2BB8A

N-terminal dna binding domain from tn916 integrase, nmr, minimized average structure
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
71
structure length
71
Chain Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Site-specific DNA binding using a variation of the double stranded RNA binding motif.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Dna recombination
total genus 6
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 1998-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2bb8A00
2EOYA 2DLKA 2ELZA 2EM4A 2J7JA 2D9HA 1A1JA 1JK2A 2EQ1A 2EMYA 5KL6A 4F6NA 2EMFA 2YTJA 1YSAC 1WJPA 2RSIA 2EN4A 3EPLA 4GZNC 1A1GA 2EPXA 4FK5C 1MEYC 2DLQA 1Z1BA 2GHFA 1P47A 1UN6B 1X3CA 2NABA 2EN7A 5KL4A 2EOZA 2YSOA 2YTIA 1TN9A 2CT1A 2LV2A 1ZAAC 2E72A 2MKDA 2EN6A 2EM8A 3UK3C 2EMWA 2EPRA 2LT7A 1X5WA 1F2IG 2DMIA 2YRMA 2EMAA 4IJDA 3EPJA 1UBDC 4R2QA 2EMLA 2ENCA 2EPZA 2YU5A 4M9VC 3VHTB 2EM7A 2ENHA 2YTQA 2PRTA 2EMZA 2LO3A 4WSGA 1A1IA 2YTOA 2EQ0A 2WBTA 2BB8A 2EPAA 4R2AA 2LVHA 1NCSA 1ZR9A 2ELYA 1X6HA 2EOFA 1YUJA 2JPAA 2EL4A 1RMDA 2CTDA 2WCC3 3M99B 2YU8A 2YTNA 2EQ3A 2EOSA 1DGCA 1KJKA 2GLIA 2EN2A 2EM9A 1ZU1A 2EN3A 3MHSC 5KL3A 2DGCA 2EMHA 2EOMA 1X6FA 3EPHA 2LCEA 2EMBA 2YRHA 1A1KA 2EOOA 2YTGA 2ADRA 2EMCA 2EMGA 2EOIA 2WBSA 2EMKA 1TF3A 2I13A 2MKNA 2EN1A 4F2JC 1A1HA 2EOHA 5KL5A 4R2RA 2EJ4A 2YRKA 2EPUA 2EMXA 3EPKA 4R2PA 2EE8A 5KL7A 1A1LA 2EOEA 2JP9A 4R2EA 1LLMC 4F6MA 1A1FA 2EORA 2EOXA 2EM0A 2A25A 2EPCA 2WBUA 2RPCA 2YTEA 2MDGA 1YUIA 1BB8A 1JK1A 2EL6A 2YTPA 3MHHC 1G2FC 2ENAA 2EM2A 2EOQA 2M9AA 4R2DA 5KL2A 4X9JA 2CSHA 2EMIA 4R2SA 4IS1C 2EM3A 2EP3A 2VRDA 1BBOA 2YSPA 1TF6A 2HGHA 2EN8A 2EOJA 2YTDA 1X6EA 2EPPA 2EL5A 2R1FA 4R2CA 1AAYA 2EM6A 2YTFA 2EM5A 1B69A 1G2DC 2DRPA
chains in the Genus database with same CATH superfamily
