2BB8A

N-terminal dna binding domain from tn916 integrase, nmr, minimized average structure
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
71
structure length
71
Chain Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Site-specific DNA binding using a variation of the double stranded RNA binding motif.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Dna recombination
molecule keywords INTEGRASE
total genus 6
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 1998-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2bb8A00
2NABA 4R2RA 2EORA 1F2IG 2ENAA 2CT1A 2YRKA 4R2PA 5KL7A 5KL3A 1KJKA 1X3CA 2EM2A 1JK2A 2EN7A 2EMAA 2VRDA 1X5WA 2R1FA 2EN6A 1YUJA 1TF3A 1P47A 2ELZA 2JPAA 2EPCA 2LT7A 2EMWA 2EOIA 2EMGA 2MKDA 2EM4A 2MKNA 4X9JA 2EOXA 2LO3A 2ADRA 2D9HA 3EPLA 2I13A 2EL5A 2EM5A 2WBTA 4R2DA 2EQ0A 1DGCA 1UN6B 2EM7A 2EM3A 3UK3C 4F2JC 2EM8A 2EOZA 5KL5A 1MEYC 1X6HA 1RMDA 1A1GA 2EMFA 2YTIA 5KL2A 2PRTA 2EOJA 2EPPA 4R2QA 1ZAAC 1WJPA 2EQ1A 1UBDC 2YTDA 2EP3A 2EMHA 1TN9A 2YTEA 1A1JA 2EMCA 2HGHA 2YTNA 4R2SA 1G2DC 2EOQA 2EOFA 2MDGA 2EOYA 2DLKA 2EPXA 2EPUA 4M9VC 2YRMA 2EN8A 4GZNC 3EPJA 2YTGA 2WCC3 2EMBA 2RPCA 2YTPA 2EOMA 1X6EA 2EMIA 2YTQA 2EM0A 2E72A 3MHSC 1NCSA 2BB8A 1X6FA 2CTDA 2EMXA 2YU8A 1A1IA 2ENHA 1A1LA 2EN4A 2LV2A 2EMKA 2YTFA 2EMLA 2EOOA 1YSAC 2J7JA 2EQ3A 3EPKA 2YRHA 2A25A 2YSOA 2EL4A 2EPZA 1B69A 3EPHA 4IS1C 2YTOA 1YUIA 3M99B 1G2FC 3VHTB 2YSPA 1JK1A 2DGCA 4R2EA 3MHHC 2ENCA 2M9AA 2EN2A 1Z1BA 1AAYA 2EL6A 2YU5A 2EOSA 1BB8A 1BBOA 2ELYA 2DLQA 2LCEA 4R2AA 2WBSA 2YTJA 2EMZA 2EOEA 2EN1A 2EE8A 1ZU1A 2EMYA 2RSIA 1A1HA 2CSHA 2GLIA 2EPRA 2EPAA 5KL6A 1ZR9A 2EM9A 2GHFA 2EJ4A 4FK5C 1A1FA 4F6MA 2DRPA 4R2CA 4IJDA 1LLMC 2EOHA 2EM6A 1A1KA 2WBUA 2JP9A 4WSGA 2LVHA 2EN3A 4F6NA 5KL4A 1TF6A 2DMIA
chains in the Genus database with same CATH superfamily
