2BB8A

N-terminal dna binding domain from tn916 integrase, nmr, minimized average structure
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
71
structure length
71
Chain Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna recombination
molecule keywords INTEGRASE
publication title Site-specific DNA binding using a variation of the double stranded RNA binding motif.
pubmed doi rcsb
source organism Enterococcus faecalis
total genus 6
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 1998-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2bb8A00
2EMCA 2EN4A 1A1FA 2EOSA 2EM4A 1P47A 2JPAA 2DLQA 4R2PA 2EORA 2EOFA 2EOIA 4R2SA 1JK1A 1B69A 3MHSC 2YRHA 2J7JA 2YRKA 2YTIA 4F6MA 1BBOA 2EPAA 2LO3A 2EN2A 2EMXA 2EM9A 2DGCA 2EOOA 1TF6A 2HGHA 1KJKA 2EMKA 1LLMC 2CT1A 2EL5A 4FK5C 3EPJA 2EM6A 1WJPA 5KL4A 2YTFA 2WBSA 1TF3A 1UBDC 2WCC3 2DLKA 2DRPA 2EN1A 3EPLA 2EPZA 2EQ0A 2NABA 2EPUA 4F6NA 2GLIA 5KL3A 1X6HA 2LT7A 2EQ1A 2VRDA 4X9JA 1A1GA 2EM8A 2EOZA 5KL2A 1ZU1A 4R2EA 2YTDA 3VHTB 2EOQA 2WBUA 1Z1BA 2ENHA 4M9VC 3MHHC 2EE8A 2EN6A 2EOJA 2LCEA 1X6FA 2ENAA 5KL7A 2EMHA 2MKNA 2I13A 2YSOA 4IJDA 2EPRA 2YTPA 3M99B 2CSHA 1YSAC 2EN3A 1X6EA 1A1IA 2YTNA 1YUIA 2EOEA 2YTJA 2ENCA 2ELYA 3EPHA 1X3CA 5KL5A 2YU8A 2EP3A 2EL4A 4R2QA 2YRMA 2EL6A 1UN6B 2EMAA 1DGCA 1AAYA 1TN9A 2EMWA 2EJ4A 2EMBA 2LV2A 2EMGA 2ADRA 2YTGA 2EOXA 2EMZA 2EMIA 2WBTA 4F2JC 2EMLA 1A1LA 2LVHA 2ELZA 2MKDA 2YU5A 2GHFA 1X5WA 2EOHA 1JK2A 1G2FC 3EPKA 4R2RA 2EPPA 2YSPA 2YTEA 4WSGA 2EPCA 4R2DA 2EQ3A 4GZNC 1A1JA 2EMFA 2JP9A 4R2AA 1ZR9A 2BB8A 2A25A 1A1HA 2EM2A 2EMYA 2EM5A 2EN7A 2MDGA 2R1FA 1MEYC 2RSIA 2RPCA 3UK3C 1ZAAC 2DMIA 5KL6A 2YTQA 1F2IG 2EM3A 4R2CA 2EM7A 1G2DC 1A1KA 1YUJA 1NCSA 2EOMA 2EPXA 2YTOA 2EM0A 2EOYA 2D9HA 1BB8A 2EN8A 2CTDA 2E72A 2PRTA 2M9AA 1RMDA 4IS1C
chains in the Genus database with same CATH superfamily