1IBME 4BHCA 3VYXA 1GQEA 3QG5C 1N36E 4DKKA 1JK2A 2EMYA 2B3TB 4DUZE 2VE7C 2RSIA 2EN4A 2ODRC 1A1GA 4FK5C 4DR5E 3TQMA 1MEYC 4ZYGA 2GHFA 2M7QA 1P47A 4L8NA 4LFBE 2VF1A 3EQ1A 3IWBA 2YSOA 2YTIA 2CT1A 4JI7E 4JYAE 2EN6A 3C6MA 1IBKE 1HNZE 4O24A 2EPRA 4LF9E 4B3SE 4F54A 4O4KA 1YYWA 3EPJA 4GKKE 4R2QA 5ADZA 2YU5A 3AV0A 2EPMX 1T38A 2EM7A 2ENHA 2YTQA 5AE3A 4ZYDA 3JU0A 4JI0E 4LU9A 2YTOA 2EQ0A 4X65E 2L33A 3KWRA 4DV5E 5IXMB 4R2AA 2LVHA 4X62E 2E1MA 1YPNA 4WPYA 4B3ME 2JVAA 1PJTA 1KJKA 4JV5E 1WHNA 1X47A 1PJSA 4N4RB 4R03A 3EPHA 3IWCA 1A1KA 2EOIA 4GEQB 5LLQA 2F4VE 3ECRA 3RMPA 1TF3A 2I13A 4B3RE 1XNRE 2EJ4A 1XMQE 2EPUA 2EE8A 4BC9A 4LFCE 2LUQA 1LLMC 4F6MA 2N3GA 1YFHA 4GKJE 4BMJA 1XMOE 2EOXA 3C6KA 2EPCA 2WBUA 4WXCA 2VQEE 2MDGA 1YUIA 2B7TA 2F8BA 5A69A 4RHBB 2UUCE 2UXBE 2EM2A 1O0WA 2CSHA 4L5NC 4M0VA 3H09A 3ADLA 2EM3A 1BBOA 1T4NA 3KZYA 3BBGA 4JI4E 2EOJA 2YTDA 1X6EA 5F3WA 2R1FA 1QNTA 1AAYA 2YTFA 4DR4E 2HC5A 5FLXC 2DLKA 2ELZA 2KOUA 4O43A 1A1JA 2CPNA 2EQ1A 4F6NA 4BS9A 2EMFA 2YTJA 3EPLA 4LTYA 1NEIA 4X8WA 2DLQA 1UN6B 1XNQE 1N33E 5TSEA 4KWYA 1TN9A 3T1YE 1ZAAC 4WYQB 2I9IA 4BC7A 2EPKX 2LT7A 1HNWE 2YPNA 1X5WA 2GPIA 2YWQA 4JI8E 4IJDA 2L92A 2EMLA 3VHTB 5IV8B 4DV3E 4Q28A 2PRTA 2EMZA 2BB8A 4OOGC 2L6MA 1NCSA 3OMLA 2RSMA 2L8TA 1EH6A 2ELYA 2LMZA 2JPAA 2CTDA 2WCC3 3M99B 2EQ3A 1UHZA 1WRJA 2GLIA 2B9DA 2MC6A 1ZU1A 3J81C 1YYOA 3K6QA 4DUYE 4JI6E 1QU6A 2EOOA 4WX9A 1IQSA 2YT4A 3C4TA 2EMGA 2NA2A 2UXCE 2JWOA 2L2KB 2EMKA 4O5GA 2WBSA 4DR1E 4F2JC 2UUAE 1UILA 1SFEA 3EPKA 4R2PA 5LMUE 2HJJA 3F6GA 2EOEA 1L4SA 1J26A 4F9BB 3JTZA 1A1FA 2A25A 1X49A 4TUGA 2JR1A 2JXPA 2YZTA 2G7HA 4OX9E 4DV6E 2YTPA 3MHHC 1G2FC 4J8ZA 2EOQA 3BIDA 4R2SA 2VRDA 5A2QC 2DMYA 4P7DA 5AASA 4ZYEA 2HGHA 2V89A 2LTSA 2R76A 1STUA 2EL5A 2LJHA 2RQLA 2EM5A 4BCAA 4LF8E 1G2DC 2DRPA 2EOYA 3HQ1A 2V86A 2VQFE 3DF6A 2V83A 3THNA 1X48A 1DQ3A 2MC5A 1DI2A 4DR7E 2NABA 3MSWA 2EOZA 1YYKA 2L3CA 4R8OA 1FKAE 2LTRA 4YHHE 2K4VA 2EM8A 2JY9A 1RQ0A 2V88A 4KHPE 2LRSA 1F2IG 2EMAA 2FTXB 1UBDC 1N32E 2E5LE 2ENCA 2EPZA 4BBYA 5A6JA 4KZSA 5BR8E 4WSGA 4DR6E 2EPAA 4TUIA 2LBSB 4LF7E 3ADGA 1ZR9A 1X6HA 4P78A 2EL4A 3ADIA 2DB2A 1HR0E 2YTNA 1DGCA 3KZZA 3T1HE 2EN3A 3MHSC 5AC5A 2UUBE 3VYYA 1PKPA 5KL3A 2DGCA 