2NABA 4F9AB 4R2RA 2EORA 1F2IG 2ENAA 5A6BD 2UXBE 2FGGA 2WZOA 2YRKA 2RS7A 3ADGA 5KL3A 4LFBE 1X3CA 2E5LE 4DR7E 4M0VA 2EN7A 4BCAA 2R1FA 2M1SA 3LMLA 2ELZA 4JI4E 2EPCA 1XMOE 1L4SA 2EM4A 1HNXE 4X9JA 2EOXA 2I13A 3IWCA 2EL5A 2EM5A 2WBTA 1HNWE 2EQ0A 3ECRA 2EM7A 4WYQB 3UK3C 2NUEA 2JYAA 2L2MA 4O24A 1A1GA 2EMFA 5KL2A 2EPPA 4DV3E 4R2QA 3AUZA 2LE2A 1SFEA 2EMHA 1TN9A 4DR2E 1NEIA 2E1MA 1PDAA 4DV0E 5A2QC 2EZ6A 2EOYA 2L3CA 2F8BA 2EN8A 4WSPA 2WCC3 2RPCA 2EOMA 4DV5E 2L2NA 2E72A 3MHSC 1XMQE 4KZSA 4GKKE 1X6FA 5A6BA 2YT4A 2EMXA 2YU8A 1A1IA 1RQ0A 2LV2A 2LUQA 2B7TA 3IWDA 4O5GA 2EQ3A 3EPKA 2DB2A 2YSOA 4HTGA 3H09A 1MGTA 3FIGA 1IQOA 3MHHC 1I94E 2EN2A 2IHR1 1TF6A 4DR5E 1BB8A 4JI3E 4YY3E 2HHHE 4LF4E 2ODRD 4R8OA 1WHQA 2ELYA 2GPIA 5AE1A 1YZ9A 4F54A 4R2AA 4O43A 2L2KB 2F4VE 4Q28A 2EE8A 5F3WA 1ZU1A 2EMYA 1WXRA 4BC7A 5A6AA 5LMUE 2GLIA 2DIXA 3THNA 1ZBTA 1ZR9A 4OOGC 4F6MA 4BMJA 2YWQA 1LLMC 2EOHA 1A1KA 1WHNA 2JP9A 4WSGA 4DMIA 3HPSA 2JVAA 5TSEA 2K7IA 2EN3A 4F6NA 2UUBE 1WRJA 3VK6A 4X8WA 3BGHA 2DMIA 4JV5E 3F6GA 4R2PA 1GTKA 3AV0A 1N3GA 4ZYHA 2EM2A 2UXCE 1JK2A 3K6QA 2EN6A 5CFFE 2M4IA 4WFTA 4JI8E 1TF3A 1IMUA 2EMWA 2EOIA 3ZOQB 1T4NA 2N3HA 3EPLA 2D9HA 3C6MA 2ZM6E 5LMNE 4F2JC 1IBME 1RMDA 4N4RB 2PRTA 3C4BA 5A6KA 2EOJA 3IWBA 1WJPA 1UBDC 2YTDA 1YPNA 2JOBA 2YTEA 1A1JA 2VE7C 1GQEA 2EPKX 4DV6E 4DUYE 2EPXA 3VYYA 2LUPB 1IBLE 2YRMA 4WXCA 4MLQA 4L8NA 5LL6R 5IV8B 2EMBA 2YTPA 4LF6E 4BBYA 1X6EA 2EMIA 4KWYA 4BHBA 4B3ME 4LTYA 2V89A 3HPZA 2BBGA 2L33A 1A1LA 2EN4A 4RHBB 2EOOA 3KZZA 1YSAC 2LJHA 2YRHA 4O4KA 1IBKE 1B69A 3EPHA 3VHTB 2YSPA 2DGCA 3KWRA 1RC7A 3DJWA 4F9BB 2EPLX 2MC5A 1EH8A 2JOXA 1GZ6A 1AAYA 1BBOA 2JR1A 2ODRC 4B3RE 2RSMA 4J8ZA 2JY9A 2WBSA 4DV7E 1N33E 2EMZA 3JTZA 2NUFA 1X49A 4WX9A 4X65E 2KHXA 4FK5C 4DUZE 4Q35B 2VQFE 4B3SE 4GKJE 4JI0E 5DNYA 4R2CA 1T4LB 4LF8E 2EM6A 2EPNA 2M7QA 4F9CB 2L92A 4DR6E 3HXLA 2LTRA 4GEQB 2Q8UA 2RS6A 1HR0E 4LF9E 2KONA 4WPYA 2YPNA 1EH7A 1XNRE 4OX9E 1EKZA 4MLVA 2LBSB 2EMAA 4ZYEA 2YZTA 2FV4B 1X5WA 4P7DA 1YYOA 1YUJA 1PJQA 4M2ZA 1PJTA 5LLQA 3LLHA 2JPAA 1O0WA 2EMGA 2V83A 2V85A 4NZVA 3C6KA 2NUGA 1N36E 3ADJA 2LO3A 2ADRA 4R2DA 4BS9A 1YYKA 4X66E 1SR9A 2EM3A 4HEIA 5KL5A 1X6HA 1PJSA 2YTIA 3KZYA 