2BB8A

N-terminal dna binding domain from tn916 integrase, nmr, minimized average structure
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
71
structure length
71
Chain Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Site-specific DNA binding using a variation of the double stranded RNA binding motif.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Dna recombination
total genus 6
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 1998-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2bb8A00
1A1GA 2EM5A 2EMGA 2EP3A 2PRTA 2GLIA 1X6HA 2EL5A 4M9VC 2YTFA 2EPZA 2EPCA 2ENAA 2EPXA 1X6FA 2EM4A 2EMCA 3MHSC 1KJKA 2EN8A 2YSPA 2DMIA 2ELZA 2EOFA 2YTPA 3EPJA 2R1FA 4R2QA 2EN7A 2MKDA 1ZU1A 2YU8A 2EMIA 1TF6A 4R2DA 1A1KA 2EOXA 1YSAC 2EE8A 2LCEA 3VHTB 1BBOA 1WJPA 2NABA 4F2JC 2EN3A 2BB8A 2ELYA 1A1LA 2ADRA 2I13A 5KL3A 3UK3C 2LT7A 1DGCA 2EL6A 2EL4A 1B69A 1ZAAC 2YRKA 1G2DC 2JP9A 1JK1A 2EQ0A 2WBUA 1RMDA 2YTOA 2WCC3 4R2PA 2DRPA 2EM6A 4WSGA 2EM3A 4F6MA 2EOJA 2EN1A 2YTJA 1UN6B 1LLMC 2GHFA 1P47A 1YUJA 1G2FC 1X6EA 4R2SA 2EPAA 2YTNA 1JK2A 2LO3A 2RSIA 4X9JA 2YSOA 2EM0A 2CT1A 1MEYC 4IS1C 1BB8A 2DLQA 2MKNA 1NCSA 2EPPA 2A25A 1UBDC 2EMKA 2EOZA 2YU5A 2EQ3A 2YRMA 4IJDA 1ZR9A 1Z1BA 2LVHA 2EMYA 4R2EA 1F2IG 2EMAA 4R2AA 2EOQA 1AAYA 2CSHA 2EJ4A 2EOSA 3M99B 1YUIA 2EM8A 3MHHC 2EMFA 2MDGA 2CTDA 2LV2A 2HGHA 2EMXA 1X5WA 2EOIA 2YTGA 2DLKA 2RPCA 2DGCA 2ENCA 3EPLA 4F6NA 1TF3A 2EQ1A 5KL2A 2EORA 2EN6A 4GZNC 2J7JA 5KL4A 2VRDA 5KL6A 2EN2A 2M9AA 2EOEA 2ENHA 2YRHA 1TN9A 2EMZA 1A1JA 2EPRA 1X3CA 2EOOA 2WBTA 2EM7A 4FK5C 2EPUA 1A1HA 4R2RA 1A1IA 2EMLA 2EOYA 2JPAA 2YTDA 2YTQA 2EOMA 2EMWA 5KL5A 3EPHA 2YTIA 5KL7A 1A1FA 2D9HA 2YTEA 2EOHA 2EN4A 3EPKA 2EM9A 2EMBA 2WBSA 4R2CA 2EM2A 2EMHA 2E72A
chains in the Genus database with same CATH superfamily