4N4RB 4KHPE 4TUIA 2EM4A 2L2MA 1NEIA 3ADGA 2Q8UA 1HNXE 1JK1A 2KOUA 2YRHA 2J7JA 1EH7A 2YTIA 4JI3E 2KONA 4B3RE 2EN2A 2EM9A 2L92A 3IWDA 2DGCA 1KJKA 3ZOQB 2VF1A 1LLMC 2YWQA 4ZYGA 2L8TA 2EM6A 2LUPB 2EPOA 3OTOE 2VQEE 4BHBA 4X8WA 4GKJE 2L6MA 2DRPA 3EPLA 2RS6A 2IHR1 2EPUA 4M30A 3H09A 1I94E 2EQ1A 4X9JA 4BC9A 3C6KA 3ADLA 1Z1BA 4LU9A 2BBGA 4F9BB 4HEIA 2EMHA 4P78A 2UUBE 5FLXC 2RS7A 1N34E 2YTPA 3M99B 1FJGE 1X6EA 2YTNA 2YTJA 3MSWA 4J8ZA 4JI0E 2LTRA 5KL5A 2YU8A 4DV5E 2EL6A 4LFAE 1AAYA 2EMWA 5LMUE 2JY9A 3JAMC 2LV2A 2ADRA 2YTGA 2EMZA 4F2JC 2WBTA 1A1LA 2GPIA 2ELZA 2UUAE 4M2ZA 1JK2A 1ZBTA 1PJSA 2KHXA 2MC5A 1HNZE 2VQFE 2YTEA 1PJQA 1YFHA 4R2DA 1A1JA 2EMFA 3IWCA 2UU9E 4JI1E 2N8XA 2JYAA 3JTZA 4WXCA 2DSYA 2EMYA 2EM5A 2R1FA 2H36X 2I9IA 2N3HA 4HTGA 1MEYC 2JOBA 2RSIA 4M0VA 3UK3C 4DKKA 5KL6A 2E1MA 2N3GA 2DIXA 3THNA 2CPNA 1G2DC 5LL6R 1YUJA 1ZBQA 4WX9A 2EPXA 3J7Yp 2D9HA 2M1SA 4R8OA 2EPMX 4DR6E 3LLHA 1XMOE 2LRSA 2M9AA 1RMDA 1T4NA 1QU6A 1P47A 4R2PA 2EOIA 4R2SA 4DUZE 4LF7E 1J26A 4BC7A 1B69A 1YYKA 1IMUA 3VYXA 4LF6E 4GKKE 4WXDA 1TF6A 1IBLE 3QG5C 5AC4A 1PDAA 3KZYA 4ZYDA 3AUZA 2LUQA 3DF6A 1TF3A 4KWYA 4LF4E 2DLKA 3TQMA 2UXDE 4NZVA 2EPZA 3ADJA 1RC7A 2K7IA 4LTYA 4WPYA 2GLIA 4L8NA 1X6HA 5AE3A 5CFFE 2LT7A 5DNYA 4NXNE 3F6HA 4WSPA 1QNTA 5A69A 1UILA 3ECRA 4R2EA 2R76A 2YTDA 3J81C 2EOQA 3BGHA 3MHHC 3P1XA 2EN6A 5A6KA 1X6FA 2ENAA 2EPLX 5KL7A 2ODRD 4OOGC 4L5NC 2YSOA 1WXRA 2B7VA 2JR1A 3T1YE 2NA2A 2EPNA 1YSAC 1YUIA 3HPSA 3BIDA 2FTXB 1T38A 2UXCE 1X3CA 2HC5A 1N32E 2EP3A 3DJWA 4YHHE 4DR5E 1PJTA 1T39A 1T4LB 1DGCA 4WYQB 2EWLA 4O4KA 4DMIA 3AV0A 2EJ4A 4DV2E 1EH6A 3C4TA 2V85A 3HQ1A 2LVHA 1X5WA 3T1HE 4K0KE 3EPKA 2L3CA 3HTXA 1YYOA 4ZYEA 2B9DA 2YSPA 2V89A 4WSGA 2EPCA 4DV6E 4B3SE 4R2AA 4F54A 2BB8A 2EN7A 2MDGA 4DR3E 2L33A 3OMLA 4R03A 4X64E 2V83A 4OX9E 2NUFA 2YTQA 4NHRA 2MC6A 4O43A 1T4OA 4B3ME 1WRJA 2JWOA 2FGGA 5T6JA 2EOYA 4Q35B 2DB2A 2EN8A 4JI8E 4JI2E 3IWBA 1IBKE 2EOFA 2E5LE 1HR0E 5A6AA 1FKAE 4ZYHA 3FIGA 5IT9C 1BBOA 1EKZA 1BBGA 2EPAA 1GQEA 2EOOA 2HGHA 4I8OA 2EMKA 1J5EE 5LLQA 2CT1A 4O5GA 1X49A 2EL5A 3EPJA 5TSEA 1WJPA 1WHQA 4LFCE 5KL4A 5BR8E 2L2KB 5AE2A 2F8BA 2YTFA 2WBSA 1UBDC 2WCC3 2EN1A 3C4BA 