3HTXA 5T6JA 1ZAAC 1KYQA 2H36X 1X47A 2B9DA 4DKKA 5AE3A 4DV4E 2RTXA 2EMCA 5FLXC 4R2SA 1G2DC 2EOFA 3OTOE 4LF5E 2EPUA 3BF2A 1YYWA 5BR8E 4X64E 5IWAE 3TQMA 3EPJA 3HQ1A 4JI5E 2HC5A 1UHZA 3L00A 1NCSA 4DR4E 4LU9A 3VYXA 2ENHA 2YTFA 2EMLA 2V88A 5AC4A 2J7JA 4WXDA 3BIDA 1PKPA 2DMYA 2V8QB 2EPZA 2VQEE 2N3GA 2YTOA 3M99B 1G2FC 4R2EA 2M9AA 4JI1E 2YU5A 2EOSA 4ZYDA 4K0KE 1AH5A 2DLQA 3J7AG 3T1YE 2EOEA 2LRSA 2EN1A 1FJGE 1T39A 1A1HA 1UILA 1J26A 1T38A 4DR3E 2EPAA 4LFAE 5KL6A 4DR1E 2EJ4A 3QG5C 1A1FA 3T1HE 4JI6E 2DRPA 4DV1E 4ZYGA 2L3JA 3ADIA 3F6HA 2WBUA 2MC6A 3RMPA 2LVHA 4R03A 4TUIA 2I9IA 2V87A 2CT1A 2UU9E 1HNZE 5KL7A 1KJKA 3DF6A 3OMLA 4BHCA 5A6JA 3J80C 2JXPA 2R76A 2VRDA 2UUAE 1DQ3A 4BC9A 1P47A 3J7Yp 4B3TE 2LT7A 1FKAE 2MKDA 2KOUA 2MKNA 1DI2A 1XNQE 1EH6A 1UN6B 4L5NC 1DGCA 3J81C 2L8TA 2K4VA 2EM8A 2EOZA 2EWLA 1MEYC 2L6MA 1QNTA 2EQ1A 2EP3A 5AASA 2LJUA 2UXDE 2LMZA 2HGHA 2YTNA 2EOQA 1ZBQA 2MDGA 2DSYA 5ADZA 2DLKA 4DV2E 4M9VC 2JWOA 4GZNC 2YTGA 4NHRA 2V86A 3JAMC 2YTQA 4X62E 2VF1A 2EM0A 4YHHE 2EPOA 2UUCE 1T4OA 2BB8A 2CTDA 4RH8A 1N34E 3C4TA 5IT9C 2EMKA 4JYAE 2B3TB 2A25A 2HJJA 1STUA 3P1XA 5AE2A 2EL4A 4IS1C 3ADLA 1YUIA 4JI2E 3JU0A 1QU6A 1JK1A 1N32E 3MSWA 2ENCA 4P78A 2N8XA 1Z1BA 2NA2A 2EL6A 1J5EE 4JI7E 4AQYE 4LFCE 2LCEA 2YTJA 2RQLA 4I8OA 2RSIA 1IQSA 2B7VA 1BBGA 2CPNA 4NXME 2CSHA 4LF7E 3BBGA 2EPRA 1YFHA 2EM9A 3EQ1A 2GHFA 5IXMB 4KHPE 2EPMX 2LTSA 4NXNE 2MDRA 3THOB 4IJDA 4TUGA 2G7HA 1X48A 4M30A 5AC5A 5KL4A 5A69A 2FTXB
chains in the Genus database with same CATH topology
2NABA 4R2RA 2EORA 1F2IG 2ENAA 2CT1A 2YRKA 4R2PA 5KL7A 5KL3A 1KJKA 1X3CA 2EM2A 1JK2A 2EN7A 2EMAA 2VRDA 1X5WA 2R1FA 2EN6A 1YUJA 1TF3A 1P47A 2ELZA 2JPAA 2EPCA 2LT7A 2EMWA 2EOIA 2EMGA 2MKDA 2EM4A 2MKNA 4X9JA 2EOXA 2LO3A 2ADRA 2D9HA 3EPLA 2I13A 2EL5A 2EM5A 2WBTA 4R2DA 2EQ0A 1DGCA 1UN6B 2EM7A 2EM3A 3UK3C 4F2JC 2EM8A 2EOZA 5KL5A 1MEYC 1X6HA 1RMDA 1A1GA 2EMFA 2YTIA 5KL2A 2PRTA 2EOJA 2EPPA 4R2QA 1ZAAC 1WJPA 2EQ1A 1UBDC 2YTDA 2EP3A 2EMHA 1TN9A 2YTEA 1A1JA 2EMCA 2HGHA 2YTNA 