2BB8A

N-terminal dna binding domain from tn916 integrase, nmr, minimized average structure
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
71
structure length
71
Chain Sequence
b'EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Site-specific DNA binding using a variation of the double stranded RNA binding motif.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Dna recombination
total genus 6
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 1998-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2bb8A00
2RSIA 2EMFA 4FK5C 2EN3A 2MKNA 1F2IG 2EN4A 2YTDA 1YUJA 2LT7A 2YTJA 1ZU1A 2EOFA 4R2RA 2YTGA 2YSPA 5KL5A 2BB8A 2ENHA 2EM0A 2EPZA 2EPPA 1A1GA 3UK3C 1X5WA 4R2EA 2EMIA 5KL2A 4WSGA 3EPJA 3VHTB 2EPUA 4R2SA 2YRMA 2EMHA 2EOZA 2EORA 2ELYA 2LV2A 2EOXA 2EMZA 2EOHA 2J7JA 4R2QA 2EN7A 1RMDA 1WJPA 4R2AA 2DGCA 3EPHA 1NCSA 1BBOA 3EPKA 1JK2A 2DMIA 2E72A 2EMAA 2LVHA 1UN6B 2GHFA 1YUIA 2EMBA 1MEYC 2EQ3A 5KL4A 1X3CA 1A1JA 2YRKA 1BB8A 3MHHC 2YTQA 3M99B 2EMWA 1A1IA 2ENCA 4M9VC 1B69A 2R1FA 2DLQA 4IJDA 4IS1C 2EM4A 2YTFA 1ZAAC 4R2CA 2JP9A 2EPXA 2GLIA 2YTIA 2YU8A 2WCC3 2RPCA 2WBUA 2CSHA 2EQ0A 1DGCA 2ELZA 2CTDA 1LLMC 2EM9A 2EMKA 2EL5A 2EN2A 3MHSC 2EOJA 1G2DC 1KJKA 2MKDA 2DRPA 2EOIA 2ADRA 1TF6A 2EM6A 2WBTA 2EP3A 2EL6A 1Z1BA 2D9HA 4X9JA 2M9AA 1X6HA 2LO3A 2YTEA 2YTPA 2EPAA 2WBSA 1TN9A 1TF3A 2EM2A 2ENAA 5KL3A 2YRHA 4F6NA 2EM3A 2EOOA 2I13A 4F2JC 2YU5A 1JK1A 1X6FA 2EMXA 4GZNC 1AAYA 2EPCA 2VRDA 2EOEA 2EOSA 2EPRA 2LCEA 1P47A 2HGHA 1G2FC 2PRTA 2EM5A 2EM8A 4R2PA 2EJ4A 2EOYA 2EOQA 5KL7A 2CT1A 1A1HA 2EN6A 2DLKA 2EL4A 2EMCA 2YSOA 3EPLA 1A1FA 5KL6A 2EN1A 2A25A 2EM7A 2MDGA 2EMGA 2YTOA 4F6MA 2YTNA 1ZR9A 2EOMA 1A1KA 2EQ1A 1X6EA 1A1LA 2EMYA 1YSAC 2NABA 2JPAA 2EE8A 2EN8A 1UBDC 2EMLA 4R2DA
chains in the Genus database with same CATH superfamily