2YT4A 2NABA 2VE7C 4F6NA 5KL3A 4LF8E 5A6JA 2VRDA 2V88A 5IWAE 2EM8A 2EOZA 5KL2A 1L4SA 4DV0E 2LJHA 1N33E 1X48A 2ENHA 3JU0A 5AC5A 3THOB 4M9VC 2EOJA 2LCEA 2YPNA 4F9AB 2M4IA 2I13A 3ADIA 5AE1A 4LF5E 1O0WA 2EPRA 4X66E 1X47A 4DV7E 2RSMA 2ENCA 2HHHE 2ELYA 4NXME 2JXPA 2EL4A 4R2QA 5A6BD 2YRMA 4BCAA 5AASA 1UN6B 2EMAA 1TN9A 4JYAE 2EMBA 4LF9E 2EPKX 3BF2A 2EMLA 3EQ1A 2L3JA 2M7QA 2YU5A 2B7TA 1SR9A 1G2FC 4DR7E 4R2RA 5IXMB 1SFEA 2EPPA 5A2QC 3RMPA 1IQSA 4JI6E 3J80C 1ZR9A 4DR2E 2F4VE 1KYQA 2A25A 4X65E 4O24A 4DV1E 2EM2A 2RPCA 4WFTA 2DMIA 1N3GA 2MDRA 5A6BA 2LMZA 1NCSA 2YTOA 4JI5E 1BB8A 3VK6A 1XNRE 2CTDA 4F9CB 1GZ6A 1MGTA 4IS1C 2EMCA 2EN4A 1A1FA 2EOSA 5ADZA 4TUGA 2JPAA 3KZZA 2DLQA 2EORA 4KZSA 4RHBB 4DR1E 3MHSC 2RQLA 2YRKA 4F6MA 2LTSA 2LJUA 2LO3A 2NUGA 4DUYE 2EMXA 2K4VA 3LMLA 3HXLA 3J7AG 4DV3E 4FK5C 1GTKA 1YYWA 2B3TB 1IBME 2V8QB 2ODRC 1EH8A 3VYYA 1YZ9A 4X62E 2EQ0A 1HNWE 2V86A 3F6GA 4LFBE 2ZM6E 1N36E 2LBSB 1A1GA 4GEQB 1ZU1A 3VHTB 1DI2A 1IQOA 2WBUA 2UUCE 5IV8B 2EE8A 1RQ0A 2DMYA 2MKNA 4Q28A 1DQ3A 2YZTA 4IJDA 1XNQE 1UHZA 4JI4E 2CSHA 4BMJA 1AH5A 2EN3A 4BHCA 1A1IA 2EOEA 2LE2A 3L00A 3EPHA 4P7DA 1XMQE 4B3TE 4BS9A 2NUEA 2EZ6A 2EMGA 4DR4E 1PKPA 2EOXA 2EMIA 2FV4B 1YPNA 4RH8A 3K6QA 2MKDA 2GHFA 5LMNE 2EOHA 2JVAA 2RTXA 2V87A 4JV5E 3KWRA 2WZOA 4DV4E 2EQ3A 4GZNC 2JP9A 1STUA 2UXBE 1A1HA 4BBYA 3HPZA 3C6MA 1ZAAC 1F2IG 2EM3A 4MLVA 4R2CA 2EM7A 2G7HA 2HJJA 4MLQA 1A1KA 3BBGA 4JI7E 2JOXA 4AQYE 2EOMA 2EM0A 5F3WA 1WHNA 2L2NA 2E72A 2PRTA 4YY3E
chains in the Genus database with same CATH topology
2EMCA 2EN4A 1A1FA 2EOSA 2EM4A 1P47A 2JPAA 2DLQA 4R2PA 2EORA 2EOFA 2EOIA 4R2SA 1JK1A 1B69A 3MHSC 2YRHA 2J7JA 2YRKA 2YTIA 4F6MA 1BBOA 2EPAA 2LO3A 2EN2A 2EMXA 2EM9A 2DGCA 2EOOA 1TF6A 2HGHA 1KJKA 2EMKA 1LLMC 2CT1A 2EL5A 4FK5C 3EPJA 2EM6A 1WJPA 5KL4A 2YTFA 2WBSA 1TF3A 1UBDC 2WCC3 2DLKA 2DRPA 2EN1A 3EPLA 2EPZA 2EQ0A 2NABA 2EPUA 4F6NA 2GLIA 5KL3A 1X6HA 2LT7A 2EQ1A 2VRDA 4X9JA 1A1GA 2EM8A 2EOZA 5KL2A 1ZU1A 4R2EA 2YTDA 3VHTB 2EOQA 2WBUA 1Z1BA 2ENHA 4M9VC 3MHHC 