2EMHA 4JI2E 1BBGA 4NXNE 1J5EE 4WFTA 1X6FA 1GTKA 1PJQA 2LCEA 4F9CB 2NUEA 4WXDA 2EMBA 2DIXA 1GZ6A 2MKNA 3J80C 1MGTA 2M1SA 4R2RA 2YRKA 2JOBA 2EMXA 3LLHA 5KL7A 3J7Yp 1A1LA 2N8XA 1IMUA 5A6AA 3HTXA 4M2ZA 2EORA 2EM0A 4YY3E 4DR2E 4LF5E 2V85A 2EZ6A 2MDRA 2L2NA 5IT9C 2KHXA 1ZBQA 2RPCA 3JAMC 4ZYHA 1BB8A 4X64E 1JK1A 1T4LB 4DMIA 3HPSA 3ZOQB 1HNXE 2M9AA 4R2DA 4X9JA 4IS1C 1EH7A 3IWDA 1IBLE 2Q8UA 1TF6A 2EN8A 2EPPA 2LJUA 3L00A 3LMLA 4R2CA 2JOXA 4DV1E 2FV4B 4JI3E 1YZ9A 5A6KA 2EM4A 2J7JA 2D9HA 2RS7A 2H36X 2EWLA 1EKZA 5KL6A 2RS6A 1YSAC 1WJPA 4GZNC 2EPXA 3HPZA 4DV4E 2NUFA 2L2MA 1Z1BA 2ZM6E 1X3CA 2EN7A 5KL4A 1T39A 1N3GA 2LV2A 2IHR1 2E72A 2MKDA 1FJGE 1WXRA 1WHQA 5AC4A 2EPNA 3UK3C 2EMWA 4NHRA 5AE1A 1IQOA 5T6JA 2DMIA 4B3TE 3C4BA 2YRMA 4DV7E 4AQYE 3OTOE 2WZOA 3F6HA 4LF6E 4M9VC 3FIGA 3THOB 5IWAE 1SR9A 4MLQA 5A6BD 3P1XA 3J7AG 2LO3A 2K7IA 1A1IA 2WBTA 5AE2A 4DR3E 4MLVA 4BHBA 4LF4E 4DV2E 2EOFA 1YUJA 1RMDA 5CFFE 2YU8A 2LUPB 4HTGA 2EOSA 2FGGA 3AUZA 4WSPA 4K0KE 2EN2A 2EM9A 1KYQA 4Q35B 1PDAA 2L3JA 2EOMA 4NXME 5DNYA 2HHHE 3ADJA 2YRHA 2V8QB 2YTGA 5LMNE 2ADRA 2EMCA 1EH8A 4JI5E 1T4OA 4DV0E 2EN1A 4NZVA 1A1HA 4JI1E 1AH5A 5LL6R 2EOHA 2UXDE 5KL5A 4HEIA 4X66E 2V87A 2JYAA 4LFAE 2BBGA 2JP9A 4M30A 4R2EA 2NUGA 3BF2A 2EPLX 2ODRD 2B7VA 4F9AB 3HXLA 3BGHA 3DJWA 2EPOA 2KONA 2M4IA 2UU9E 2YTEA 4I8OA 2EL6A 2ENAA 1RC7A 5KL2A 2EMIA 2EP3A 1I94E 2YSPA 2RTXA 4RH8A 2LE2A 1N34E 3VK6A 2EM6A 1ZBTA 5A6BA 2N3HA 1B69A 2DSYA
chains in the Genus database with same CATH topology
2EOYA 2DLKA 2ELZA 2EM4A 2J7JA 2D9HA 1A1JA 1JK2A 2EQ1A 2EMYA 5KL6A 4F6NA 2EMFA 2YTJA 1YSAC 1WJPA 2RSIA 2EN4A 3EPLA 4GZNC 1A1GA 2EPXA 4FK5C 1MEYC 2DLQA 1Z1BA 2GHFA 1P47A 1UN6B 1X3CA 2NABA 2EN7A 5KL4A 2EOZA 2YSOA 2YTIA 1TN9A 2CT1A 2LV2A 1ZAAC 2E72A 2MKDA 2EN6A 2EM8A 3UK3C 2EMWA 2EPRA 2LT7A 1X5WA 1F2IG 2DMIA 2YRMA 2EMAA 4IJDA 3EPJA 1UBDC 4R2QA 2EMLA 2ENCA 2EPZA 2YU5A 4M9VC 3VHTB 2EM7A 2ENHA 2YTQA 2PRTA 2EMZA 2LO3A 4WSGA 1A1IA 2YTOA 2EQ0A 2WBTA 2BB8A 2EPAA 4R2AA 2LVHA 1NCSA 1ZR9A 