2EP3A 2UUAE 2VQEE 2EPCA 1WXRA 4J8ZA 1L4SA 2Q8UA 4ZYGA 4ZYEA 2ZM6E 1HNXE 2LUQA 4JV5E 2EMIA 1YSAC 4R2DA 2EOXA 3VHTB 1BBOA 1SR9A 3J80C 4LF9E 2BB8A 2ELYA 5LMUE 5KL3A 3UK3C 4DV4E 3JU0A 4BC9A 4HEIA 1DGCA 2JOBA 4HTGA 1EH6A 2V8QB 2L2KB 1B69A 4M0VA 1N32E 4R03A 2EPOA 2WBUA 1RMDA 1NEIA 5TSEA 4P78A 4WSGA 1O0WA 2UUCE 4DR5E 2EOJA 2EN1A 1XNQE 4JYAE 2GHFA 1P47A 2YZTA 1YYOA 1X6EA 4KHPE 2LO3A 3DF6A 3HTXA 4BCAA 2JVAA 1PKPA 3ADJA 3EQ1A 1N33E 2DLQA 1KYQA 2EMKA 1T39A 2EOZA 4R8OA 4BHCA 2YU5A 1MGTA 1XMQE 2M4IA 2EPNA 3F6HA 2L33A 2VF1A 4BBYA 2EMAA 4R2AA 2WZOA 1AAYA 2EJ4A 2EOSA 3IWDA 2ODRC 2NA2A 3P1XA 2EPKX 2UU9E 4LF4E 3MHHC 1X49A 3KWRA 1T38A 4WYQB 2MDGA 2LE2A 2L3CA 4JI0E 2HHHE 1X5WA 2YTGA 4BC7A 2DLKA 2VQFE 1SFEA 2RPCA 2R76A 2V86A 3JAMC 3LMLA 4B3TE 1YPNA 5KL2A 5AASA 2H36X 2J7JA 4DV5E 2DSYA 4ZYHA 2VRDA 1HNWE 2IHR1 2EOEA 2LJUA 1N36E 4GKJE 2ENHA 2YRHA 2UXDE 4DR6E 1A1JA 1J26A 2EOOA 4DV3E 3JTZA 2B7VA 1EH7A 2YTDA 2EOMA 4DUYE 4YHHE 1AH5A 1A1FA 3THOB 4JI2E 2EOHA 4BHBA 2RQLA 4M30A 2EM9A 2RS6A 2F8BA 3OMLA 2WBSA 4R2CA 4LFCE 1YUJA 2EWLA 2PRTA 1X6HA 2EPXA 2EM4A 2EMCA 4WPYA 3J7Yp 5A6JA 2E1MA 4KZSA 4X64E 2EZ6A 1KJKA 2ELZA 1IQSA 4JI1E 3EPJA 1DQ3A 2V88A 2L6MA 3BIDA 2FTXB 5BR8E 1WHNA 3HPSA 3C6MA 2EE8A 3ECRA 1HNZE 4LTYA 4NHRA 5IXMB 4B3RE 2ADRA 2I13A 2LMZA 2LT7A 4OX9E 2JP9A 2NUEA 2MDRA 2L92A 2EQ0A 2E5LE 2WCC3 2V87A 2EM6A 5LL6R 2YTJA 1UN6B 3BGHA 2EPAA 1JK2A 2EPMX 4F54A 1QNTA 4P7DA 2LRSA 4F9BB 4X9JA 2DMYA 1T4OA 5AC5A 3KZZA 2MKNA 4LU9A 2A25A 1IBKE 2YWQA 1Z1BA 2LVHA 3QG5C 4BS9A 5A6BD 4R2EA 4F9CB 1EH8A 1QU6A 2EOQA 4B3SE 2LTRA 3M99B 2KHXA 3IWBA 4DR3E 4I8OA 2RSMA 1X47A 3F6GA 4RH8A 4RHBB 4WXDA 3J7AG 2ENCA 4F6NA 3C6KA 4O24A 2HC5A 1TF3A 2EQ1A 4KWYA 3TQMA 2JXPA 2EORA 4DUZE 5A6AA 2UUBE 4DR4E 5KL4A 5KL6A 2M9AA 4Q35B 1IMUA 3IWCA 1TN9A 1PJQA 2B9DA 2EPUA 1RC7A 2EMLA 2EOYA 2NUGA 5LLQA 3VYXA 3BF2A 2JPAA 2YTQA 2EMWA 5AE3A 4DV0E 5KL5A 2YTIA 4F9AB 4GKKE 4NXME 2DB2A 1XMOE 2L2MA 3EPKA 2EMBA 2EM2A 5AC4A 1GTKA 5A2QC 2G7HA 2EMGA 1A1GA 2EL5A 1N3GA 2KOUA 2YTFA 2EPZA 4M9VC 2ENAA 3MHSC 1X6FA 3L00A 2EN8A 2FGGA 2YT4A 2DMIA 2YTPA 3K6QA 2R1FA 4MLQA 2F4VE 2EN7A 4ZYDA 1ZU1A 2FV4B 2LCEA 1BBGA 2NABA 2RTXA 4F2JC 4DR1E 3HQ1A 2M7QA 4Q28A 5ADZA 5F3WA 