4R2SA 1G2DC 2EOQA 2EOFA 2MDGA 2EOYA 2DLKA 2EPXA 2EPUA 4M9VC 2YRMA 2EN8A 4GZNC 3EPJA 2YTGA 2WCC3 2EMBA 2RPCA 2YTPA 2EOMA 1X6EA 2EMIA 2YTQA 2EM0A 2E72A 3MHSC 1NCSA 2BB8A 1X6FA 2CTDA 2EMXA 2YU8A 1A1IA 2ENHA 1A1LA 2EN4A 2LV2A 2EMKA 2YTFA 2EMLA 2EOOA 1YSAC 2J7JA 2EQ3A 3EPKA 2YRHA 2A25A 2YSOA 2EL4A 2EPZA 1B69A 3EPHA 4IS1C 2YTOA 1YUIA 3M99B 1G2FC 3VHTB 2YSPA 1JK1A 2DGCA 4R2EA 3MHHC 2ENCA 2M9AA 2EN2A 1Z1BA 1AAYA 2EL6A 2YU5A 2EOSA 1BB8A 1BBOA 2ELYA 2DLQA 2LCEA 4R2AA 2WBSA 2YTJA 2EMZA 2EOEA 2EN1A 2EE8A 1ZU1A 2EMYA 2RSIA 1A1HA 2CSHA 2GLIA 2EPRA 2EPAA 5KL6A 1ZR9A 2EM9A 2GHFA 2EJ4A 4FK5C 1A1FA 4F6MA 2DRPA 4R2CA 4IJDA 1LLMC 2EOHA 2EM6A 1A1KA 2WBUA 2JP9A 4WSGA 2LVHA 2EN3A 4F6NA 5KL4A 1TF6A 2DMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NAB A;  4R2R A;  2EOR A;  1F2I G;  2ENA A;  2CT1 A;  2YRK A;  4R2P A;  5KL7 A;  5KL3 A;  1KJK A;  1X3C A;  2EM2 A;  1JK2 A;  2EN7 A;  2EMA A;  2VRD A;  1X5W A;  2R1F A;  2EN6 A;  1YUJ A;  1TF3 A;  1P47 A;  2ELZ A;  2JPA A;  2EPC A;  2LT7 A;  2EMW A;  2EOI A;  2EMG A;  2MKD A;  2EM4 A;  2MKN A;  4X9J A;  2EOX A;  2LO3 A;  2ADR A;  2D9H A;  3EPL A;  2I13 A;  2EL5 A;  2EM5 A;  2WBT A;  4R2D A;  2EQ0 A;  1DGC A;  1UN6 B;  2EM7 A;  2EM3 A;  3UK3 C;  4F2J C;  2EM8 A;  2EOZ A;  5KL5 A;  1MEY C;  1X6H A;  1RMD A;  1A1G A;  2EMF A;  2YTI A;  5KL2 A;  2PRT A;  2EOJ A;  2EPP A;  4R2Q A;  1ZAA C;  1WJP A;  2EQ1 A;  1UBD C;  2YTD A;  2EP3 A;  2EMH A;  1TN9 A;  2YTE A;  1A1J A;  2EMC A;  2HGH A;  2YTN A;  4R2S A;  1G2D C;  2EOQ A;  2EOF A;  2MDG A;  2EOY A;  2DLK A;  2EPX A;  2EPU A;  4M9V C;  2YRM A;  2EN8 A;  4GZN C;  3EPJ A;  2YTG A;  2WCC 3;  2EMB A;  2RPC A;  2YTP A;  2EOM A;  1X6E A;  2EMI A;  2YTQ A;  2EM0 A;  2E72 A;  3MHS C;  1NCS A;  2BB8 A;  1X6F A;  2CTD A;  2EMX A;  2YU8 A;  1A1I A;  2ENH A;  1A1L A;  2EN4 A;  2LV2 A;  2EMK A;  2YTF A;  2EML A;  2EOO A;  1YSA C;  2J7J A;  2EQ3 A;  3EPK A;  2YRH A;  2A25 A;  2YSO A;  2EL4 A;  2EPZ A;  1B69 A;  3EPH A;  4IS1 C;  