2EE8A 2EN6A 2EOJA 2LCEA 1X6FA 2ENAA 5KL7A 2EMHA 2MKNA 2I13A 2YSOA 4IJDA 2EPRA 2YTPA 3M99B 2CSHA 1YSAC 2EN3A 1X6EA 1A1IA 2YTNA 1YUIA 2EOEA 2YTJA 2ENCA 2ELYA 3EPHA 1X3CA 5KL5A 2YU8A 2EP3A 2EL4A 4R2QA 2YRMA 2EL6A 1UN6B 2EMAA 1DGCA 1AAYA 1TN9A 2EMWA 2EJ4A 2EMBA 2LV2A 2EMGA 2ADRA 2YTGA 2EOXA 2EMZA 2EMIA 2WBTA 4F2JC 2EMLA 1A1LA 2LVHA 2ELZA 2MKDA 2YU5A 2GHFA 1X5WA 2EOHA 1JK2A 1G2FC 3EPKA 4R2RA 2EPPA 2YSPA 2YTEA 4WSGA 2EPCA 4R2DA 2EQ3A 4GZNC 1A1JA 2EMFA 2JP9A 4R2AA 1ZR9A 2BB8A 2A25A 1A1HA 2EM2A 2EMYA 2EM5A 2EN7A 2MDGA 2R1FA 1MEYC 2RSIA 2RPCA 3UK3C 1ZAAC 2DMIA 5KL6A 2YTQA 1F2IG 2EM3A 4R2CA 2EM7A 1G2DC 1A1KA 1YUJA 1NCSA 2EOMA 2EPXA 2YTOA 2EM0A 2EOYA 2D9HA 1BB8A 2EN8A 2CTDA 2E72A 2PRTA 2M9AA 1RMDA 4IS1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMC A;  2EN4 A;  1A1F A;  2EOS A;  2EM4 A;  1P47 A;  2JPA A;  2DLQ A;  4R2P A;  2EOR A;  2EOF A;  2EOI A;  4R2S A;  1JK1 A;  1B69 A;  3MHS C;  2YRH A;  2J7J A;  2YRK A;  2YTI A;  4F6M A;  1BBO A;  2EPA A;  2LO3 A;  2EN2 A;  2EMX A;  2EM9 A;  2DGC A;  2EOO A;  1TF6 A;  2HGH A;  1KJK A;  2EMK A;  1LLM C;  2CT1 A;  2EL5 A;  4FK5 C;  3EPJ A;  2EM6 A;  1WJP A;  5KL4 A;  2YTF A;  2WBS A;  1TF3 A;  1UBD C;  2WCC 3;  2DLK A;  2DRP A;  2EN1 A;  3EPL A;  2EPZ A;  2EQ0 A;  2NAB A;  2EPU A;  4F6N A;  2GLI A;  5KL3 A;  1X6H A;  2LT7 A;  2EQ1 A;  2VRD A;  4X9J A;  1A1G A;  2EM8 A;  2EOZ A;  5KL2 A;  1ZU1 A;  4R2E A;  2YTD A;  3VHT B;  2EOQ A;  2WBU A;  1Z1B A;  2ENH A;  4M9V C;  3MHH C;  2EE8 A;  2EN6 A;  2EOJ A;  2LCE A;  1X6F A;  2ENA A;  5KL7 A;  2EMH A;  2MKN A;  2I13 A;  2YSO A;  4IJD A;  2EPR A;  2YTP A;  3M99 B;  2CSH A;  1YSA C;  2EN3 A;  1X6E A;  1A1I A;  2YTN A;  1YUI A;  2EOE A;  2YTJ A;  2ENC A;  2ELY A;  3EPH A;  1X3C A;  5KL5 A;  2YU8 A;  2EP3 A;  2EL4 A;  4R2Q A;  2YRM A;  2EL6 A;  1UN6 B;  2EMA A;  1DGC A;  1AAY A;  1TN9 A;  2EMW A;  2EJ4 A;  2EMB A;  2LV2 A;  2EMG A;  2ADR A;  2YTG A;  2EOX A;  2EMZ A;  2EMI A;  2WBT A;  4F2J C;  2EML A;  1A1L A;  