1IQSA 2EN4A 4DV6E 2YTJA 4LF4E 3TQMA 2HJJA 4DV2E 2EPMX 1N3GA 3UK3C 1X5WA 4HTGA 4WFTA 4BC7A 2EMIA 4OOGC 2YPNA 5KL2A 3EPJA 4NHRA 4AQYE 2YRMA 1YZ9A 2VE7C 2ELYA 2NUEA 3LLHA 4ZYEA 4BHBA 4DMIA 3BF2A 1WHQA 1WJPA 4R2AA 2LUQA 3EPHA 1NCSA 2DMIA 2DIXA 1YUIA 1MEYC 2EQ3A 5KL4A 1BB8A 2UXCE 4R03A 2JR1A 4TUIA 1PJQA 4B3RE 2KOUA 3RMPA 1XNRE 3JAMC 2YTFA 4DR2E 3DJWA 4DV4E 3F6HA 2EPXA 2YU8A 1BBGA 5ADZA 4BC9A 2CSHA 1DGCA 4LFBE 4WXCA 4DUYE 5A6KA 5LMNE 2EL5A 4KZSA 4MLQA 5LL6R 3C4BA 4JI0E 5IV8B 2EM6A 5A2QC 2ODRC 4X65E 2EL6A 2Q8UA 3AV0A 4DR7E 4KHPE 2L8TA 2YTPA 2LO3A 3F6GA 2EM2A 5KL3A 2MC6A 1EH6A 2UUBE 2VRDA 2EOSA 1P47A 2PRTA 2LMZA 1N32E 5AE2A 4RH8A 4N4RB 1A1HA 1PKPA 3MSWA 2EWLA 2RSMA 1HNZE 2EN1A 4Q28A 2MDGA 2KHXA 4WPYA 5AE3A 3KZYA 4F6MA 3HTXA 2EPOA 2LTSA 4YHHE 2EMYA 2NABA 2N3HA 2LE2A 2MC5A 1UBDC 4JI7E 4R2DA 1FJGE 2B7TA 2VF1A 4KWYA 2EN3A 2MKNA 4LF6E 1J26A 3IWCA 2R76A 5AC5A 2LT7A 2FV4B 3P1XA 4ZYHA 5BR8E 4R2RA 2YSPA 2M4IA 1DQ3A 5F3WA 2BB8A 2ENHA 2EPPA 4F9BB 2JOBA 4R2EA 4DR5E 2NA2A 1XMQE 4JI3E 3JU0A 4R2SA 4GKJE 2LJUA 2EMZA 2J7JA 3THNA 4R2QA 2EN7A 1RMDA 5AASA 2DGCA 2UUAE 1X49A 3EPKA 4DUZE 1HNWE 3VK6A 1JK2A 2E72A 2LVHA 2EMBA 5DNYA 1X3CA 1A1JA 3IWBA 3MHHC 2ZM6E 1GTKA 4DR4E 2KONA 1A1IA 2ENCA 3ECRA 4M9VC 2R1FA 3OTOE 2V86A 3AUZA 1KYQA 2EZ6A 2JP9A 4DR1E 4JI6E 1X47A 2LUPB 3C6KA 2YTIA 3ADLA 1DI2A 4LF7E 2UU9E 2ELZA 2CTDA 2EMKA 5IXMB 2EN2A 4X62E 2EOJA 1X48A 1G2DC 4BS9A 1XMOE 2K7IA 2ADRA 3KWRA 3ZOQB 4DV7E 2EP3A 4TUGA 2JWOA 1Z1BA 2RS7A 2M9AA 3J7Yp 1IBLE 2UXBE 2EPAA 3J81C 2WBSA 1NEIA 2M7QA 2RQLA 3OMLA 4F6NA 2V89A 2I13A 4F2JC 5AE1A 1JK1A 4GZNC 2EPCA 4WYQB 2B7VA 4DV0E 2JYAA 2EM8A 2HC5A 2EOYA 2FTXB 2EOQA 1WHNA 2V88A 4O43A 2CT1A 2DLKA 5A6AA 5KL6A 3VYXA 4DV1E 2EMGA 1ZR9A 1L4SA 4ZYGA 2V8QB 5FLXC 4WSPA 1PDAA 3LMLA 2EMFA 4FK5C 2V83A 4B3SE 4M30A 4K0KE 4P78A 2YTGA 2L3CA 4WXDA 4O4KA 2EPZA 4YY3E 1A1GA 2I9IA 1UILA 2M1SA 3KZZA 4M2ZA 1O0WA 5LMUE 2N3GA 2YWQA 4NXNE 2EMHA 2EOZA 2E1MA 2VQFE 2LV2A 2JY9A 4ZYDA 3EQ1A 5IWAE 4J8ZA 2LJHA 4WX9A 3VYYA 2EMAA 1UN6B 2GHFA 3BGHA 1RQ0A 2YRKA 3M99B 4M0VA 1QU6A 1B69A 4IJDA 3DF6A 4DV5E 4GEQB 2WZOA 2RS6A 1YYWA 4BCAA 4O5GA 3J7AG 4DKKA 2LBSB 1RC7A 2RPCA 2WBUA 3HQ1A 1GZ6A 5A6JA 1LLMC 