2ELYA 1X6HA 2EOFA 1YUJA 2JPAA 2EL4A 1RMDA 2CTDA 2WCC3 3M99B 2YU8A 2YTNA 2EQ3A 2EOSA 1DGCA 1KJKA 2GLIA 2EN2A 2EM9A 1ZU1A 2EN3A 3MHSC 5KL3A 2DGCA 2EMHA 2EOMA 1X6FA 3EPHA 2LCEA 2EMBA 2YRHA 1A1KA 2EOOA 2YTGA 2ADRA 2EMCA 2EMGA 2EOIA 2WBSA 2EMKA 1TF3A 2I13A 2MKNA 2EN1A 4F2JC 1A1HA 2EOHA 5KL5A 4R2RA 2EJ4A 2YRKA 2EPUA 2EMXA 3EPKA 4R2PA 2EE8A 5KL7A 1A1LA 2EOEA 2JP9A 4R2EA 1LLMC 4F6MA 1A1FA 2EORA 2EOXA 2EM0A 2A25A 2EPCA 2WBUA 2RPCA 2YTEA 2MDGA 1YUIA 1BB8A 1JK1A 2EL6A 2YTPA 3MHHC 1G2FC 2ENAA 2EM2A 2EOQA 2M9AA 4R2DA 5KL2A 4X9JA 2CSHA 2EMIA 4R2SA 4IS1C 2EM3A 2EP3A 2VRDA 1BBOA 2YSPA 1TF6A 2HGHA 2EN8A 2EOJA 2YTDA 1X6EA 2EPPA 2EL5A 2R1FA 4R2CA 1AAYA 2EM6A 2YTFA 2EM5A 1B69A 1G2DC 2DRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOY A;  2DLK A;  2ELZ A;  2EM4 A;  2J7J A;  2D9H A;  1A1J A;  1JK2 A;  2EQ1 A;  2EMY A;  5KL6 A;  4F6N A;  2EMF A;  2YTJ A;  1YSA C;  1WJP A;  2RSI A;  2EN4 A;  3EPL A;  4GZN C;  1A1G A;  2EPX A;  4FK5 C;  1MEY C;  2DLQ A;  1Z1B A;  2GHF A;  1P47 A;  1UN6 B;  1X3C A;  2NAB A;  2EN7 A;  5KL4 A;  2EOZ A;  2YSO A;  2YTI A;  1TN9 A;  2CT1 A;  2LV2 A;  1ZAA C;  2E72 A;  2MKD A;  2EN6 A;  2EM8 A;  3UK3 C;  2EMW A;  2EPR A;  2LT7 A;  1X5W A;  1F2I G;  2DMI A;  2YRM A;  2EMA A;  4IJD A;  3EPJ A;  1UBD C;  4R2Q A;  2EML A;  2ENC A;  2EPZ A;  2YU5 A;  4M9V C;  3VHT B;  2EM7 A;  2ENH A;  2YTQ A;  2PRT A;  2EMZ A;  2LO3 A;  4WSG A;  1A1I A;  2YTO A;  2EQ0 A;  2WBT A;  2BB8 A;  2EPA A;  4R2A A;  2LVH A;  1NCS A;  1ZR9 A;  2ELY A;  1X6H A;  2EOF A;  1YUJ A;  2JPA A;  2EL4 A;  1RMD A;  2CTD A;  2WCC 3;  3M99 B;  2YU8 A;  2YTN A;  2EQ3 A;  2EOS A;  1DGC A;  1KJK A;  2GLI A;  2EN2 A;  2EM9 A;  1ZU1 A;  2EN3 A;  3MHS C;  5KL3 A;  2DGC A;  2EMH A;  2EOM A;  1X6F A;  3EPH A;  2LCE A;  2EMB A;  2YRH A;  1A1K A;  2EOO A;  2YTG A;  2ADR A;  2EMC A;  2EMG A;  2EOI A;  2WBS A;  2EMK A;  1TF3 A;  2I13 A;  2MKN A;  2EN1 A;  4F2J C;  1A1H A;  2EOH A;  5KL5 A;  4R2R A;  2EJ4 A;  2YRK A;  2EPU A;  2EMX