1IQSA

Minimized average structure of mth1880 from methanobacterium thermoautotrophicum
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
88
structure length
88
Chain Sequence
LFIATLKGIFTLKDLPEEFRPFVDYKAGLEKKKLSDDDEIAIISIKGTQSNHVLFLSSYNSVDEIRKELEEAGAKINHTTLKILEGHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords MTH1880
publication title Solution structure of a novel calcium binding protein, MTH1880, from Methanobacterium thermoautotrophicum.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 13
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2001-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05370 DUF749 Domain of unknown function (DUF749)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.120 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Hypothetical protein MTH1880 1iqsA00
1IQOA 1IQSA
chains in the Genus database with same CATH superfamily
4RHBB 2EP3A 4R2QA 1UBDC 2HC5A 1HNWE 2GPIA 3ADIA 4DR6E 1X6FA 4X66E 1N3GA 2EMGA 1BBOA 4ZYHA 2VQFE 4WFTA 4BHBA 3RMPA 2YTOA 1BBGA 2E72A 4LF5E 2VRDA 2JP9A 3EPHA 1IQOA 1A1IA 4K0KE 2EL5A 2J7JA 2N3HA 4DR2E 1DGCA 2EPAA 4O5GA 1L4SA 4JI0E 3MHHC 4YHHE 5AE1A 4LF9E 2YTEA 2YTPA 4JV5E 1N33E 1UHZA 3JAMC 1B69A 4NHRA 3EQ1A 4HTGA 2A25A 2B3TB 1UILA 4DUZE 5KL3A 2EPPA 2DGCA 2DRPA 4O43A 4M30A 5A6AA 1ZAAC 2NUEA 2YWQA 4LF8E 1MEYC 4BC9A 1SR9A 2EWLA 1KYQA 2EMCA 1ZBQA 2EOYA 4WSPA 3ZOQB 3ADLA 2R76A 4X64E 2EMXA 3BIDA 2L6MA 2EOXA 5FLXC 5A6JA 2YU8A 5BR8E 2D9HA 2HGHA 1X47A 2L3CA 4N4RB 3T1YE 2RQLA 2EMAA 2WBUA 1JK2A 3EPJA 1IBLE 2EOZA 3DJWA 5AASA 2YSOA 4R2SA 2YU5A 2JOBA 2MKNA 4DR5E 3BBGA 5KL5A 2LVHA 2EOIA 4DV6E 1FKAE 1UN6B 3LLHA 3HTXA 2ELZA 4BC7A 2L3JA 2EQ0A 5A2QC 1WHQA 3QG5C 4BS9A 2EM2A 3THOB 4X65E 3TQMA 4AQYE 1X49A 2M1SA 3C4TA 1PJSA 2EQ3A 2YSPA 2N3GA 4NZVA 1RQ0A 4P7DA 2YTJA 2UUAE 2CT1A 4BHCA 2RPCA 1A1GA 1T38A 2EQ1A 2EN4A 2EMBA 2ODRD 2JOXA 2LTSA 2B7VA 2EOFA 2WBSA 4BCAA 1IMUA 2RTXA 3MHSC 1YYWA 2EPRA 1NEIA 5T6JA 4GEQB 3VYXA 2HJJA 1YPNA 3OMLA 1GQEA 1X3CA 4TUGA 2Q8UA 2I9IA 3FIGA 2LV2A 2YRMA 1PJTA 2EPZA 2YT4A 4LTYA 