2EM9A 2L92A 3MHSC 4BHCA 4BMJA 4HEIA 2EPNA 1YFHA 4JI5E 2MKDA 1KJKA 1TF6A 2WBTA 3ADIA 4L8NA 3J80C 2D9HA 2L6MA 4X9JA 1PJSA 4MLVA 2YTEA 4LFAE 1TF3A 2YRHA 4LTYA 2K4VA 2EM3A 2EOOA 2YU5A 1T38A 1X6FA 5CFFE 4B3ME 2EOEA 2LCEA 1IBME 5IT9C 2EM5A 2UXDE 2B9DA 4JYAE 5KL7A 3BBGA 3FIGA 1MGTA 1I94E 2EN6A 1WRJA 2EL4A 2EMCA 3EPLA 2VQEE 1A1FA 1YYOA 3K6QA 3ADJA 2YTNA 5TSEA 2JVAA 2EOMA 1IMUA 4LF8E 1A1KA 2EQ1A 1X6EA 2YT4A 1EH7A 1SFEA 3H09A 1A1LA 1YPNA 4NZVA 4JI8E 1YSAC 2NUGA 3HPSA 2YZTA 2EN8A 2YTOA 4F9AB 1IBKE 2RSIA 2B3TB 4F54A 2DMYA 1F2IG 4JV5E 1N34E 4JI4E 2YTDA 1YUJA 2L2NA 3T1YE 1ZU1A 1EH8A 2EOFA 2UUCE 1N33E 5KL5A 2FGGA 1GQEA 1WXRA 2EM0A 5LLQA 4Q35B 3HPZA 4BBYA 4X64E 4WSGA 2ODRD 1J5EE 4LF5E 3VHTB 1PJTA 2EPUA 3HXLA 2NUFA 3ADGA 2EORA 2F8BA 1QNTA 1ZBTA 4X8WA 2EOXA 2L2KB 2EOHA 4DR3E 1BBOA 1ZBQA 3QG5C 2CPNA 2HHHE 2JOXA 1STUA 4OX9E 4GKKE 2YTQA 4X66E 3THOB 2EMWA 2DLQA 3IWDA 2L2MA 4IS1C 1YYKA 2EM4A 2L33A 2MDRA 1ZAAC 4R2CA 1IQOA 4O24A 5A69A 1UHZA 5A6BD 1HR0E 2GLIA 2WCC3 2E5LE 2EQ0A 1N36E 2EPKX 4F9CB 1T4LB 2EPLX 4L5NC 3JTZA 2V85A 2V87A 2DRPA 2EOIA 4P7DA 1T4OA 2N8XA 2L3JA 2LRSA 1X6HA 4LU9A 1TN9A 3C6MA 2JXPA 2ENAA 1EKZA 1FKAE 4LF9E 1AH5A 2EMXA 4DV3E 4JI1E 1AAYA 5T6JA 4NXME 2EPRA 4DR6E 2RTXA 1G2FC 2HGHA 4R2PA 1XNQE 2EJ4A 2G7HA 5AC4A 2DSYA 3C4TA 4RHBB 2F4VE 2LTRA 2YSOA 3BIDA 5A6BA 2A25A 2EM7A 3L00A 4R8OA 3T1HE 1T4NA 4I8OA 1HNXE 2BBGA 1SR9A 4LFCE 4B3TE 2DB2A 2H36X 2JPAA 2EE8A 2GPIA 4JI2E 2EMLA 1T39A 2IHR1
chains in the Genus database with same CATH topology
2RSIA 2EMFA 4FK5C 2EN3A 2MKNA 1F2IG 2EN4A 2YTDA 1YUJA 2LT7A 2YTJA 1ZU1A 2EOFA 4R2RA 2YTGA 2YSPA 5KL5A 2BB8A 2ENHA 2EM0A 2EPZA 2EPPA 1A1GA 3UK3C 1X5WA 4R2EA 2EMIA 5KL2A 4WSGA 3EPJA 3VHTB 2EPUA 4R2SA 2YRMA 2EMHA 2EOZA 2EORA 2ELYA 2LV2A 2EOXA 2EMZA 2EOHA 2J7JA 4R2QA 2EN7A 1RMDA 1WJPA 4R2AA 2DGCA 3EPHA 1NCSA 1BBOA 3EPKA 1JK2A 2DMIA 2E72A 2EMAA 2LVHA 1UN6B 2GHFA 1YUIA 2EMBA 1MEYC 2EQ3A 5KL4A 1X3CA 1A1JA 2YRKA 1BB8A 3MHHC 2YTQA 3M99B 2EMWA 1A1IA 2ENCA 4M9VC 1B69A 2R1FA 2DLQA 