2JOXA 2JR1A 4LF7E 1I94E 1UILA 2EL4A 1ZAAC 1G2DC 3MSWA 2YTOA 2V85A 2DRPA 2EM3A 4F6MA 3VYYA 4GEQB 1RQ0A 4JI5E 5AE1A 4DV2E 3RMPA 2K4VA 1PJSA 2RSIA 2YSOA 2B7TA 2EM0A 3C4BA 2CT1A 1YFHA 4IS1C 2DIXA 4JI4E 2LUPB 1UBDC 4TUGA 2YRMA 5A6KA 4IJDA 1ZR9A 4O4KA 2KONA 2EMYA 5LMNE 4DV6E 2CSHA 4WX9A 4JI3E 2CTDA 1WRJA 4JI7E 2EMXA 3EPLA 2N3GA 2I9IA 4LF8E 5IV8B 3DJWA 4YY3E 1ZBQA 4GZNC 2JY9A 3KZYA 4LFBE 2V83A 3THNA 2EN2A 2L2NA 2MC6A 3T1YE 4L8NA 3AUZA 1PDAA 1UHZA 2L3JA 2EPRA 1X3CA 1DI2A 1IBLE 2UXCE 4R2RA 1IQOA 4MLVA 4X66E 3FIGA 2B3TB 2D9HA 4DKKA 5DNYA 2EN4A 4WSPA 3HXLA 4R2SA 1HR0E 2E72A 3BBGA 1GZ6A 2EM5A 2GLIA 2YSPA 3ADIA 1FJGE 2EOFA 5IT9C 4R2QA 2MKDA 4DR7E 5IWAE 2MC5A 2YU8A 5AE2A 5FLXC 4DR2E 1TF6A 1A1KA 1FKAE 5A69A 1WJPA 2EN3A 4DMIA 4JI8E 1T4LB 1A1LA 2UXBE 2N3HA 4X62E 3ADLA 2EL6A 4O43A 2N8XA 1X48A 2EPLX 2YRKA 3J81C 1JK1A 3ADGA 2ODRD 4R2PA 1J5EE 4WXCA 1LLMC 4WFTA 3OTOE 4DV1E 1STUA 4NZVA 1G2FC 2YTNA 2LTSA 2VE7C 4LFAE 2RS7A 4LF5E 1YZ9A 1MEYC 2NUFA 1BB8A 3VK6A 4O5GA 2GPIA 1NCSA 2EPPA 2V89A 4NXNE 2BBGA 1N34E 2EQ3A 3ZOQB 4X8WA 5T6JA 2JWOA 2LBSB 1ZBTA 1F2IG 4M2ZA 4LF6E 4DV7E 4TUIA 5CFFE 5A6BA 3HPZA 4X65E 1YUIA 2LJHA 1GQEA 2EM8A 2EMFA 1WHQA 2LV2A 2HGHA 2EOIA 2DGCA 1EKZA 1IBME 4OOGC 2JYAA 4AQYE 3LLHA 3H09A 2EN6A 1PJTA 4JI6E 3C4TA 4N4RB 2EMZA 1YYKA 2M1SA 4L5NC 2WBTA 2EM7A 4FK5C 1A1HA 1A1IA 4B3ME 3AV0A 2K7IA 4BMJA 4K0KE 3EPHA 1YYWA 5KL7A 2HJJA 2YPNA 3T1HE 2YTEA 2CPNA 1T4NA 1XNRE 2L8TA 2EMHA
chains in the Genus database with same CATH topology
1A1GA 2EM5A 2EMGA 2EP3A 2PRTA 2GLIA 1X6HA 2EL5A 4M9VC 2YTFA 2EPZA 2EPCA 2ENAA 2EPXA 1X6FA 2EM4A 2EMCA 3MHSC 1KJKA 2EN8A 2YSPA 2DMIA 2ELZA 2EOFA 2YTPA 3EPJA 2R1FA 4R2QA 2EN7A 2MKDA 1ZU1A 2YU8A 2EMIA 1TF6A 4R2DA 1A1KA 2EOXA 1YSAC 2EE8A 2LCEA 3VHTB 1BBOA 1WJPA 2NABA 4F2JC 2EN3A 2BB8A 2ELYA 1A1LA 2ADRA 2I13A 5KL3A 3UK3C 2LT7A 1DGCA 2EL6A 2EL4A 1B69A 1ZAAC 2YRKA 1G2DC 2JP9A 1JK1A 2EQ0A 2WBUA 1RMDA 2YTOA 2WCC3 4R2PA 2DRPA 2EM6A 4WSGA 2EM3A 4F6MA 2EOJA 2EN1A 2YTJA 1UN6B 1LLMC 2GHFA 1P47A 