWY A;  2DLK A;  2EPO A;  4YHH E;  4FK5 C;  2EQ1 A;  4M9V C;  4OOG C;  1A1L A;  3HQ1 A;  2KON A;  2CT1 A;  2EM6 A;  2NAB A;  3P1X A;  2YRH A;  4DV1 E;  1I94 E;  1X5W A;  2EPM X;  1QU6 A;  1T4O A;  2EMA A;  2NA2 A;  2YTJ A;  2EMC A;  4NHR A;  5IXM B;  3C4B A;  2B7V A;  2L8T A;  2VE7 C;  1HNZ E;  4R2C A;  2KHX A;  2EZ6 A;  2WBT A;  1A1G A;  1DI2 A;  1N32 E;  1EKZ A;  2I9I A;  2YTQ A;  4K0K E;  1TF3 A;  2D9H A;  3BF2 A;  4DMI A;  2RSM A;  4B3T E;  4R2Q A;  1QNT A;  1HNW E;  2MKN A;  2EOS A;  4DUY E;  2EMH A;  2MC6 A;  2E5L E;  1UN6 B;  1WHN A;  4RH8 A;  4O5G A;  1PJS A;  2ENH A;  2NUF A;  1T4N A;  2EOZ A;  1T39 A;  1AAY A;  5BR8 E;  2A25 A;  1GTK A;  2ZM6 E;  2WCC 3;  2EP3 A;  2WBU A;  4GZN C;  4LU9 A;  2EL4 A;  2EPA A;  2RTX A;  3HPZ A;  2L2N A;  3JU0 A;  2FTX B;  4B3R E;  1X49 A;  3ZOQ B;  2EN3 A;  2EOR A;  3ADG A;  2E72 A;  2LTR A;  2UXC E;  4N4R B;  4R2P A;  2EMF A;  2LO3 A;  4F6N A;  1XMQ E;  2GLI A;  4GKJ E;  1IQO A;  2M9A A;  1RC7 A;  2JP9 A;  4LF7 E;  2UXD E;  2YZT A;  4BC7 A;  2DGC A;  2EPZ A;  2V83 A;  3F6H A;  4IJD A;  1X6E A;  2EL6 A;  4JI2 E;  4LFC E;  4LF9 E;  1J5E E;  2EMB A;  2LBS B;  3F6G A;  4M2Z A;  4DV2 E;  1EH7 A;  2JXP A;  3ECR A;  1HR0 E;  2K4V A;  1BB8 A;  5AE2 A;  2F4V E;  1IBK E;  1YYW A;  3OML A;  4IS1 C;  2Q8U A;  4WYQ B;  2V89 A;  2EM9 A;  2EM7 A;  4L5N C;  2HGH A;  3EPJ A;  3H09 A;  4F9A B;  2EPU A;  5AAS A;  1UBD C;  4DKK A;  2HC5 A;  2LUQ A;  4DR7 E;  2EL5 A;  2ODR D;  4P7D A;  2EM5 A;  2EOM A;  3HTX A;  2LVH A;  1RQ0 A;  5A2Q C;  2UUB E;  3IWB A; 
#chains in the Genus database with same CATH homology
 2DLQ A;  4R2D A;  3MHS C;  4R2C A;  2R1F A;  2WBT A;  1A1K A;  1A1G A;  1JK1 A;  2EM3 A;  2ELZ A;  2YTQ A;  4F6M A;  5KL7 A;  2EOX A;  2EMX A;  1TF3 A;  2D9H A;  2YRM A;  2RSI A;  2EMK A;  2RPC A;  2DMI A;  2EM8 A;  4R2Q A;  2YTE A;  1X6H A;  1B69 A;  2MKN A;  2EN2 A;  1P47 A;  1A1J A;  2JPA A;  2EOS A;  2EMH A;  5KL6 A;  2LT7 A;  2EQ0 A;  3EPH A;  1BBO A;  1UN6 B;  2CSH A;  2EN8 A;  2EMZ A;  2EMY A;  2EOO A;  2EQ3 A;  2ENH A;  2YRK A;  2EN6 A;  2ENA A;  2EOZ A;  2YTO A;  1AAY A;  1ZAA C;  3MHH C;  2A25 A;  2LV2 A;  2MKD A;  2EOY A;  2WCC 3;  3VHT B;  2EP3 A;  2WBU A;  2EPX A;  2YTD A;  2EOI A;  2VRD A;  2ENC A;  2EOE A;  4GZN C;  2YU5 A;  2EL4 A;  2EPA A;  1YSA C;  1G2D C;  2ADR A;  3EPL A;  4F2J C;  2EN7 A;  1YUJ A;  2YSP A;  2EN3 A;  2YTF A;  2EOR A;  2EJ4 A;  1ZR9 A;  2EE8 A;  1KJK A;  1MEY C;  2I13 A;  2EPP A;  1TN9 A;  2E72 A;  4R2S A;  4R2P A;  2GLI A;  2EMF A;  2LO3 A;  4F6N A;  1G2F C;  2M9A A;  4R2A A;  2EMG A;  2LCE A;  2EOH A;  2JP9 A;  1F2I G;  2BB8 A;  2YTP A;  2YTI A;  5KL3 A;  2DGC A;  2EOQ A;  2EPZ A;  1X6F A;  2EOJ A;  2YTN A;  1A1H A;  2EM4 A;  2EMI A;  2EPC A;  2EOF A;  4X9J A;  2ELY A;  2MDG A;  1A1F A;  4IJD A;  1X6E A;  2EL6 A;  2EML A;  2EM2 A;  2WBS A;  1RMD A;  2EPR A;  2EMB A;  2PRT A;  4R2R A;  2EM0 A;  1WJP A;  2EN4 A;  2YSO A;  1LLM C;  2EMW A;  2GHF A;  2CTD A;  2DLK A;  1BB8 A;  5KL2 A;  1X3C A;  1NCS A;  4FK5 C;  1Z1B A;  2EN1 A;  4IS1 C;  1TF6 A;  1DGC A;  2EQ1 A;  4M9V C;  2DRP A;  2EM9 A;  2EM7 A;  1A1L A;  1A1I A;  2J7J A;  2CT1 A;  1YUI A;  2EM6 A;  2NAB A;  2HGH A;  3EPJ A;  2YRH A;  5KL5 A;  1X5W A;  2EPU A;  2YU8 A;  1UBD C;  2EMA A;  3M99 B;  2EL5 A;  2YTJ A;  2EMC A;  3UK3 C;  2EM5 A;  2YTG A;  2EOM A;  2LVH A;  4R2E A;  4WSG A;  1ZU1 A;  1JK2 A;  5KL4 A;  3EPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...