2UUBE 4F9CB 3J81C 1ZBTA 1EH6A 2EOQA 4MLVA 4IS1C 4LFBE 2RSMA 1T39A 1RMDA 2ENHA 2DMYA 2YTIA 2LUPB 2FTXB 3ADGA 3ADJA 4JI8E 1YUJA 1T4LB 3K6QA 5KL4A 4DV7E 2LE2A 4R2EA 2RS7A 5A6KA 1YUIA 1YZ9A 1BB8A 1EKZA 2M7QA 5A69A 2UXBE 2CSHA 2V88A 1KJKA 2UXDE 2EOJA 1G2FC 2YPNA 4BBYA 2WBTA 2WZOA 4B3ME 2EMLA 4WYQB 2NUFA 1YYKA 1AAYA 2ADRA 2EM5A 4DV3E 1XNQE 1O0WA 2BB8A 2EMHA 4BMJA 5KL2A 1AH5A 2E5LE 2EN8A 2JWOA 2EMYA 2JPAA 2FV4B 4LFCE 2EM0A 4P78A 2YZTA 1LLMC 2EZ6A 2BBGA 2LTRA 5LMUE 4M0VA 1EH8A 2B7TA 4F6MA 1P47A 2EN7A 2EPUA 3VHTB 4M9VC 5AC4A 2EMZA 1GTKA 1PJQA 4R03A 3DF6A 2MDGA 2K7IA 4X9JA 4L5NC 4R2RA 5LL6R 2EL6A 4M2ZA 5IWAE 5IT9C 2KOUA 4JI3E 2EPOA 2MKDA 4R2PA 5A6BA 4TUIA 3T1HE 3M99B 2I13A 4WXDA 1X6EA 3H09A 4KZSA 3F6GA 2ZM6E 2ELYA 2EJ4A 1STUA 4RH8A 5CFFE 4DUYE 1DI2A 5IV8B 4JI2E 3UK3C 1TF3A 2JVAA 2F8BA 4ZYDA 3AUZA 5TSEA 2EMKA 4DMIA 5A6BD 4X62E 2JYAA 4B3TE 4WXCA 5IXMB 4JI1E 2V8QB 2HHHE 4DV0E 4DR1E 2EPCA 5KL7A 1TN9A 2E1MA 2EN3A 1G2DC 2KHXA 4MLQA 2EE8A 2YTGA 2RSIA 3J80C 1Z1BA 4R8OA 4WPYA 5F3WA 1N36E 1FJGE 2YTNA 1PKPA 4WSGA 1A1JA 1DQ3A 4LF7E 3HPSA 4DR4E 1NCSA 2EM9A 3ECRA 4L8NA 2NUGA 1HR0E 4HEIA 2EM4A 2EOHA 4JI7E 2LBSB 1T4NA 2VQEE 1MGTA 1XMQE 4WX9A 4GKKE 2JR1A 2G7HA 3OTOE 1A1HA 1X6HA 2DMIA 4O4KA 2R1FA 2EOOA 2GLIA 3IWBA 2ENCA 3MSWA 1YYOA 2LUQA 2N8XA 4JI5E 1ZR9A 3J7AG 1A1FA 4R2AA 2LJUA 2FGGA 4J8ZA 3C6MA 5LMNE 1A1KA 4DV5E 2V86A 2YRHA 1PDAA 2LT7A 1T4OA 2CTDA 4DV1E 3C6KA 2EPMX 3F6HA 2V87A 1ZU1A 1EH7A 3THNA 3JU0A 1XNRE 5AE2A 2ODRC 2EM8A 3EPKA 4DR7E 1A1LA 2EPNA 5DNYA 4O24A 4LFAE 5ADZA 4F9BB 4R2DA 4LF4E 2CPNA 2YTFA 4I8OA 2M9AA 2GHFA 2M4IA 4Q35B 4DKKA 2EORA 2DB2A 1IBME 2LCEA 4NXME 4NXNE 3IWDA 2LO3A 2DIXA 1IBKE 2VF1A 1IQSA 2L33A 3J7Yp 1F2IG 2IHR1 3P1XA 3KWRA 3IWCA 4DR3E 2L2MA 3LMLA 4GKJE 2WCC3 2EM3A 1I94E 2H36X 3JTZA 4DV2E 1QU6A 1N32E 1WXRA 1J26A 3BGHA 3HQ1A 2EL4A 2L92A 4F2JC 2MC6A 2EN1A 4IJDA 2L2KB 1X5WA 2EM7A 4X8WA 2EOSA 1XMOE 4B3RE 2UUCE 2EOEA 3KZZA 1WRJA 4YY3E 2MDRA 3VK6A 1HNXE 3AV0A 2EMWA 4FK5C 2EPXA 4B3SE 1TF6A 2KONA 2DSYA 4F9AB 2V85A 3EPLA 4LU9A 2DLKA 4JYAE 4JI6E 2EPLX 4JI4E 2EMFA 