2LVH A;  2ELZ A;  2MKD A;  2YU5 A;  2GHF A;  1X5W A;  2EOH A;  1JK2 A;  1G2F C;  3EPK A;  4R2R A;  2EPP A;  2YSP A;  2YTE A;  4WSG A;  2EPC A;  4R2D A;  2EQ3 A;  4GZN C;  1A1J A;  2EMF A;  2JP9 A;  4R2A A;  1ZR9 A;  2BB8 A;  2A25 A;  1A1H A;  2EM2 A;  2EMY A;  2EM5 A;  2EN7 A;  2MDG A;  2R1F A;  1MEY C;  2RSI A;  2RPC A;  3UK3 C;  1ZAA C;  2DMI A;  5KL6 A;  2YTQ A;  1F2I G;  2EM3 A;  4R2C A;  2EM7 A;  1G2D C;  1A1K A;  1YUJ A;  1NCS A;  2EOM A;  2EPX A;  2YTO A;  2EM0 A;  2EOY A;  2D9H A;  1BB8 A;  2EN8 A;  2CTD A;  2E72 A;  2PRT A;  2M9A A;  1RMD A;  4IS1 C; 
#chains in the Genus database with same CATH topology
 4N4R B;  4KHP E;  4TUI A;  2EM4 A;  2L2M A;  1NEI A;  3ADG A;  2Q8U A;  1HNX E;  1JK1 A;  2KOU A;  2YRH A;  2J7J A;  1EH7 A;  2YTI A;  4JI3 E;  2KON A;  4B3R E;  2EN2 A;  2EM9 A;  2L92 A;  3IWD A;  2DGC A;  1KJK A;  3ZOQ B;  2VF1 A;  1LLM C;  2YWQ A;  4ZYG A;  2L8T A;  2EM6 A;  2LUP B;  2EPO A;  3OTO E;  2VQE E;  4BHB A;  4X8W A;  4GKJ E;  2L6M A;  2DRP A;  3EPL A;  2RS6 A;  2IHR 1;  2EPU A;  4M30 A;  3H09 A;  1I94 E;  2EQ1 A;  4X9J A;  4BC9 A;  3C6K A;  3ADL A;  1Z1B A;  4LU9 A;  2BBG A;  4F9B B;  4HEI A;  2EMH A;  4P78 A;  2UUB E;  5FLX C;  2RS7 A;  1N34 E;  2YTP A;  3M99 B;  1FJG E;  1X6E A;  2YTN A;  2YTJ A;  3MSW A;  4J8Z A;  4JI0 E;  2LTR A;  5KL5 A;  2YU8 A;  4DV5 E;  2EL6 A;  4LFA E;  1AAY A;  2EMW A;  5LMU E;  2JY9 A;  3JAM C;  2LV2 A;  2ADR A;  2YTG A;  2EMZ A;  4F2J C;  2WBT A;  1A1L A;  2GPI A;  2ELZ A;  2UUA E;  4M2Z A;  1JK2 A;  1ZBT A;  1PJS A;  2KHX A;  2MC5 A;  1HNZ E;  2VQF E;  2YTE A;  1PJQ A;  1YFH A;  4R2D A;  1A1J A;  2EMF A;  3IWC A;  2UU9 E;  4JI1 E;  2N8X A;  2JYA A;  3JTZ A;  4WXC A;  2DSY A;  2EMY A;  2EM5 A;  2R1F A;  2H36 X;  2I9I A;  2N3H A;  4HTG A;  1MEY C;  2JOB A;  2RSI A;  4M0V A;  3UK3 C;  4DKK A;  5KL6 A;  2E1M A;  2N3G A;  2DIX A;  3THN A;  2CPN A;  1G2D C;  5LL6 R;  1YUJ A;  1ZBQ A;  4WX9 A;  2EPX A;  3J7Y p;  2D9H A;  2M1S A;  4R8O A;  