A;  3EPK A;  4R2P A;  2EE8 A;  5KL7 A;  1A1L A;  2EOE A;  2JP9 A;  4R2E A;  1LLM C;  4F6M A;  1A1F A;  2EOR A;  2EOX A;  2EM0 A;  2A25 A;  2EPC A;  2WBU A;  2RPC A;  2YTE A;  2MDG A;  1YUI A;  1BB8 A;  1JK1 A;  2EL6 A;  2YTP A;  3MHH C;  1G2F C;  2ENA A;  2EM2 A;  2EOQ A;  2M9A A;  4R2D A;  5KL2 A;  4X9J A;  2CSH A;  2EMI A;  4R2S A;  4IS1 C;  2EM3 A;  2EP3 A;  2VRD A;  1BBO A;  2YSP A;  1TF6 A;  2HGH A;  2EN8 A;  2EOJ A;  2YTD A;  1X6E A;  2EPP A;  2EL5 A;  2R1F A;  4R2C A;  1AAY A;  2EM6 A;  2YTF A;  2EM5 A;  1B69 A;  1G2D C;  2DRP A; 
#chains in the Genus database with same CATH topology
 1IBM E;  4BHC A;  3VYX A;  1GQE A;  3QG5 C;  1N36 E;  4DKK A;  1JK2 A;  2EMY A;  2B3T B;  4DUZ E;  2VE7 C;  2RSI A;  2EN4 A;  2ODR C;  1A1G A;  4FK5 C;  4DR5 E;  3TQM A;  1MEY C;  4ZYG A;  2GHF A;  2M7Q A;  1P47 A;  4L8N A;  4LFB E;  2VF1 A;  3EQ1 A;  3IWB A;  2YSO A;  2YTI A;  2CT1 A;  4JI7 E;  4JYA E;  2EN6 A;  3C6M A;  1IBK E;  1HNZ E;  4O24 A;  2EPR A;  4LF9 E;  4B3S E;  4F54 A;  4O4K A;  1YYW A;  3EPJ A;  4GKK E;  4R2Q A;  5ADZ A;  2YU5 A;  3AV0 A;  2EPM X;  1T38 A;  2EM7 A;  2ENH A;  2YTQ A;  5AE3 A;  4ZYD A;  3JU0 A;  4JI0 E;  4LU9 A;  2YTO A;  2EQ0 A;  4X65 E;  2L33 A;  3KWR A;  4DV5 E;  5IXM B;  4R2A A;  2LVH A;  4X62 E;  2E1M A;  1YPN A;  4WPY A;  4B3M E;  2JVA A;  1PJT A;  1KJK A;  4JV5 E;  1WHN A;  1X47 A;  1PJS A;  4N4R B;  4R03 A;  3EPH A;  3IWC A;  1A1K A;  2EOI A;  4GEQ B;  5LLQ A;  2F4V E;  3ECR A;  3RMP A;  1TF3 A;  2I13 A;  4B3R E;  1XNR E;  2EJ4 A;  1XMQ E;  2EPU A;  2EE8 A;  4BC9 A;  4LFC E;  2LUQ A;  1LLM C;  4F6M A;  2N3G A;  1YFH A;  4GKJ E;  4BMJ A;  1XMO E;  2EOX A;  3C6K A;  2EPC A;  2WBU A;  4WXC A;  2VQE E;  2MDG A;  1YUI A;  2B7T A;  2F8B A;  5A69 A;  4RHB B;  2UUC E;  2UXB E;  2EM2 A;  1O0W A;  2CSH A;  4L5N C;  4M0V A;  3H09 A;  3ADL A;  2EM3 A;  1BBO A;  1T4N A;  3KZY A;  3BBG A;  4JI4 E;  2EOJ A;  2YTD A;  1X6E A;  5F3W A;  2R1F A;  1QNT A;  1AAY A;  2YTF A;  