3VYYA 2LMZA 1HNZE 4F6NA 2UU9E 1WHNA 2DLQA 2L8TA 2NA2A 2JXPA 3BF2A 4R2CA 1RC7A 2PRTA 2EM6A 2B9DA 5AC5A 3HPZA 1YFHA 4Q28A 2LRSA 2JY9A 2YTDA 4DV4E 2YTQA 4F54A 1N34E 4KWYA 4LF6E 1QNTA 2RS6A 1J5EE 4KHPE 1X48A 3KZYA 3L00A 5KL6A 2EN6A 2EPKX 2K4VA 2LJHA 1GZ6A 2EMIA 4ZYEA 2ENAA 3C4BA 2NABA 4GZNC 2L2NA 2YRKA 2V83A 1SFEA 2UXCE 2MC5A 5AE3A 2VE7C 1WJPA 2F4VE 4OX9E 2EN2A 2V89A 4ZYGA 1JK1A 1YSAC 4OOGC 5LLQA 2EOMA 3HXLA
chains in the Genus database with same CATH topology
1IQOA 1IQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IQO A;  1IQS A; 
#chains in the Genus database with same CATH topology
 4RHB B;  2EP3 A;  4R2Q A;  1UBD C;  2HC5 A;  1HNW E;  2GPI A;  3ADI A;  4DR6 E;  1X6F A;  4X66 E;  1N3G A;  2EMG A;  1BBO A;  4ZYH A;  2VQF E;  4WFT A;  4BHB A;  3RMP A;  2YTO A;  1BBG A;  2E72 A;  4LF5 E;  2VRD A;  2JP9 A;  3EPH A;  1IQO A;  1A1I A;  4K0K E;  2EL5 A;  2J7J A;  2N3H A;  4DR2 E;  1DGC A;  2EPA A;  4O5G A;  1L4S A;  4JI0 E;  3MHH C;  4YHH E;  5AE1 A;  4LF9 E;  2YTE A;  2YTP A;  4JV5 E;  1N33 E;  1UHZ A;  3JAM C;  1B69 A;  4NHR A;  3EQ1 A;  4HTG A;  2A25 A;  2B3T B;  1UIL A;  4DUZ E;  5KL3 A;  2EPP A;  2DGC A;  2DRP A;  4O43 A;  4M30 A;  5A6A A;  1ZAA C;  2NUE A;  2YWQ A;  4LF8 E;  1MEY C;  4BC9 A;  1SR9 A;  2EWL A;  1KYQ A;  2EMC A;  1ZBQ A;  2EOY A;  4WSP A;  3ZOQ B;  3ADL A;  2R76 A;  4X64 E;  2EMX A;  3BID A;  2L6M A;  2EOX A;  5FLX C;  5A6J A;  2YU8 A;  5BR8 E;  2D9H A;  2HGH A;  1X47 A;  2L3C A;  4N4R B;  3T1Y E;  2RQL A;  2EMA A;  2WBU A;  1JK2 A;  3EPJ A;  1IBL E;  2EOZ A;  3DJW A;  5AAS A;  2YSO A;  4R2S A;  2YU5 A;  2JOB A;  2MKN A;  4DR5 E;  3BBG A;  5KL5 A;  2LVH A;  2EOI A;  4DV6 E;  1FKA E;  1UN6 B;  3LLH A;  3HTX A;  2ELZ A;  4BC7 A;  2L3J A;  2EQ0 A;  5A2Q C;  1WHQ A;  3QG5 C;  4BS9 A;  2EM2 A;  3THO B;  4X65 E;  3TQM A;  4AQY E;  1X49 A;  2M1S A;  3C4T A;  1PJS A;  2EQ3 A;  2YSP A;  2N3G A;  4NZV A;  1RQ0 A;  4P7D A;  2YTJ A;  2UUA E;  2CT1 A;  4BHC A;  2RPC A;  1A1G A;  1T38 A;  2EQ1 A;  2EN4 A;  2EMB A;  2ODR D;  2JOX A;  2LTS