2YTO A;  1YUI A;  3M99 B;  1G2F C;  3VHT B;  2YSP A;  1JK1 A;  2DGC A;  4R2E A;  3MHH C;  2ENC A;  2M9A A;  2EN2 A;  1Z1B A;  1AAY A;  2EL6 A;  2YU5 A;  2EOS A;  1BB8 A;  1BBO A;  2ELY A;  2DLQ A;  2LCE A;  4R2A A;  2WBS A;  2YTJ A;  2EMZ A;  2EOE A;  2EN1 A;  2EE8 A;  1ZU1 A;  2EMY A;  2RSI A;  1A1H A;  2CSH A;  2GLI A;  2EPR A;  2EPA A;  5KL6 A;  1ZR9 A;  2EM9 A;  2GHF A;  2EJ4 A;  4FK5 C;  1A1F A;  4F6M A;  2DRP A;  4R2C A;  4IJD A;  1LLM C;  2EOH A;  2EM6 A;  1A1K A;  2WBU A;  2JP9 A;  4WSG A;  2LVH A;  2EN3 A;  4F6N A;  5KL4 A;  1TF6 A;  2DMI A; 
#chains in the Genus database with same CATH topology
 2NAB A;  4F9A B;  4R2R A;  2EOR A;  1F2I G;  2ENA A;  5A6B D;  2UXB E;  2FGG A;  2WZO A;  2YRK A;  2RS7 A;  3ADG A;  5KL3 A;  4LFB E;  1X3C A;  2E5L E;  4DR7 E;  4M0V A;  2EN7 A;  4BCA A;  2R1F A;  2M1S A;  3LML A;  2ELZ A;  4JI4 E;  2EPC A;  1XMO E;  1L4S A;  2EM4 A;  1HNX E;  4X9J A;  2EOX A;  2I13 A;  3IWC A;  2EL5 A;  2EM5 A;  2WBT A;  1HNW E;  2EQ0 A;  3ECR A;  2EM7 A;  4WYQ B;  3UK3 C;  2NUE A;  2JYA A;  2L2M A;  4O24 A;  1A1G A;  2EMF A;  5KL2 A;  2EPP A;  4DV3 E;  4R2Q A;  3AUZ A;  2LE2 A;  1SFE A;  2EMH A;  1TN9 A;  4DR2 E;  1NEI A;  2E1M A;  1PDA A;  4DV0 E;  5A2Q C;  2EZ6 A;  2EOY A;  2L3C A;  2F8B A;  2EN8 A;  4WSP A;  2WCC 3;  2RPC A;  2EOM A;  4DV5 E;  2L2N A;  2E72 A;  3MHS C;  1XMQ E;  4KZS A;  4GKK E;  1X6F A;  5A6B A;  2YT4 A;  2EMX A;  2YU8 A;  1A1I A;  1RQ0 A;  2LV2 A;  2LUQ A;  2B7T A;  3IWD A;  4O5G A;  2EQ3 A;  3EPK A;  2DB2 A;  2YSO A;  4HTG A;  3H09 A;  1MGT A;  3FIG A;  1IQO A;  3MHH C;  1I94 E;  2EN2 A;  2IHR 1;  1TF6 A;  4DR5 E;  1BB8 A;  4JI3 E;  4YY3 E;  2HHH E;  4LF4 E;  2ODR D;  4R8O A;  1WHQ A;  2ELY A;  2GPI A;  5AE1 A;  1YZ9 A;  4F54 A;  4R2A A;  4O43 A;  2L2K B;  2F4V E;  4Q28 A;  2EE8 A;  5F3W A;  1ZU1 A;  2EMY A;  1WXR A;  4BC7 A;  5A6A A;  5LMU E;  2GLI A;  2DIX A;  3THN A;  1ZBT A;  1ZR9 A;  4OOG C;  4F6M A;  4BMJ A;  2YWQ A;  1LLM C;  2EOH A;  