1YUJA 1G2FC 1X6EA 4R2SA 2EPAA 2YTNA 1JK2A 2LO3A 2RSIA 4X9JA 2YSOA 2EM0A 2CT1A 1MEYC 4IS1C 1BB8A 2DLQA 2MKNA 1NCSA 2EPPA 2A25A 1UBDC 2EMKA 2EOZA 2YU5A 2EQ3A 2YRMA 4IJDA 1ZR9A 1Z1BA 2LVHA 2EMYA 4R2EA 1F2IG 2EMAA 4R2AA 2EOQA 1AAYA 2CSHA 2EJ4A 2EOSA 3M99B 1YUIA 2EM8A 3MHHC 2EMFA 2MDGA 2CTDA 2LV2A 2HGHA 2EMXA 1X5WA 2EOIA 2YTGA 2DLKA 2RPCA 2DGCA 2ENCA 3EPLA 4F6NA 1TF3A 2EQ1A 5KL2A 2EORA 2EN6A 4GZNC 2J7JA 5KL4A 2VRDA 5KL6A 2EN2A 2M9AA 2EOEA 2ENHA 2YRHA 1TN9A 2EMZA 1A1JA 2EPRA 1X3CA 2EOOA 2WBTA 2EM7A 4FK5C 2EPUA 1A1HA 4R2RA 1A1IA 2EMLA 2EOYA 2JPAA 2YTDA 2YTQA 2EOMA 2EMWA 5KL5A 3EPHA 2YTIA 5KL7A 1A1FA 2D9HA 2YTEA 2EOHA 2EN4A 3EPKA 2EM9A 2EMBA 2WBSA 4R2CA 2EM2A 2EMHA 2E72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A1G A;  2EM5 A;  2EMG A;  2EP3 A;  2PRT A;  2GLI A;  1X6H A;  2EL5 A;  4M9V C;  2YTF A;  2EPZ A;  2EPC A;  2ENA A;  2EPX A;  1X6F A;  2EM4 A;  2EMC A;  3MHS C;  1KJK A;  2EN8 A;  2YSP A;  2DMI A;  2ELZ A;  2EOF A;  2YTP A;  3EPJ A;  2R1F A;  4R2Q A;  2EN7 A;  2MKD A;  1ZU1 A;  2YU8 A;  2EMI A;  1TF6 A;  4R2D A;  1A1K A;  2EOX A;  1YSA C;  2EE8 A;  2LCE A;  3VHT B;  1BBO A;  1WJP A;  2NAB A;  4F2J C;  2EN3 A;  2BB8 A;  2ELY A;  1A1L A;  2ADR A;  2I13 A;  5KL3 A;  3UK3 C;  2LT7 A;  1DGC A;  2EL6 A;  2EL4 A;  1B69 A;  1ZAA C;  2YRK A;  1G2D C;  2JP9 A;  1JK1 A;  2EQ0 A;  2WBU A;  1RMD A;  2YTO A;  2WCC 3;  4R2P A;  2DRP A;  2EM6 A;  4WSG A;  2EM3 A;  4F6M A;  2EOJ A;  2EN1 A;  2YTJ A;  1UN6 B;  1LLM C;  2GHF A;  1P47 A;  1YUJ A;  1G2F C;  1X6E A;  4R2S A;  2EPA A;  2YTN A;  1JK2 A;  2LO3 A;  2RSI A;  4X9J A;  2YSO A;  2EM0 A;  2CT1 A;  1MEY C;  4IS1 C;  1BB8 A;  2DLQ A;  2MKN A;  1NCS A;  2EPP A;  2A25 A;  1UBD C;  2EMK A;  2EOZ A;  2YU5 A;  2EQ3 A;  2YRM A;  4IJD A;  1ZR9 A;  1Z1B A;  2LVH A;  2EMY A;  4R2E A;  1F2I G;  2EMA A;  4R2A A;  2EOQ A;  1AAY A;  2CSH A;  2EJ4 A;  2EOS A;  3M99 B;  1YUI A;  2EM8 A;  3MHH C;  2EMF A;  2MDG A;  2CTD A;  2LV2 A;  2HGH A;  2EMX A;  1X5W