A;  2B7V A;  2EOF A;  2WBS A;  4BCA A;  1IMU A;  2RTX A;  3MHS C;  1YYW A;  2EPR A;  1NEI A;  5T6J A;  4GEQ B;  3VYX A;  2HJJ A;  1YPN A;  3OML A;  1GQE A;  1X3C A;  4TUG A;  2Q8U A;  2I9I A;  3FIG A;  2LV2 A;  2YRM A;  1PJT A;  2EPZ A;  2YT4 A;  4LTY A;  2UUB E;  4F9C B;  3J81 C;  1ZBT A;  1EH6 A;  2EOQ A;  4MLV A;  4IS1 C;  4LFB E;  2RSM A;  1T39 A;  1RMD A;  2ENH A;  2DMY A;  2YTI A;  2LUP B;  2FTX B;  3ADG A;  3ADJ A;  4JI8 E;  1YUJ A;  1T4L B;  3K6Q A;  5KL4 A;  4DV7 E;  2LE2 A;  4R2E A;  2RS7 A;  5A6K A;  1YUI A;  1YZ9 A;  1BB8 A;  1EKZ A;  2M7Q A;  5A69 A;  2UXB E;  2CSH A;  2V88 A;  1KJK A;  2UXD E;  2EOJ A;  1G2F C;  2YPN A;  4BBY A;  2WBT A;  2WZO A;  4B3M E;  2EML A;  4WYQ B;  2NUF A;  1YYK A;  1AAY A;  2ADR A;  2EM5 A;  4DV3 E;  1XNQ E;  1O0W A;  2BB8 A;  2EMH A;  4BMJ A;  5KL2 A;  1AH5 A;  2E5L E;  2EN8 A;  2JWO A;  2EMY A;  2JPA A;  2FV4 B;  4LFC E;  2EM0 A;  4P78 A;  2YZT A;  1LLM C;  2EZ6 A;  2BBG A;  2LTR A;  5LMU E;  4M0V A;  1EH8 A;  2B7T A;  4F6M A;  1P47 A;  2EN7 A;  2EPU A;  3VHT B;  4M9V C;  5AC4 A;  2EMZ A;  1GTK A;  1PJQ A;  4R03 A;  3DF6 A;  2MDG A;  2K7I A;  4X9J A;  4L5N C;  4R2R A;  5LL6 R;  2EL6 A;  4M2Z A;  5IWA E;  5IT9 C;  2KOU A;  4JI3 E;  2EPO A;  2MKD A;  4R2P A;  5A6B A;  4TUI A;  3T1H E;  3M99 B;  2I13 A;  4WXD A;  1X6E A;  3H09 A;  4KZS A;  3F6G A;  2ZM6 E;  2ELY A;  2EJ4 A;  1STU A;  4RH8 A;  5CFF E;  4DUY E;  1DI2 A;  5IV8 B;  4JI2 E;  3UK3 C;  1TF3 A;  2JVA A;  2F8B A;  4ZYD A;  3AUZ A;  5TSE A;  2EMK A;  4DMI A;  5A6B D;  4X62 E;  2JYA A;  4B3T E;  4WXC A;  5IXM B;  4JI1 E;  2V8Q B;  2HHH E;  4DV0 E;  4DR1 E;  2EPC A;  5KL7 A;  1TN9 A;  2E1M A;  2EN3 A;  1G2D C;  2KHX A;  4MLQ A;  2EE8 A;  2YTG A;  2RSI A;  3J80 C;  1Z1B A;  4R8O A;  4WPY A;  5F3W A;  1N36 E;  1FJG E;  2YTN A;  1PKP A;  4WSG A;  1A1J A;  1DQ3 A;  4LF7 E;  3HPS A;  4DR4 E;  1NCS A;  2EM9 A;  3ECR A;  4L8N A;  2NUG A;  1HR0 E;  4HEI A;  2EM4 A;  2EOH A;  4JI7 E;  2LBS B;  1T4N A;  2VQE E;  1MGT A;  1XMQ E;  4WX9 A;  4GKK E;  2JR1 A;  2G7H