1A1K A;  1WHN A;  2JP9 A;  4WSG A;  4DMI A;  3HPS A;  2JVA A;  5TSE A;  2K7I A;  2EN3 A;  4F6N A;  2UUB E;  1WRJ A;  3VK6 A;  4X8W A;  3BGH A;  2DMI A;  4JV5 E;  3F6G A;  4R2P A;  1GTK A;  3AV0 A;  1N3G A;  4ZYH A;  2EM2 A;  2UXC E;  1JK2 A;  3K6Q A;  2EN6 A;  5CFF E;  2M4I A;  4WFT A;  4JI8 E;  1TF3 A;  1IMU A;  2EMW A;  2EOI A;  3ZOQ B;  1T4N A;  2N3H A;  3EPL A;  2D9H A;  3C6M A;  2ZM6 E;  5LMN E;  4F2J C;  1IBM E;  1RMD A;  4N4R B;  2PRT A;  3C4B A;  5A6K A;  2EOJ A;  3IWB A;  1WJP A;  1UBD C;  2YTD A;  1YPN A;  2JOB A;  2YTE A;  1A1J A;  2VE7 C;  1GQE A;  2EPK X;  4DV6 E;  4DUY E;  2EPX A;  3VYY A;  2LUP B;  1IBL E;  2YRM A;  4WXC A;  4MLQ A;  4L8N A;  5LL6 R;  5IV8 B;  2EMB A;  2YTP A;  4LF6 E;  4BBY A;  1X6E A;  2EMI A;  4KWY A;  4BHB A;  4B3M E;  4LTY A;  2V89 A;  3HPZ A;  2BBG A;  2L33 A;  1A1L A;  2EN4 A;  4RHB B;  2EOO A;  3KZZ A;  1YSA C;  2LJH A;  2YRH A;  4O4K A;  1IBK E;  1B69 A;  3EPH A;  3VHT B;  2YSP A;  2DGC A;  3KWR A;  1RC7 A;  3DJW A;  4F9B B;  2EPL X;  2MC5 A;  1EH8 A;  2JOX A;  1GZ6 A;  1AAY A;  1BBO A;  2JR1 A;  2ODR C;  4B3R E;  2RSM A;  4J8Z A;  2JY9 A;  2WBS A;  4DV7 E;  1N33 E;  2EMZ A;  3JTZ A;  2NUF A;  1X49 A;  4WX9 A;  4X65 E;  2KHX A;  4FK5 C;  4DUZ E;  4Q35 B;  2VQF E;  4B3S E;  4GKJ E;  4JI0 E;  5DNY A;  4R2C A;  1T4L B;  4LF8 E;  2EM6 A;  2EPN A;  2M7Q A;  4F9C B;  2L92 A;  4DR6 E;  3HXL A;  2LTR A;  4GEQ B;  2Q8U A;  2RS6 A;  1HR0 E;  4LF9 E;  2KON A;  4WPY A;  2YPN A;  1EH7 A;  1XNR E;  4OX9 E;  1EKZ A;  4MLV A;  2LBS B;  2EMA A;  4ZYE A;  2YZT A;  2FV4 B;  1X5W A;  4P7D A;  1YYO A;  1YUJ A;  1PJQ A;  4M2Z A;  1PJT A;  5LLQ A;  3LLH A;  2JPA A;  1O0W A;  2EMG A;  2V83 A;  2V85 A;  4NZV A;  3C6K A;  2NUG A;  1N36 E;  3ADJ A;  2LO3 A;  2ADR A;  4R2D A;  4BS9 A;  1YYK A;  4X66 E;  1SR9 A;  2EM3 A;  4HEI A;  5KL5 A;  1X6H A;  1PJS A;  2YTI A;  3KZY A;  3HTX A;  5T6J A;  1ZAA C;  1KYQ A;  2H36 X;  1X47 A;  2B9D A;  4DKK A;  5AE3 A;  4DV4 E;  2RTX A;  