A;  2EOI A;  2YTG A;  2DLK A;  2RPC A;  2DGC A;  2ENC A;  3EPL A;  4F6N A;  1TF3 A;  2EQ1 A;  5KL2 A;  2EOR A;  2EN6 A;  4GZN C;  2J7J A;  5KL4 A;  2VRD A;  5KL6 A;  2EN2 A;  2M9A A;  2EOE A;  2ENH A;  2YRH A;  1TN9 A;  2EMZ A;  1A1J A;  2EPR A;  1X3C A;  2EOO A;  2WBT A;  2EM7 A;  4FK5 C;  2EPU A;  1A1H A;  4R2R A;  1A1I A;  2EML A;  2EOY A;  2JPA A;  2YTD A;  2YTQ A;  2EOM A;  2EMW A;  5KL5 A;  3EPH A;  2YTI A;  5KL7 A;  1A1F A;  2D9H A;  2YTE A;  2EOH A;  2EN4 A;  3EPK A;  2EM9 A;  2EMB A;  2WBS A;  4R2C A;  2EM2 A;  2EMH A;  2E72 A; 
#chains in the Genus database with same CATH topology
 2EP3 A;  2UUA E;  2VQE E;  2EPC A;  1WXR A;  4J8Z A;  1L4S A;  2Q8U A;  4ZYG A;  4ZYE A;  2ZM6 E;  1HNX E;  2LUQ A;  4JV5 E;  2EMI A;  1YSA C;  4R2D A;  2EOX A;  3VHT B;  1BBO A;  1SR9 A;  3J80 C;  4LF9 E;  2BB8 A;  2ELY A;  5LMU E;  5KL3 A;  3UK3 C;  4DV4 E;  3JU0 A;  4BC9 A;  4HEI A;  1DGC A;  2JOB A;  4HTG A;  1EH6 A;  2V8Q B;  2L2K B;  1B69 A;  4M0V A;  1N32 E;  4R03 A;  2EPO A;  2WBU A;  1RMD A;  1NEI A;  5TSE A;  4P78 A;  4WSG A;  1O0W A;  2UUC E;  4DR5 E;  2EOJ A;  2EN1 A;  1XNQ E;  4JYA E;  2GHF A;  1P47 A;  2YZT A;  1YYO A;  1X6E A;  4KHP E;  2LO3 A;  3DF6 A;  3HTX A;  4BCA A;  2JVA A;  1PKP A;  3ADJ A;  3EQ1 A;  1N33 E;  2DLQ A;  1KYQ A;  2EMK A;  1T39 A;  2EOZ A;  4R8O A;  4BHC A;  2YU5 A;  1MGT A;  1XMQ E;  2M4I A;  2EPN A;  3F6H A;  2L33 A;  2VF1 A;  4BBY A;  2EMA A;  4R2A A;  2WZO A;  1AAY A;  2EJ4 A;  2EOS A;  3IWD A;  2ODR C;  2NA2 A;  3P1X A;  2EPK X;  2UU9 E;  4LF4 E;  3MHH C;  1X49 A;  3KWR A;  1T38 A;  4WYQ B;  2MDG A;  2LE2 A;  2L3C A;  4JI0 E;  2HHH E;  1X5W A;  2YTG A;  4BC7 A;  2DLK A;  2VQF E;  1SFE A;  2RPC A;  2R76 A;  2V86 A;  3JAM C;  3LML A;  4B3T E;  1YPN A;  5KL2 A;  5AAS A;  2H36 X;  2J7J A;  4DV5 E;  2DSY A;  4ZYH A;  2VRD A;  1HNW E;  2IHR 1;  2EOE A;  2LJU A;  1N36 E;  4GKJ E;  2ENH A;  2YRH A;  2UXD E;  4DR6 E;  1A1J A;  1J26 A;  2EOO A;  4DV3 E;  3JTZ A;  