4IJDA 4IS1C 2EM4A 2YTFA 1ZAAC 4R2CA 2JP9A 2EPXA 2GLIA 2YTIA 2YU8A 2WCC3 2RPCA 2WBUA 2CSHA 2EQ0A 1DGCA 2ELZA 2CTDA 1LLMC 2EM9A 2EMKA 2EL5A 2EN2A 3MHSC 2EOJA 1G2DC 1KJKA 2MKDA 2DRPA 2EOIA 2ADRA 1TF6A 2EM6A 2WBTA 2EP3A 2EL6A 1Z1BA 2D9HA 4X9JA 2M9AA 1X6HA 2LO3A 2YTEA 2YTPA 2EPAA 2WBSA 1TN9A 1TF3A 2EM2A 2ENAA 5KL3A 2YRHA 4F6NA 2EM3A 2EOOA 2I13A 4F2JC 2YU5A 1JK1A 1X6FA 2EMXA 4GZNC 1AAYA 2EPCA 2VRDA 2EOEA 2EOSA 2EPRA 2LCEA 1P47A 2HGHA 1G2FC 2PRTA 2EM5A 2EM8A 4R2PA 2EJ4A 2EOYA 2EOQA 5KL7A 2CT1A 1A1HA 2EN6A 2DLKA 2EL4A 2EMCA 2YSOA 3EPLA 1A1FA 5KL6A 2EN1A 2A25A 2EM7A 2MDGA 2EMGA 2YTOA 4F6MA 2YTNA 1ZR9A 2EOMA 1A1KA 2EQ1A 1X6EA 1A1LA 2EMYA 1YSAC 2NABA 2JPAA 2EE8A 2EN8A 1UBDC 2EMLA 4R2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RSI A;  2EMF A;  4FK5 C;  2EN3 A;  2MKN A;  1F2I G;  2EN4 A;  2YTD A;  1YUJ A;  2LT7 A;  2YTJ A;  1ZU1 A;  2EOF A;  4R2R A;  2YTG A;  2YSP A;  5KL5 A;  2BB8 A;  2ENH A;  2EM0 A;  2EPZ A;  2EPP A;  1A1G A;  3UK3 C;  1X5W A;  4R2E A;  2EMI A;  5KL2 A;  4WSG A;  3EPJ A;  3VHT B;  2EPU A;  4R2S A;  2YRM A;  2EMH A;  2EOZ A;  2EOR A;  2ELY A;  2LV2 A;  2EOX A;  2EMZ A;  2EOH A;  2J7J A;  4R2Q A;  2EN7 A;  1RMD A;  1WJP A;  4R2A A;  2DGC A;  3EPH A;  1NCS A;  1BBO A;  3EPK A;  1JK2 A;  2DMI A;  2E72 A;  2EMA A;  2LVH A;  1UN6 B;  2GHF A;  1YUI A;  2EMB A;  1MEY C;  2EQ3 A;  5KL4 A;  1X3C A;  1A1J A;  2YRK A;  1BB8 A;  3MHH C;  2YTQ A;  3M99 B;  2EMW A;  1A1I A;  2ENC A;  4M9V C;  1B69 A;  2R1F A;  2DLQ A;  4IJD A;  4IS1 C;  2EM4 A;  2YTF A;  1ZAA C;  4R2C A;  2JP9 A;  2EPX A;  2GLI A;  2YTI A;  2YU8 A;  2WCC 3;  2RPC A;  2WBU A;  2CSH A;  2EQ0 A;  1DGC A;  2ELZ A;  2CTD A;  1LLM C;  2EM9 A;  2EMK A;  2EL5 A;  2EN2 A;  3MHS C;  2EOJ A;  1G2D C;  1KJK A;  2MKD A;  2DRP A;  2EOI A;  2ADR A;  1TF6 A;  2EM6 A;  2WBT A;  2EP3 A;  2EL6 A;  1Z1B A;  2D9H A;  4X9J A;  2M9A A;  1X6H A;  2LO3 A;  2YTE A;  2YTP A;  2EPA A;  2WBS A;  1TN9 A;  1TF3 A;  2EM2 A;  2ENA A;  5KL3 A;  2YRH