2EMC A;  5FLX C;  4R2S A;  1G2D C;  2EOF A;  3OTO E;  4LF5 E;  2EPU A;  3BF2 A;  1YYW A;  5BR8 E;  4X64 E;  5IWA E;  3TQM A;  3EPJ A;  3HQ1 A;  4JI5 E;  2HC5 A;  1UHZ A;  3L00 A;  1NCS A;  4DR4 E;  4LU9 A;  3VYX A;  2ENH A;  2YTF A;  2EML A;  2V88 A;  5AC4 A;  2J7J A;  4WXD A;  3BID A;  1PKP A;  2DMY A;  2V8Q B;  2EPZ A;  2VQE E;  2N3G A;  2YTO A;  3M99 B;  1G2F C;  4R2E A;  2M9A A;  4JI1 E;  2YU5 A;  2EOS A;  4ZYD A;  4K0K E;  1AH5 A;  2DLQ A;  3J7A G;  3T1Y E;  2EOE A;  2LRS A;  2EN1 A;  1FJG E;  1T39 A;  1A1H A;  1UIL A;  1J26 A;  1T38 A;  4DR3 E;  2EPA A;  4LFA E;  5KL6 A;  4DR1 E;  2EJ4 A;  3QG5 C;  1A1F A;  3T1H E;  4JI6 E;  2DRP A;  4DV1 E;  4ZYG A;  2L3J A;  3ADI A;  3F6H A;  2WBU A;  2MC6 A;  3RMP A;  2LVH A;  4R03 A;  4TUI A;  2I9I A;  2V87 A;  2CT1 A;  2UU9 E;  1HNZ E;  5KL7 A;  1KJK A;  3DF6 A;  3OML A;  4BHC A;  5A6J A;  3J80 C;  2JXP A;  2R76 A;  2VRD A;  2UUA E;  1DQ3 A;  4BC9 A;  1P47 A;  3J7Y p;  4B3T E;  2LT7 A;  1FKA E;  2MKD A;  2KOU A;  2MKN A;  1DI2 A;  1XNQ E;  1EH6 A;  1UN6 B;  4L5N C;  1DGC A;  3J81 C;  2L8T A;  2K4V A;  2EM8 A;  2EOZ A;  2EWL A;  1MEY C;  2L6M A;  1QNT A;  2EQ1 A;  2EP3 A;  5AAS A;  2LJU A;  2UXD E;  2LMZ A;  2HGH A;  2YTN A;  2EOQ A;  1ZBQ A;  2MDG A;  2DSY A;  5ADZ A;  2DLK A;  4DV2 E;  4M9V C;  2JWO A;  4GZN C;  2YTG A;  4NHR A;  2V86 A;  3JAM C;  2YTQ A;  4X62 E;  2VF1 A;  2EM0 A;  4YHH E;  2EPO A;  2UUC E;  1T4O A;  2BB8 A;  2CTD A;  4RH8 A;  1N34 E;  3C4T A;  5IT9 C;  2EMK A;  4JYA E;  2B3T B;  2A25 A;  2HJJ A;  1STU A;  3P1X A;  5AE2 A;  2EL4 A;  4IS1 C;  3ADL A;  1YUI A;  4JI2 E;  3JU0 A;  1QU6 A;  1JK1 A;  1N32 E;  3MSW A;  2ENC A;  4P78 A;  2N8X A;  1Z1B A;  2NA2 A;  2EL6 A;  1J5E E;  4JI7 E;  4AQY E;  4LFC E;  2LCE A;  2YTJ A;  2RQL A;  4I8O A;  2RSI A;  1IQS A;  2B7V A;  1BBG A;  2CPN A;  4NXM E;  2CSH A;  4LF7 E;  3BBG A;  2EPR A;  1YFH A;  2EM9 A;  3EQ1 A;  2GHF A;  5IXM B;  4KHP E;  2EPM X;  2LTS A;  4NXN E;  2MDR A;  3THO B;  4IJD A;  4TUG A;  2G7H A;  1X48 A;  4M30 A;  5AC5 A;  5KL4 A;  5A69 A;  2FTX B; 