2EPM X;  4DR6 E;  3LLH A;  1XMO E;  2LRS A;  2M9A A;  1RMD A;  1T4N A;  1QU6 A;  1P47 A;  4R2P A;  2EOI A;  4R2S A;  4DUZ E;  4LF7 E;  1J26 A;  4BC7 A;  1B69 A;  1YYK A;  1IMU A;  3VYX A;  4LF6 E;  4GKK E;  4WXD A;  1TF6 A;  1IBL E;  3QG5 C;  5AC4 A;  1PDA A;  3KZY A;  4ZYD A;  3AUZ A;  2LUQ A;  3DF6 A;  1TF3 A;  4KWY A;  4LF4 E;  2DLK A;  3TQM A;  2UXD E;  4NZV A;  2EPZ A;  3ADJ A;  1RC7 A;  2K7I A;  4LTY A;  4WPY A;  2GLI A;  4L8N A;  1X6H A;  5AE3 A;  5CFF E;  2LT7 A;  5DNY A;  4NXN E;  3F6H A;  4WSP A;  1QNT A;  5A69 A;  1UIL A;  3ECR A;  4R2E A;  2R76 A;  2YTD A;  3J81 C;  2EOQ A;  3BGH A;  3MHH C;  3P1X A;  2EN6 A;  5A6K A;  1X6F A;  2ENA A;  2EPL X;  5KL7 A;  2ODR D;  4OOG C;  4L5N C;  2YSO A;  1WXR A;  2B7V A;  2JR1 A;  3T1Y E;  2NA2 A;  2EPN A;  1YSA C;  1YUI A;  3HPS A;  3BID A;  2FTX B;  1T38 A;  2UXC E;  1X3C A;  2HC5 A;  1N32 E;  2EP3 A;  3DJW A;  4YHH E;  4DR5 E;  1PJT A;  1T39 A;  1T4L B;  1DGC A;  4WYQ B;  2EWL A;  4O4K A;  4DMI A;  3AV0 A;  2EJ4 A;  4DV2 E;  1EH6 A;  3C4T A;  2V85 A;  3HQ1 A;  2LVH A;  1X5W A;  3T1H E;  4K0K E;  3EPK A;  2L3C A;  3HTX A;  1YYO A;  4ZYE A;  2B9D A;  2YSP A;  2V89 A;  4WSG A;  2EPC A;  4DV6 E;  4B3S E;  4R2A A;  4F54 A;  2BB8 A;  2EN7 A;  2MDG A;  4DR3 E;  2L33 A;  3OML A;  4R03 A;  4X64 E;  2V83 A;  4OX9 E;  2NUF A;  2YTQ A;  4NHR A;  2MC6 A;  4O43 A;  1T4O A;  4B3M E;  1WRJ A;  2JWO A;  2FGG A;  5T6J A;  2EOY A;  4Q35 B;  2DB2 A;  2EN8 A;  4JI8 E;  4JI2 E;  3IWB A;  1IBK E;  2EOF A;  2E5L E;  1HR0 E;  5A6A A;  1FKA E;  4ZYH A;  3FIG A;  5IT9 C;  1BBO A;  1EKZ A;  1BBG A;  2EPA A;  1GQE A;  2EOO A;  2HGH A;  4I8O A;  2EMK A;  1J5E E;  5LLQ A;  2CT1 A;  4O5G A;  1X49 A;  2EL5 A;  3EPJ A;  5TSE A;  1WJP A;  1WHQ A;  4LFC E;  5KL4 A;  5BR8 E;  2L2K B;  5AE2 A;  2F8B A;  2YTF A;  2WBS A;  1UBD C;  2WCC 3;  2EN1 A;  3C4B A;  2YT4 A;  2NAB A;  2VE7 C;  4F6N A;  5KL3 A;  4LF8 E;  5A6J A;  2VRD A;  2V88 A;  5IWA E;  2EM8 A;  2EOZ A;  5KL2 A;  1L4S