2B7V A;  1EH7 A;  2YTD A;  2EOM A;  4DUY E;  4YHH E;  1AH5 A;  1A1F A;  3THO B;  4JI2 E;  2EOH A;  4BHB A;  2RQL A;  4M30 A;  2EM9 A;  2RS6 A;  2F8B A;  3OML A;  2WBS A;  4R2C A;  4LFC E;  1YUJ A;  2EWL A;  2PRT A;  1X6H A;  2EPX A;  2EM4 A;  2EMC A;  4WPY A;  3J7Y p;  5A6J A;  2E1M A;  4KZS A;  4X64 E;  2EZ6 A;  1KJK A;  2ELZ A;  1IQS A;  4JI1 E;  3EPJ A;  1DQ3 A;  2V88 A;  2L6M A;  3BID A;  2FTX B;  5BR8 E;  1WHN A;  3HPS A;  3C6M A;  2EE8 A;  3ECR A;  1HNZ E;  4LTY A;  4NHR A;  5IXM B;  4B3R E;  2ADR A;  2I13 A;  2LMZ A;  2LT7 A;  4OX9 E;  2JP9 A;  2NUE A;  2MDR A;  2L92 A;  2EQ0 A;  2E5L E;  2WCC 3;  2V87 A;  2EM6 A;  5LL6 R;  2YTJ A;  1UN6 B;  3BGH A;  2EPA A;  1JK2 A;  2EPM X;  4F54 A;  1QNT A;  4P7D A;  2LRS A;  4F9B B;  4X9J A;  2DMY A;  1T4O A;  5AC5 A;  3KZZ A;  2MKN A;  4LU9 A;  2A25 A;  1IBK E;  2YWQ A;  1Z1B A;  2LVH A;  3QG5 C;  4BS9 A;  5A6B D;  4R2E A;  4F9C B;  1EH8 A;  1QU6 A;  2EOQ A;  4B3S E;  2LTR A;  3M99 B;  2KHX A;  3IWB A;  4DR3 E;  4I8O A;  2RSM A;  1X47 A;  3F6G A;  4RH8 A;  4RHB B;  4WXD A;  3J7A G;  2ENC A;  4F6N A;  3C6K A;  4O24 A;  2HC5 A;  1TF3 A;  2EQ1 A;  4KWY A;  3TQM A;  2JXP A;  2EOR A;  4DUZ E;  5A6A A;  2UUB E;  4DR4 E;  5KL4 A;  5KL6 A;  2M9A A;  4Q35 B;  1IMU A;  3IWC A;  1TN9 A;  1PJQ A;  2B9D A;  2EPU A;  1RC7 A;  2EML A;  2EOY A;  2NUG A;  5LLQ A;  3VYX A;  3BF2 A;  2JPA A;  2YTQ A;  2EMW A;  5AE3 A;  4DV0 E;  5KL5 A;  2YTI A;  4F9A B;  4GKK E;  4NXM E;  2DB2 A;  1XMO E;  2L2M A;  3EPK A;  2EMB A;  2EM2 A;  5AC4 A;  1GTK A;  5A2Q C;  2G7H A;  2EMG A;  1A1G A;  2EL5 A;  1N3G A;  2KOU A;  2YTF A;  2EPZ A;  4M9V C;  2ENA A;  3MHS C;  1X6F A;  3L00 A;  2EN8 A;  2FGG A;  2YT4 A;  2DMI A;  2YTP A;  3K6Q A;  2R1F A;  4MLQ A;  2F4V E;  2EN7 A;  4ZYD A;  1ZU1 A;  2FV4 B;  2LCE A;  1BBG A;  2NAB A;  2RTX A;  4F2J C;  4DR1 E;  3HQ1 A;  2M7Q A;  4Q28 A;  5ADZ A;  5F3W A;  2JOX A;  2JR1 A;  4LF7 E;  1I94 E;  1UIL A;  2EL4 A;  1ZAA C;  1G2D C;  3MSW A;  