4DR4 E;  2HC5 A;  5FLX C;  2DLK A;  2ELZ A;  2KOU A;  4O43 A;  1A1J A;  2CPN A;  2EQ1 A;  4F6N A;  4BS9 A;  2EMF A;  2YTJ A;  3EPL A;  4LTY A;  1NEI A;  4X8W A;  2DLQ A;  1UN6 B;  1XNQ E;  1N33 E;  5TSE A;  4KWY A;  1TN9 A;  3T1Y E;  1ZAA C;  4WYQ B;  2I9I A;  4BC7 A;  2EPK X;  2LT7 A;  1HNW E;  2YPN A;  1X5W A;  2GPI A;  2YWQ A;  4JI8 E;  4IJD A;  2L92 A;  2EML A;  3VHT B;  5IV8 B;  4DV3 E;  4Q28 A;  2PRT A;  2EMZ A;  2BB8 A;  4OOG C;  2L6M A;  1NCS A;  3OML A;  2RSM A;  2L8T A;  1EH6 A;  2ELY A;  2LMZ A;  2JPA A;  2CTD A;  2WCC 3;  3M99 B;  2EQ3 A;  1UHZ A;  1WRJ A;  2GLI A;  2B9D A;  2MC6 A;  1ZU1 A;  3J81 C;  1YYO A;  3K6Q A;  4DUY E;  4JI6 E;  1QU6 A;  2EOO A;  4WX9 A;  1IQS A;  2YT4 A;  3C4T A;  2EMG A;  2NA2 A;  2UXC E;  2JWO A;  2L2K B;  2EMK A;  4O5G A;  2WBS A;  4DR1 E;  4F2J C;  2UUA E;  1UIL A;  1SFE A;  3EPK A;  4R2P A;  5LMU E;  2HJJ A;  3F6G A;  2EOE A;  1L4S A;  1J26 A;  4F9B B;  3JTZ A;  1A1F A;  2A25 A;  1X49 A;  4TUG A;  2JR1 A;  2JXP A;  2YZT A;  2G7H A;  4OX9 E;  4DV6 E;  2YTP A;  3MHH C;  1G2F C;  4J8Z A;  2EOQ A;  3BID A;  4R2S A;  2VRD A;  5A2Q C;  2DMY A;  4P7D A;  5AAS A;  4ZYE A;  2HGH A;  2V89 A;  2LTS A;  2R76 A;  1STU A;  2EL5 A;  2LJH A;  2RQL A;  2EM5 A;  4BCA A;  4LF8 E;  1G2D C;  2DRP A;  2EOY A;  3HQ1 A;  2V86 A;  2VQF E;  3DF6 A;  2V83 A;  3THN A;  1X48 A;  1DQ3 A;  2MC5 A;  1DI2 A;  4DR7 E;  2NAB A;  3MSW A;  2EOZ A;  1YYK A;  2L3C A;  4R8O A;  1FKA E;  2LTR A;  4YHH E;  2K4V A;  2EM8 A;  2JY9 A;  1RQ0 A;  2V88 A;  4KHP E;  2LRS A;  1F2I G;  2EMA A;  2FTX B;  1UBD C;  1N32 E;  2E5L E;  2ENC A;  2EPZ A;  4BBY A;  5A6J A;  4KZS A;  5BR8 E;  4WSG A;  4DR6 E;  2EPA A;  4TUI A;  2LBS B;  4LF7 E;  3ADG A;  1ZR9 A;  1X6H A;  4P78 A;  2EL4 A;  3ADI A;  2DB2 A;  1HR0 E;  2YTN A;  1DGC A;  3KZZ A;  3T1H E;  2EN3 A;  3MHS C;  5AC5 A;  2UUB E;  3VYY A;  1PKP A;  5KL3 A;  2DGC A;  2EMH A;  4JI2 E;  1BBG A;  4NXN E;  1J5E E;  4WFT A;  1X6F A;  1GTK A;  1PJQ A;  