A;  4DV0 E;  2LJH A;  1N33 E;  1X48 A;  2ENH A;  3JU0 A;  5AC5 A;  3THO B;  4M9V C;  2EOJ A;  2LCE A;  2YPN A;  4F9A B;  2M4I A;  2I13 A;  3ADI A;  5AE1 A;  4LF5 E;  1O0W A;  2EPR A;  4X66 E;  1X47 A;  4DV7 E;  2RSM A;  2ENC A;  2HHH E;  2ELY A;  4NXM E;  2JXP A;  2EL4 A;  4R2Q A;  5A6B D;  2YRM A;  4BCA A;  5AAS A;  1UN6 B;  2EMA A;  1TN9 A;  4JYA E;  2EMB A;  4LF9 E;  2EPK X;  3BF2 A;  2EML A;  3EQ1 A;  2L3J A;  2M7Q A;  2YU5 A;  2B7T A;  1SR9 A;  1G2F C;  4DR7 E;  4R2R A;  5IXM B;  1SFE A;  2EPP A;  5A2Q C;  3RMP A;  1IQS A;  4JI6 E;  3J80 C;  1ZR9 A;  4DR2 E;  2F4V E;  1KYQ A;  2A25 A;  4X65 E;  4O24 A;  4DV1 E;  2EM2 A;  2RPC A;  4WFT A;  2DMI A;  1N3G A;  2MDR A;  5A6B A;  2LMZ A;  1NCS A;  2YTO A;  4JI5 E;  1BB8 A;  3VK6 A;  1XNR E;  2CTD A;  4F9C B;  1GZ6 A;  1MGT A;  4IS1 C;  2EMC A;  2EN4 A;  1A1F A;  2EOS A;  5ADZ A;  4TUG A;  2JPA A;  3KZZ A;  2DLQ A;  2EOR A;  4KZS A;  4RHB B;  4DR1 E;  3MHS C;  2RQL A;  2YRK A;  4F6M A;  2LTS A;  2LJU A;  2LO3 A;  2NUG A;  4DUY E;  2EMX A;  2K4V A;  3LML A;  3HXL A;  3J7A G;  4DV3 E;  4FK5 C;  1GTK A;  1YYW A;  2B3T B;  1IBM E;  2V8Q B;  2ODR C;  1EH8 A;  3VYY A;  1YZ9 A;  4X62 E;  2EQ0 A;  1HNW E;  2V86 A;  3F6G A;  4LFB E;  2ZM6 E;  1N36 E;  2LBS B;  1A1G A;  4GEQ B;  1ZU1 A;  3VHT B;  1DI2 A;  1IQO A;  2WBU A;  2UUC E;  5IV8 B;  2EE8 A;  1RQ0 A;  2DMY A;  2MKN A;  4Q28 A;  1DQ3 A;  2YZT A;  4IJD A;  1XNQ E;  1UHZ A;  4JI4 E;  2CSH A;  4BMJ A;  1AH5 A;  2EN3 A;  4BHC A;  1A1I A;  2EOE A;  2LE2 A;  3L00 A;  3EPH A;  4P7D A;  1XMQ E;  4B3T E;  4BS9 A;  2NUE A;  2EZ6 A;  2EMG A;  4DR4 E;  1PKP A;  2EOX A;  2EMI A;  2FV4 B;  1YPN A;  4RH8 A;  3K6Q A;  2MKD A;  2GHF A;  5LMN E;  2EOH A;  2JVA A;  2RTX A;  2V87 A;  4JV5 E;  3KWR A;  2WZO A;  4DV4 E;  2EQ3 A;  4GZN C;  2JP9 A;  1STU A;  2UXB E;  1A1H A;  4BBY A;  3HPZ A;  3C6M A;  1ZAA C;  1F2I G;  2EM3 A;  4MLV A;  4R2C A;  2EM7 A;  2G7H A;  2HJJ A;  4MLQ A;  1A1K A;  3BBG A;  4JI7 E;  2JOX A;  4AQY E;  2EOM A;  2EM0 A;  5F3W A;  1WHN A;  2L2N A;  2E72 A;  2PRT A;  4YY3 E; 