A;  4F6N A;  2EM3 A;  2EOO A;  2I13 A;  4F2J C;  2YU5 A;  1JK1 A;  1X6F A;  2EMX A;  4GZN C;  1AAY A;  2EPC A;  2VRD A;  2EOE A;  2EOS A;  2EPR A;  2LCE A;  1P47 A;  2HGH A;  1G2F C;  2PRT A;  2EM5 A;  2EM8 A;  4R2P A;  2EJ4 A;  2EOY A;  2EOQ A;  5KL7 A;  2CT1 A;  1A1H A;  2EN6 A;  2DLK A;  2EL4 A;  2EMC A;  2YSO A;  3EPL A;  1A1F A;  5KL6 A;  2EN1 A;  2A25 A;  2EM7 A;  2MDG A;  2EMG A;  2YTO A;  4F6M A;  2YTN A;  1ZR9 A;  2EOM A;  1A1K A;  2EQ1 A;  1X6E A;  1A1L A;  2EMY A;  1YSA C;  2NAB A;  2JPA A;  2EE8 A;  2EN8 A;  1UBD C;  2EML A;  4R2D A; 
#chains in the Genus database with same CATH topology
 1IQS A;  2EN4 A;  4DV6 E;  2YTJ A;  4LF4 E;  3TQM A;  2HJJ A;  4DV2 E;  2EPM X;  1N3G A;  3UK3 C;  1X5W A;  4HTG A;  4WFT A;  4BC7 A;  2EMI A;  4OOG C;  2YPN A;  5KL2 A;  3EPJ A;  4NHR A;  4AQY E;  2YRM A;  1YZ9 A;  2VE7 C;  2ELY A;  2NUE A;  3LLH A;  4ZYE A;  4BHB A;  4DMI A;  3BF2 A;  1WHQ A;  1WJP A;  4R2A A;  2LUQ A;  3EPH A;  1NCS A;  2DMI A;  2DIX A;  1YUI A;  1MEY C;  2EQ3 A;  5KL4 A;  1BB8 A;  2UXC E;  4R03 A;  2JR1 A;  4TUI A;  1PJQ A;  4B3R E;  2KOU A;  3RMP A;  1XNR E;  3JAM C;  2YTF A;  4DR2 E;  3DJW A;  4DV4 E;  3F6H A;  2EPX A;  2YU8 A;  1BBG A;  5ADZ A;  4BC9 A;  2CSH A;  1DGC A;  4LFB E;  4WXC A;  4DUY E;  5A6K A;  5LMN E;  2EL5 A;  4KZS A;  4MLQ A;  5LL6 R;  3C4B A;  4JI0 E;  5IV8 B;  2EM6 A;  5A2Q C;  2ODR C;  4X65 E;  2EL6 A;  2Q8U A;  3AV0 A;  4DR7 E;  4KHP E;  2L8T A;  2YTP A;  2LO3 A;  3F6G A;  2EM2 A;  5KL3 A;  2MC6 A;  1EH6 A;  2UUB E;  2VRD A;  2EOS A;  1P47 A;  2PRT A;  2LMZ A;  1N32 E;  5AE2 A;  4RH8 A;  4N4R B;  1A1H A;  1PKP A;  3MSW A;  2EWL A;  2RSM A;  1HNZ E;  2EN1 A;  4Q28 A;  2MDG A;  2KHX A;  4WPY A;  5AE3 A;  3KZY A;  4F6M A;  3HTX A;  2EPO A;  2LTS A;  4YHH E;  2EMY A;  2NAB A;  2N3H A;  2LE2 A;  2MC5 A;  1UBD C;  4JI7 E;  4R2D A;  1FJG E;  2B7T A;  2VF1 A;  4KWY A;  2EN3 A;  2MKN A;  4LF6 E;  1J26 A;  3IWC A;  2R76 A;  5AC5 A;  2LT7 A;  2FV4 B;  3P1X