A;  3OTO E;  1A1H A;  1X6H A;  2DMI A;  4O4K A;  2R1F A;  2EOO A;  2GLI A;  3IWB A;  2ENC A;  3MSW A;  1YYO A;  2LUQ A;  2N8X A;  4JI5 E;  1ZR9 A;  3J7A G;  1A1F A;  4R2A A;  2LJU A;  2FGG A;  4J8Z A;  3C6M A;  5LMN E;  1A1K A;  4DV5 E;  2V86 A;  2YRH A;  1PDA A;  2LT7 A;  1T4O A;  2CTD A;  4DV1 E;  3C6K A;  2EPM X;  3F6H A;  2V87 A;  1ZU1 A;  1EH7 A;  3THN A;  3JU0 A;  1XNR E;  5AE2 A;  2ODR C;  2EM8 A;  3EPK A;  4DR7 E;  1A1L A;  2EPN A;  5DNY A;  4O24 A;  4LFA E;  5ADZ A;  4F9B B;  4R2D A;  4LF4 E;  2CPN A;  2YTF A;  4I8O A;  2M9A A;  2GHF A;  2M4I A;  4Q35 B;  4DKK A;  2EOR A;  2DB2 A;  1IBM E;  2LCE A;  4NXM E;  4NXN E;  3IWD A;  2LO3 A;  2DIX A;  1IBK E;  2VF1 A;  1IQS A;  2L33 A;  3J7Y p;  1F2I G;  2IHR 1;  3P1X A;  3KWR A;  3IWC A;  4DR3 E;  2L2M A;  3LML A;  4GKJ E;  2WCC 3;  2EM3 A;  1I94 E;  2H36 X;  3JTZ A;  4DV2 E;  1QU6 A;  1N32 E;  1WXR A;  1J26 A;  3BGH A;  3HQ1 A;  2EL4 A;  2L92 A;  4F2J C;  2MC6 A;  2EN1 A;  4IJD A;  2L2K B;  1X5W A;  2EM7 A;  4X8W A;  2EOS A;  1XMO E;  4B3R E;  2UUC E;  2EOE A;  3KZZ A;  1WRJ A;  4YY3 E;  2MDR A;  3VK6 A;  1HNX E;  3AV0 A;  2EMW A;  4FK5 C;  2EPX A;  4B3S E;  1TF6 A;  2KON A;  2DSY A;  4F9A B;  2V85 A;  3EPL A;  4LU9 A;  2DLK A;  4JYA E;  4JI6 E;  2EPL X;  4JI4 E;  2EMF A;  3VYY A;  2LMZ A;  1HNZ E;  4F6N A;  2UU9 E;  1WHN A;  2DLQ A;  2L8T A;  2NA2 A;  2JXP A;  3BF2 A;  4R2C A;  1RC7 A;  2PRT A;  2EM6 A;  2B9D A;  5AC5 A;  3HPZ A;  1YFH A;  4Q28 A;  2LRS A;  2JY9 A;  2YTD A;  4DV4 E;  2YTQ A;  4F54 A;  1N34 E;  4KWY A;  4LF6 E;  1QNT A;  2RS6 A;  1J5E E;  4KHP E;  1X48 A;  3KZY A;  3L00 A;  5KL6 A;  2EN6 A;  2EPK X;  2K4V A;  2LJH A;  1GZ6 A;  2EMI A;  4ZYE A;  2ENA A;  3C4B A;  2NAB A;  4GZN C;  2L2N A;  2YRK A;  2V83 A;  1SFE A;  2UXC E;  2MC5 A;  5AE3 A;  2VE7 C;  1WJP A;  2F4V E;  4OX9 E;  2EN2 A;  2V89 A;  4ZYG A;  1JK1 A;  1YSA C;  4OOG C;  5LLQ A;  2EOM A;  3HXL A; 
#chains in the Genus database with same CATH homology
 1IQO A;  1IQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...