2LCE A;  4F9C B;  2NUE A;  4WXD A;  2EMB A;  2DIX A;  1GZ6 A;  2MKN A;  3J80 C;  1MGT A;  2M1S A;  4R2R A;  2YRK A;  2JOB A;  2EMX A;  3LLH A;  5KL7 A;  3J7Y p;  1A1L A;  2N8X A;  1IMU A;  5A6A A;  3HTX A;  4M2Z A;  2EOR A;  2EM0 A;  4YY3 E;  4DR2 E;  4LF5 E;  2V85 A;  2EZ6 A;  2MDR A;  2L2N A;  5IT9 C;  2KHX A;  1ZBQ A;  2RPC A;  3JAM C;  4ZYH A;  1BB8 A;  4X64 E;  1JK1 A;  1T4L B;  4DMI A;  3HPS A;  3ZOQ B;  1HNX E;  2M9A A;  4R2D A;  4X9J A;  4IS1 C;  1EH7 A;  3IWD A;  1IBL E;  2Q8U A;  1TF6 A;  2EN8 A;  2EPP A;  2LJU A;  3L00 A;  3LML A;  4R2C A;  2JOX A;  4DV1 E;  2FV4 B;  4JI3 E;  1YZ9 A;  5A6K A;  2EM4 A;  2J7J A;  2D9H A;  2RS7 A;  2H36 X;  2EWL A;  1EKZ A;  5KL6 A;  2RS6 A;  1YSA C;  1WJP A;  4GZN C;  2EPX A;  3HPZ A;  4DV4 E;  2NUF A;  2L2M A;  1Z1B A;  2ZM6 E;  1X3C A;  2EN7 A;  5KL4 A;  1T39 A;  1N3G A;  2LV2 A;  2IHR 1;  2E72 A;  2MKD A;  1FJG E;  1WXR A;  1WHQ A;  5AC4 A;  2EPN A;  3UK3 C;  2EMW A;  4NHR A;  5AE1 A;  1IQO A;  5T6J A;  2DMI A;  4B3T E;  3C4B A;  2YRM A;  4DV7 E;  4AQY E;  3OTO E;  2WZO A;  3F6H A;  4LF6 E;  4M9V C;  3FIG A;  3THO B;  5IWA E;  1SR9 A;  4MLQ A;  5A6B D;  3P1X A;  3J7A G;  2LO3 A;  2K7I A;  1A1I A;  2WBT A;  5AE2 A;  4DR3 E;  4MLV A;  4BHB A;  4LF4 E;  4DV2 E;  2EOF A;  1YUJ A;  1RMD A;  5CFF E;  2YU8 A;  2LUP B;  4HTG A;  2EOS A;  2FGG A;  3AUZ A;  4WSP A;  4K0K E;  2EN2 A;  2EM9 A;  1KYQ A;  4Q35 B;  1PDA A;  2L3J A;  2EOM A;  4NXM E;  5DNY A;  2HHH E;  3ADJ A;  2YRH A;  2V8Q B;  2YTG A;  5LMN E;  2ADR A;  2EMC A;  1EH8 A;  4JI5 E;  1T4O A;  4DV0 E;  2EN1 A;  4NZV A;  1A1H A;  4JI1 E;  1AH5 A;  5LL6 R;  2EOH A;  2UXD E;  5KL5 A;  4HEI A;  4X66 E;  2V87 A;  2JYA A;  4LFA E;  2BBG A;  2JP9 A;  4M30 A;  4R2E A;  2NUG A;  3BF2 A;  2EPL X;  2ODR D;  2B7V A;  4F9A B;  3HXL A;  3BGH A;  3DJW A;  2EPO A;  2KON A;  2M4I A;  2UU9 E;  2YTE A;  4I8O A;  2EL6 A;  2ENA A;  1RC7 A;  5KL2 A;  2EMI A;  2EP3 A;  1I94 E;  2YSP A;  2RTX A;  4RH8 A;  2LE2 A;  1N34 E;  3VK6 A;  2EM6 A;  1ZBT A;  5A6B A;  2N3H A;  1B69 A;  2DSY A; 