A;  4ZYH A;  5BR8 E;  4R2R A;  2YSP A;  2M4I A;  1DQ3 A;  5F3W A;  2BB8 A;  2ENH A;  2EPP A;  4F9B B;  2JOB A;  4R2E A;  4DR5 E;  2NA2 A;  1XMQ E;  4JI3 E;  3JU0 A;  4R2S A;  4GKJ E;  2LJU A;  2EMZ A;  2J7J A;  3THN A;  4R2Q A;  2EN7 A;  1RMD A;  5AAS A;  2DGC A;  2UUA E;  1X49 A;  3EPK A;  4DUZ E;  1HNW E;  3VK6 A;  1JK2 A;  2E72 A;  2LVH A;  2EMB A;  5DNY A;  1X3C A;  1A1J A;  3IWB A;  3MHH C;  2ZM6 E;  1GTK A;  4DR4 E;  2KON A;  1A1I A;  2ENC A;  3ECR A;  4M9V C;  2R1F A;  3OTO E;  2V86 A;  3AUZ A;  1KYQ A;  2EZ6 A;  2JP9 A;  4DR1 E;  4JI6 E;  1X47 A;  2LUP B;  3C6K A;  2YTI A;  3ADL A;  1DI2 A;  4LF7 E;  2UU9 E;  2ELZ A;  2CTD A;  2EMK A;  5IXM B;  2EN2 A;  4X62 E;  2EOJ A;  1X48 A;  1G2D C;  4BS9 A;  1XMO E;  2K7I A;  2ADR A;  3KWR A;  3ZOQ B;  4DV7 E;  2EP3 A;  4TUG A;  2JWO A;  1Z1B A;  2RS7 A;  2M9A A;  3J7Y p;  1IBL E;  2UXB E;  2EPA A;  3J81 C;  2WBS A;  1NEI A;  2M7Q A;  2RQL A;  3OML A;  4F6N A;  2V89 A;  2I13 A;  4F2J C;  5AE1 A;  1JK1 A;  4GZN C;  2EPC A;  4WYQ B;  2B7V A;  4DV0 E;  2JYA A;  2EM8 A;  2HC5 A;  2EOY A;  2FTX B;  2EOQ A;  1WHN A;  2V88 A;  4O43 A;  2CT1 A;  2DLK A;  5A6A A;  5KL6 A;  3VYX A;  4DV1 E;  2EMG A;  1ZR9 A;  1L4S A;  4ZYG A;  2V8Q B;  5FLX C;  4WSP A;  1PDA A;  3LML A;  2EMF A;  4FK5 C;  2V83 A;  4B3S E;  4M30 A;  4K0K E;  4P78 A;  2YTG A;  2L3C A;  4WXD A;  4O4K A;  2EPZ A;  4YY3 E;  1A1G A;  2I9I A;  1UIL A;  2M1S A;  3KZZ A;  4M2Z A;  1O0W A;  5LMU E;  2N3G A;  2YWQ A;  4NXN E;  2EMH A;  2EOZ A;  2E1M A;  2VQF E;  2LV2 A;  2JY9 A;  4ZYD A;  3EQ1 A;  5IWA E;  4J8Z A;  2LJH A;  4WX9 A;  3VYY A;  2EMA A;  1UN6 B;  2GHF A;  3BGH A;  1RQ0 A;  2YRK A;  3M99 B;  4M0V A;  1QU6 A;  1B69 A;  4IJD A;  3DF6 A;  4DV5 E;  4GEQ B;  2WZO A;  2RS6 A;  1YYW A;  4BCA A;  4O5G A;  3J7A G;  4DKK A;  2LBS B;  1RC7 A;  2RPC A;  2WBU A;  3HQ1 A;  1GZ6 A;  5A6J A;  1LLM C;  2EM9 A;  2L92 A;  3MHS C;  4BHC A;  4BMJ A;  4HEI A;  2EPN A;  1YFH A;  4JI5 E;  2MKD A;  1KJK