#chains in the Genus database with same CATH homology
 2NAB A;  4R2R A;  2EOR A;  1F2I G;  2ENA A;  2CT1 A;  2YRK A;  4R2P A;  5KL7 A;  5KL3 A;  1KJK A;  1X3C A;  2EM2 A;  1JK2 A;  2EN7 A;  2EMA A;  2VRD A;  1X5W A;  2R1F A;  2EN6 A;  1YUJ A;  1TF3 A;  1P47 A;  2ELZ A;  2JPA A;  2EPC A;  2LT7 A;  2EMW A;  2EOI A;  2EMG A;  2MKD A;  2EM4 A;  2MKN A;  4X9J A;  2EOX A;  2LO3 A;  2ADR A;  2D9H A;  3EPL A;  2I13 A;  2EL5 A;  2EM5 A;  2WBT A;  4R2D A;  2EQ0 A;  1DGC A;  1UN6 B;  2EM7 A;  2EM3 A;  3UK3 C;  4F2J C;  2EM8 A;  2EOZ A;  5KL5 A;  1MEY C;  1X6H A;  1RMD A;  1A1G A;  2EMF A;  2YTI A;  5KL2 A;  2PRT A;  2EOJ A;  2EPP A;  4R2Q A;  1ZAA C;  1WJP A;  2EQ1 A;  1UBD C;  2YTD A;  2EP3 A;  2EMH A;  1TN9 A;  2YTE A;  1A1J A;  2EMC A;  2HGH A;  2YTN A;  4R2S A;  1G2D C;  2EOQ A;  2EOF A;  2MDG A;  2EOY A;  2DLK A;  2EPX A;  2EPU A;  4M9V C;  2YRM A;  2EN8 A;  4GZN C;  3EPJ A;  2YTG A;  2WCC 3;  2EMB A;  2RPC A;  2YTP A;  2EOM A;  1X6E A;  2EMI A;  2YTQ A;  2EM0 A;  2E72 A;  3MHS C;  1NCS A;  2BB8 A;  1X6F A;  2CTD A;  2EMX A;  2YU8 A;  1A1I A;  2ENH A;  1A1L A;  2EN4 A;  2LV2 A;  2EMK A;  2YTF A;  2EML A;  2EOO A;  1YSA C;  2J7J A;  2EQ3 A;  3EPK A;  2YRH A;  2A25 A;  2YSO A;  2EL4 A;  2EPZ A;  1B69 A;  3EPH A;  4IS1 C;  2YTO A;  1YUI A;  3M99 B;  1G2F C;  3VHT B;  2YSP A;  1JK1 A;  2DGC A;  4R2E A;  3MHH C;  2ENC A;  2M9A A;  2EN2 A;  1Z1B A;  1AAY A;  2EL6 A;  2YU5 A;  2EOS A;  1BB8 A;  1BBO A;  2ELY A;  2DLQ A;  2LCE A;  4R2A A;  2WBS A;  2YTJ A;  2EMZ A;  2EOE A;  2EN1 A;  2EE8 A;  1ZU1 A;  2EMY A;  2RSI A;  1A1H A;  2CSH A;  2GLI A;  2EPR A;  2EPA A;  5KL6 A;  1ZR9 A;  2EM9 A;  2GHF A;  2EJ4 A;  4FK5 C;  1A1F A;  4F6M A;  2DRP A;  4R2C A;  4IJD A;  1LLM C;  2EOH A;  2EM6 A;  1A1K A;  2WBU A;  2JP9 A;  4WSG A;  2LVH A;  2EN3 A;  4F6N A;  5KL4 A;  1TF6 A;  2DMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...