#chains in the Genus database with same CATH homology
 2EOY A;  2DLK A;  2ELZ A;  2EM4 A;  2J7J A;  2D9H A;  1A1J A;  1JK2 A;  2EQ1 A;  2EMY A;  5KL6 A;  4F6N A;  2EMF A;  2YTJ A;  1YSA C;  1WJP A;  2RSI A;  2EN4 A;  3EPL A;  4GZN C;  1A1G A;  2EPX A;  4FK5 C;  1MEY C;  2DLQ A;  1Z1B A;  2GHF A;  1P47 A;  1UN6 B;  1X3C A;  2NAB A;  2EN7 A;  5KL4 A;  2EOZ A;  2YSO A;  2YTI A;  1TN9 A;  2CT1 A;  2LV2 A;  1ZAA C;  2E72 A;  2MKD A;  2EN6 A;  2EM8 A;  3UK3 C;  2EMW A;  2EPR A;  2LT7 A;  1X5W A;  1F2I G;  2DMI A;  2YRM A;  2EMA A;  4IJD A;  3EPJ A;  1UBD C;  4R2Q A;  2EML A;  2ENC A;  2EPZ A;  2YU5 A;  4M9V C;  3VHT B;  2EM7 A;  2ENH A;  2YTQ A;  2PRT A;  2EMZ A;  2LO3 A;  4WSG A;  1A1I A;  2YTO A;  2EQ0 A;  2WBT A;  2BB8 A;  2EPA A;  4R2A A;  2LVH A;  1NCS A;  1ZR9 A;  2ELY A;  1X6H A;  2EOF A;  1YUJ A;  2JPA A;  2EL4 A;  1RMD A;  2CTD A;  2WCC 3;  3M99 B;  2YU8 A;  2YTN A;  2EQ3 A;  2EOS A;  1DGC A;  1KJK A;  2GLI A;  2EN2 A;  2EM9 A;  1ZU1 A;  2EN3 A;  3MHS C;  5KL3 A;  2DGC A;  2EMH A;  2EOM A;  1X6F A;  3EPH A;  2LCE A;  2EMB A;  2YRH A;  1A1K A;  2EOO A;  2YTG A;  2ADR A;  2EMC A;  2EMG A;  2EOI A;  2WBS A;  2EMK A;  1TF3 A;  2I13 A;  2MKN A;  2EN1 A;  4F2J C;  1A1H A;  2EOH A;  5KL5 A;  4R2R A;  2EJ4 A;  2YRK A;  2EPU A;  2EMX A;  3EPK A;  4R2P A;  2EE8 A;  5KL7 A;  1A1L A;  2EOE A;  2JP9 A;  4R2E A;  1LLM C;  4F6M A;  1A1F A;  2EOR A;  2EOX A;  2EM0 A;  2A25 A;  2EPC A;  2WBU A;  2RPC A;  2YTE A;  2MDG A;  1YUI A;  1BB8 A;  1JK1 A;  2EL6 A;  2YTP A;  3MHH C;  1G2F C;  2ENA A;  2EM2 A;  2EOQ A;  2M9A A;  4R2D A;  5KL2 A;  4X9J A;  2CSH A;  2EMI A;  4R2S A;  4IS1 C;  2EM3 A;  2EP3 A;  2VRD A;  1BBO A;  2YSP A;  1TF6 A;  2HGH A;  2EN8 A;  2EOJ A;  2YTD A;  1X6E A;  2EPP A;  2EL5 A;  2R1F A;  4R2C A;  1AAY A;  2EM6 A;  2YTF A;  2EM5 A;  1B69 A;  1G2D C;  2DRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...