A;  1TF6 A;  2WBT A;  3ADI A;  4L8N A;  3J80 C;  2D9H A;  2L6M A;  4X9J A;  1PJS A;  4MLV A;  2YTE A;  4LFA E;  1TF3 A;  2YRH A;  4LTY A;  2K4V A;  2EM3 A;  2EOO A;  2YU5 A;  1T38 A;  1X6F A;  5CFF E;  4B3M E;  2EOE A;  2LCE A;  1IBM E;  5IT9 C;  2EM5 A;  2UXD E;  2B9D A;  4JYA E;  5KL7 A;  3BBG A;  3FIG A;  1MGT A;  1I94 E;  2EN6 A;  1WRJ A;  2EL4 A;  2EMC A;  3EPL A;  2VQE E;  1A1F A;  1YYO A;  3K6Q A;  3ADJ A;  2YTN A;  5TSE A;  2JVA A;  2EOM A;  1IMU A;  4LF8 E;  1A1K A;  2EQ1 A;  1X6E A;  2YT4 A;  1EH7 A;  1SFE A;  3H09 A;  1A1L A;  1YPN A;  4NZV A;  4JI8 E;  1YSA C;  2NUG A;  3HPS A;  2YZT A;  2EN8 A;  2YTO A;  4F9A B;  1IBK E;  2RSI A;  2B3T B;  4F54 A;  2DMY A;  1F2I G;  4JV5 E;  1N34 E;  4JI4 E;  2YTD A;  1YUJ A;  2L2N A;  3T1Y E;  1ZU1 A;  1EH8 A;  2EOF A;  2UUC E;  1N33 E;  5KL5 A;  2FGG A;  1GQE A;  1WXR A;  2EM0 A;  5LLQ A;  4Q35 B;  3HPZ A;  4BBY A;  4X64 E;  4WSG A;  2ODR D;  1J5E E;  4LF5 E;  3VHT B;  1PJT A;  2EPU A;  3HXL A;  2NUF A;  3ADG A;  2EOR A;  2F8B A;  1QNT A;  1ZBT A;  4X8W A;  2EOX A;  2L2K B;  2EOH A;  4DR3 E;  1BBO A;  1ZBQ A;  3QG5 C;  2CPN A;  2HHH E;  2JOX A;  1STU A;  4OX9 E;  4GKK E;  2YTQ A;  4X66 E;  3THO B;  2EMW A;  2DLQ A;  3IWD A;  2L2M A;  4IS1 C;  1YYK A;  2EM4 A;  2L33 A;  2MDR A;  1ZAA C;  4R2C A;  1IQO A;  4O24 A;  5A69 A;  1UHZ A;  5A6B D;  1HR0 E;  2GLI A;  2WCC 3;  2E5L E;  2EQ0 A;  1N36 E;  2EPK X;  4F9C B;  1T4L B;  2EPL X;  4L5N C;  3JTZ A;  2V85 A;  2V87 A;  2DRP A;  2EOI A;  4P7D A;  1T4O A;  2N8X A;  2L3J A;  2LRS A;  1X6H A;  4LU9 A;  1TN9 A;  3C6M A;  2JXP A;  2ENA A;  1EKZ A;  1FKA E;  4LF9 E;  1AH5 A;  2EMX A;  4DV3 E;  4JI1 E;  1AAY A;  5T6J A;  4NXM E;  2EPR A;  4DR6 E;  2RTX A;  1G2F C;  2HGH A;  4R2P A;  1XNQ E;  2EJ4 A;  2G7H A;  5AC4 A;  2DSY A;  3C4T A;  4RHB B;  2F4V E;  2LTR A;  2YSO A;  3BID A;  5A6B A;  2A25 A;  2EM7 A;  3L00 A;  4R8O A;  3T1H E;  1T4N A;  4I8O A;  1HNX E;  2BBG A;  1SR9 A;  4LFC E;  4B3T E;  2DB2 A;  2H36 X;  2JPA A;  2EE8 A;  2GPI A;  4JI2 E;  2EML A;  1T39 A;  2IHR 1; 