2YTO A;  2V85 A;  2DRP A;  2EM3 A;  4F6M A;  3VYY A;  4GEQ B;  1RQ0 A;  4JI5 E;  5AE1 A;  4DV2 E;  3RMP A;  2K4V A;  1PJS A;  2RSI A;  2YSO A;  2B7T A;  2EM0 A;  3C4B A;  2CT1 A;  1YFH A;  4IS1 C;  2DIX A;  4JI4 E;  2LUP B;  1UBD C;  4TUG A;  2YRM A;  5A6K A;  4IJD A;  1ZR9 A;  4O4K A;  2KON A;  2EMY A;  5LMN E;  4DV6 E;  2CSH A;  4WX9 A;  4JI3 E;  2CTD A;  1WRJ A;  4JI7 E;  2EMX A;  3EPL A;  2N3G A;  2I9I A;  4LF8 E;  5IV8 B;  3DJW A;  4YY3 E;  1ZBQ A;  4GZN C;  2JY9 A;  3KZY A;  4LFB E;  2V83 A;  3THN A;  2EN2 A;  2L2N A;  2MC6 A;  3T1Y E;  4L8N A;  3AUZ A;  1PDA A;  1UHZ A;  2L3J A;  2EPR A;  1X3C A;  1DI2 A;  1IBL E;  2UXC E;  4R2R A;  1IQO A;  4MLV A;  4X66 E;  3FIG A;  2B3T B;  2D9H A;  4DKK A;  5DNY A;  2EN4 A;  4WSP A;  3HXL A;  4R2S A;  1HR0 E;  2E72 A;  3BBG A;  1GZ6 A;  2EM5 A;  2GLI A;  2YSP A;  3ADI A;  1FJG E;  2EOF A;  5IT9 C;  4R2Q A;  2MKD A;  4DR7 E;  5IWA E;  2MC5 A;  2YU8 A;  5AE2 A;  5FLX C;  4DR2 E;  1TF6 A;  1A1K A;  1FKA E;  5A69 A;  1WJP A;  2EN3 A;  4DMI A;  4JI8 E;  1T4L B;  1A1L A;  2UXB E;  2N3H A;  4X62 E;  3ADL A;  2EL6 A;  4O43 A;  2N8X A;  1X48 A;  2EPL X;  2YRK A;  3J81 C;  1JK1 A;  3ADG A;  2ODR D;  4R2P A;  1J5E E;  4WXC A;  1LLM C;  4WFT A;  3OTO E;  4DV1 E;  1STU A;  4NZV A;  1G2F C;  2YTN A;  2LTS A;  2VE7 C;  4LFA E;  2RS7 A;  4LF5 E;  1YZ9 A;  1MEY C;  2NUF A;  1BB8 A;  3VK6 A;  4O5G A;  2GPI A;  1NCS A;  2EPP A;  2V89 A;  4NXN E;  2BBG A;  1N34 E;  2EQ3 A;  3ZOQ B;  4X8W A;  5T6J A;  2JWO A;  2LBS B;  1ZBT A;  1F2I G;  4M2Z A;  4LF6 E;  4DV7 E;  4TUI A;  5CFF E;  5A6B A;  3HPZ A;  4X65 E;  1YUI A;  2LJH A;  1GQE A;  2EM8 A;  2EMF A;  1WHQ A;  2LV2 A;  2HGH A;  2EOI A;  2DGC A;  1EKZ A;  1IBM E;  4OOG C;  2JYA A;  4AQY E;  3LLH A;  3H09 A;  2EN6 A;  1PJT A;  4JI6 E;  3C4T A;  4N4R B;  2EMZ A;  1YYK A;  2M1S A;  4L5N C;  2WBT A;  2EM7 A;  4FK5 C;  1A1H A;  1A1I A;  4B3M E;  3AV0 A;  2K7I A;  4BMJ A;  4K0K E;  3EPH A;  1YYW A;  5KL7 A;  2HJJ A;  2YPN A;  3T1H E;  2YTE A;  2CPN A;  1T4N A;  1XNR E;  2L8T A;  2EMH A; 