#chains in the Genus database with same CATH homology
 2EMC A;  2EN4 A;  1A1F A;  2EOS A;  2EM4 A;  1P47 A;  2JPA A;  2DLQ A;  4R2P A;  2EOR A;  2EOF A;  2EOI A;  4R2S A;  1JK1 A;  1B69 A;  3MHS C;  2YRH A;  2J7J A;  2YRK A;  2YTI A;  4F6M A;  1BBO A;  2EPA A;  2LO3 A;  2EN2 A;  2EMX A;  2EM9 A;  2DGC A;  2EOO A;  1TF6 A;  2HGH A;  1KJK A;  2EMK A;  1LLM C;  2CT1 A;  2EL5 A;  4FK5 C;  3EPJ A;  2EM6 A;  1WJP A;  5KL4 A;  2YTF A;  2WBS A;  1TF3 A;  1UBD C;  2WCC 3;  2DLK A;  2DRP A;  2EN1 A;  3EPL A;  2EPZ A;  2EQ0 A;  2NAB A;  2EPU A;  4F6N A;  2GLI A;  5KL3 A;  1X6H A;  2LT7 A;  2EQ1 A;  2VRD A;  4X9J A;  1A1G A;  2EM8 A;  2EOZ A;  5KL2 A;  1ZU1 A;  4R2E A;  2YTD A;  3VHT B;  2EOQ A;  2WBU A;  1Z1B A;  2ENH A;  4M9V C;  3MHH C;  2EE8 A;  2EN6 A;  2EOJ A;  2LCE A;  1X6F A;  2ENA A;  5KL7 A;  2EMH A;  2MKN A;  2I13 A;  2YSO A;  4IJD A;  2EPR A;  2YTP A;  3M99 B;  2CSH A;  1YSA C;  2EN3 A;  1X6E A;  1A1I A;  2YTN A;  1YUI A;  2EOE A;  2YTJ A;  2ENC A;  2ELY A;  3EPH A;  1X3C A;  5KL5 A;  2YU8 A;  2EP3 A;  2EL4 A;  4R2Q A;  2YRM A;  2EL6 A;  1UN6 B;  2EMA A;  1DGC A;  1AAY A;  1TN9 A;  2EMW A;  2EJ4 A;  2EMB A;  2LV2 A;  2EMG A;  2ADR A;  2YTG A;  2EOX A;  2EMZ A;  2EMI A;  2WBT A;  4F2J C;  2EML A;  1A1L A;  2LVH A;  2ELZ A;  2MKD A;  2YU5 A;  2GHF A;  1X5W A;  2EOH A;  1JK2 A;  1G2F C;  3EPK A;  4R2R A;  2EPP A;  2YSP A;  2YTE A;  4WSG A;  2EPC A;  4R2D A;  2EQ3 A;  4GZN C;  1A1J A;  2EMF A;  2JP9 A;  4R2A A;  1ZR9 A;  2BB8 A;  2A25 A;  1A1H A;  2EM2 A;  2EMY A;  2EM5 A;  2EN7 A;  2MDG A;  2R1F A;  1MEY C;  2RSI A;  2RPC A;  3UK3 C;  1ZAA C;  2DMI A;  5KL6 A;  2YTQ A;  1F2I G;  2EM3 A;  4R2C A;  2EM7 A;  1G2D C;  1A1K A;  1YUJ A;  1NCS A;  2EOM A;  2EPX A;  2YTO A;  2EM0 A;  2EOY A;  2D9H A;  1BB8 A;  2EN8 A;  2CTD A;  2E72 A;  2PRT A;  2M9A A;  1RMD A;  4IS1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...