#chains in the Genus database with same CATH homology
 2RSI A;  2EMF A;  4FK5 C;  2EN3 A;  2MKN A;  1F2I G;  2EN4 A;  2YTD A;  1YUJ A;  2LT7 A;  2YTJ A;  1ZU1 A;  2EOF A;  4R2R A;  2YTG A;  2YSP A;  5KL5 A;  2BB8 A;  2ENH A;  2EM0 A;  2EPZ A;  2EPP A;  1A1G A;  3UK3 C;  1X5W A;  4R2E A;  2EMI A;  5KL2 A;  4WSG A;  3EPJ A;  3VHT B;  2EPU A;  4R2S A;  2YRM A;  2EMH A;  2EOZ A;  2EOR A;  2ELY A;  2LV2 A;  2EOX A;  2EMZ A;  2EOH A;  2J7J A;  4R2Q A;  2EN7 A;  1RMD A;  1WJP A;  4R2A A;  2DGC A;  3EPH A;  1NCS A;  1BBO A;  3EPK A;  1JK2 A;  2DMI A;  2E72 A;  2EMA A;  2LVH A;  1UN6 B;  2GHF A;  1YUI A;  2EMB A;  1MEY C;  2EQ3 A;  5KL4 A;  1X3C A;  1A1J A;  2YRK A;  1BB8 A;  3MHH C;  2YTQ A;  3M99 B;  2EMW A;  1A1I A;  2ENC A;  4M9V C;  1B69 A;  2R1F A;  2DLQ A;  4IJD A;  4IS1 C;  2EM4 A;  2YTF A;  1ZAA C;  4R2C A;  2JP9 A;  2EPX A;  2GLI A;  2YTI A;  2YU8 A;  2WCC 3;  2RPC A;  2WBU A;  2CSH A;  2EQ0 A;  1DGC A;  2ELZ A;  2CTD A;  1LLM C;  2EM9 A;  2EMK A;  2EL5 A;  2EN2 A;  3MHS C;  2EOJ A;  1G2D C;  1KJK A;  2MKD A;  2DRP A;  2EOI A;  2ADR A;  1TF6 A;  2EM6 A;  2WBT A;  2EP3 A;  2EL6 A;  1Z1B A;  2D9H A;  4X9J A;  2M9A A;  1X6H A;  2LO3 A;  2YTE A;  2YTP A;  2EPA A;  2WBS A;  1TN9 A;  1TF3 A;  2EM2 A;  2ENA A;  5KL3 A;  2YRH A;  4F6N A;  2EM3 A;  2EOO A;  2I13 A;  4F2J C;  2YU5 A;  1JK1 A;  1X6F A;  2EMX A;  4GZN C;  1AAY A;  2EPC A;  2VRD A;  2EOE A;  2EOS A;  2EPR A;  2LCE A;  1P47 A;  2HGH A;  1G2F C;  2PRT A;  2EM5 A;  2EM8 A;  4R2P A;  2EJ4 A;  2EOY A;  2EOQ A;  5KL7 A;  2CT1 A;  1A1H A;  2EN6 A;  2DLK A;  2EL4 A;  2EMC A;  2YSO A;  3EPL A;  1A1F A;  5KL6 A;  2EN1 A;  2A25 A;  2EM7 A;  2MDG A;  2EMG A;  2YTO A;  4F6M A;  2YTN A;  1ZR9 A;  2EOM A;  1A1K A;  2EQ1 A;  1X6E A;  1A1L A;  2EMY A;  1YSA C;  2NAB A;  2JPA A;  2EE8 A;  2EN8 A;  1UBD C;  2EML A;  4R2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...