#chains in the Genus database with same CATH homology
 1A1G A;  2EM5 A;  2EMG A;  2EP3 A;  2PRT A;  2GLI A;  1X6H A;  2EL5 A;  4M9V C;  2YTF A;  2EPZ A;  2EPC A;  2ENA A;  2EPX A;  1X6F A;  2EM4 A;  2EMC A;  3MHS C;  1KJK A;  2EN8 A;  2YSP A;  2DMI A;  2ELZ A;  2EOF A;  2YTP A;  3EPJ A;  2R1F A;  4R2Q A;  2EN7 A;  2MKD A;  1ZU1 A;  2YU8 A;  2EMI A;  1TF6 A;  4R2D A;  1A1K A;  2EOX A;  1YSA C;  2EE8 A;  2LCE A;  3VHT B;  1BBO A;  1WJP A;  2NAB A;  4F2J C;  2EN3 A;  2BB8 A;  2ELY A;  1A1L A;  2ADR A;  2I13 A;  5KL3 A;  3UK3 C;  2LT7 A;  1DGC A;  2EL6 A;  2EL4 A;  1B69 A;  1ZAA C;  2YRK A;  1G2D C;  2JP9 A;  1JK1 A;  2EQ0 A;  2WBU A;  1RMD A;  2YTO A;  2WCC 3;  4R2P A;  2DRP A;  2EM6 A;  4WSG A;  2EM3 A;  4F6M A;  2EOJ A;  2EN1 A;  2YTJ A;  1UN6 B;  1LLM C;  2GHF A;  1P47 A;  1YUJ A;  1G2F C;  1X6E A;  4R2S A;  2EPA A;  2YTN A;  1JK2 A;  2LO3 A;  2RSI A;  4X9J A;  2YSO A;  2EM0 A;  2CT1 A;  1MEY C;  4IS1 C;  1BB8 A;  2DLQ A;  2MKN A;  1NCS A;  2EPP A;  2A25 A;  1UBD C;  2EMK A;  2EOZ A;  2YU5 A;  2EQ3 A;  2YRM A;  4IJD A;  1ZR9 A;  1Z1B A;  2LVH A;  2EMY A;  4R2E A;  1F2I G;  2EMA A;  4R2A A;  2EOQ A;  1AAY A;  2CSH A;  2EJ4 A;  2EOS A;  3M99 B;  1YUI A;  2EM8 A;  3MHH C;  2EMF A;  2MDG A;  2CTD A;  2LV2 A;  2HGH A;  2EMX A;  1X5W A;  2EOI A;  2YTG A;  2DLK A;  2RPC A;  2DGC A;  2ENC A;  3EPL A;  4F6N A;  1TF3 A;  2EQ1 A;  5KL2 A;  2EOR A;  2EN6 A;  4GZN C;  2J7J A;  5KL4 A;  2VRD A;  5KL6 A;  2EN2 A;  2M9A A;  2EOE A;  2ENH A;  2YRH A;  1TN9 A;  2EMZ A;  1A1J A;  2EPR A;  1X3C A;  2EOO A;  2WBT A;  2EM7 A;  4FK5 C;  2EPU A;  1A1H A;  4R2R A;  1A1I A;  2EML A;  2EOY A;  2JPA A;  2YTD A;  2YTQ A;  2EOM A;  2EMW A;  5KL5 A;  3EPH A;  2YTI A;  5KL7 A;  1A1F A;  2D9H A;  2YTE A;  2EOH A;  2EN4 A;  3EPK A;  2EM9 A;  2EMB A;  2WBS A;  4R2C A;  2EM2 A;  2EMH A;  2E72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...