1IQSA

Minimized average structure of mth1880 from methanobacterium thermoautotrophicum
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
88
structure length
88
Chain Sequence
LFIATLKGIFTLKDLPEEFRPFVDYKAGLEKKKLSDDDEIAIISIKGTQSNHVLFLSSYNSVDEIRKELEEAGAKINHTTLKILEGHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MTH1880
publication title Solution structure of a novel calcium binding protein, MTH1880, from Methanobacterium thermoautotrophicum.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Metal binding protein
total genus 13
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2001-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05370 DUF749 Domain of unknown function (DUF749)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.120 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Hypothetical protein MTH1880 1iqsA00
1IQOA 1IQSA
chains in the Genus database with same CATH superfamily
4DR7E 2RSMA 2YRKA 4IS1C 2Q8UA 3DF6A 4ZYDA 2EPNA 4DV3E 1RMDA 1HR0E 1HNZE 2F8BA 1YUIA 2R1FA 3HQ1A 5T6JA 2DIXA 1X5WA 2KOUA 4O43A 5A6BD 1F2IG 1PJSA 4DKKA 4BBYA 2NUGA 1IBME 2V88A 2EOQA 4DV4E 4LFAE 3C6MA 1O0WA 2BB8A 2K4VA 5IWAE 5BR8E 3HXLA 2VQFE 2JPAA 1IBKE 2B3TB 4WSPA 2JR1A 3IWBA 1G2FC 1QNTA 1X6EA 2RS7A 4F6NA 4JI8E 3EPJA 3JAMC 2EN4A 2EN6A 1T4LB 5AC5A 2DMIA 2EOHA 4P78A 2J7JA 2JOXA 4M9VC 2DRPA 4GKJE 5A69A 4GZNC 4R2RA 3H09A 2DLKA 1NCSA 4BC9A 5IV8B 4WX9A 4WXDA 4DR1E 4DR2E 1YUJA 5A6JA 1JK2A 2EMIA 2EN1A 2F4VE 2LRSA 2YSOA 3VYYA 2V86A 4O5GA 2N3HA 4R2PA 2JP9A 2K7IA 2YZTA 2LUPB 2EMCA 2EOYA 5TSEA 2L2MA 2LT7A 4WXCA 1AH5A 2EQ1A 4BCAA 2EPZA 2DLQA 2YTEA 2UUAE 3THOB 2YTNA 2EN2A 4JI6E 3DJWA 5A6BA 2YSPA 1EKZA 3IWCA 2JXPA 3UK3C 5A6KA 2EMKA 3EPKA 4DR6E 1IQOA 4NZVA 2DMYA 1X3CA 2ADRA 2NUFA 4LF5E 2LCEA 2YTQA 2UXCE 3ADGA 2EPUA 2GLIA 1WJPA 2M4IA 2L2KB 4LF4E 2DSYA 4F9CB 3LLHA 2YU8A 1X49A 3J7AG 4R8OA 2EM5A 2R76A 1TN9A 1PDAA 3TQMA 4Q28A 2ENAA 2LVHA 4DV7E 1P47A 4LFBE 4O24A 1ZBQA 1LLMC 4AQYE 2EWLA 1Z1BA 2JYAA 2EOZA 3M99B 1ZR9A 4DV0E 2CT1A 2EPAA 2LJUA 2WBUA 1A1IA 5A6AA 4KWYA 4O4KA 4JI7E 1TF3A 2EQ3A 5IT9C 4NXNE 1FKAE 5AE3A 2VF1A 1IBLE 4FK5C 5KL4A 2LBSB 3P1XA 2EL5A 4X62E 4M2ZA 4R2EA 4KZSA 2EOJA 2EM4A 2GPIA 2YRMA 2KHXA 2HGHA 1DGCA 4RH8A 2EMGA 4L8NA 1EH6A 1KJKA 5A2QC 1X6FA 1AAYA 2WZOA 1STUA 5F3WA 1ZU1A 3ZOQB 2ODRC 2RS6A 2YTJA 2V89A 5CFFE 1DI2A 2EMAA 4DUYE 1A1KA 1YSAC 2LV2A 2EM0A 4B3SE 2V85A 1IMUA 2EPOA 1UN6B 3HTXA 4R2DA 4JI4E 4L5NC 4YY3E 1N36E 4F2JC 2RSIA 1GQEA 4BHCA 4BMJA 4R2QA 3L00A 4JI1E 4RHBB 4M0VA 2MC5A 1YYKA 4KHPE 2JWOA 2CTDA 2L3CA 2A25A 3OTOE 2ENHA 4TUIA 2EMYA 2ZM6E 1EH8A 2MDRA 4Q35B 3KWRA 1TF6A 2EOSA 2L33A 2DGCA 3ADLA 3C6KA 2M9AA 4DV2E 3KZZA 5AE1A 1RC7A 1I94E 4X66E 2VQEE 1XMOE 2YTPA 4DR5E 3AV0A 4ZYEA 1T4NA 2EP3A 5AE2A 2EM9A 3MSWA 1EH7A 5LLQA 2YTIA 3JTZA 3ADJA 2CSHA 3EPLA 3ADIA 2EOIA 1X48A 4HTGA 3QG5C 4NHRA 4LF7E 3K6QA 1N32E 2N3GA 3ECRA 1YFHA 1N34E 4HEIA 2B7VA 2ELZA 2E72A 4DUZE 4ZYGA 2V87A 4OOGC 5AASA 2EL4A 1FJGE 1L4SA 3EQ1A 4I8OA 4NXME 4R2SA 4N4RB 2NABA 3MHSC 2LUQA 3T1HE 1GTKA 4R03A 2RQLA 1BB8A 2NUEA 5KL2A 4ZYHA 2EQ0A 4DV6E 2LMZA 2H36X 1YPNA 2E1MA 2LTRA 1NEIA 2NA2A 4K0KE 2EL6A 4LFCE 1J26A 4WPYA 3BBGA 2PRTA 2EMBA 2YTFA 2EM6A 5KL5A 3IWDA 1PJTA 1IQSA 4BS9A 5FLXC 4X9JA 2EM2A 4OX9E 1YYOA 2MC6A 4F6MA 3BF2A 4LF6E 2VE7C 2EN8A 2ELYA 2EM3A 2YT4A 2EMZA 2EN7A 4MLVA 1HNXE 1UILA 4DV5E 3J7Yp 2EMXA 4DR4E 4P7DA 2JVAA 2VRDA 5AC4A 2EOOA 2M7QA 2L2NA 3FIGA 3JU0A 2YTDA 4YHHE 2EMWA 5LMNE 2LJHA 2UUCE 2EPPA 2MKDA 4X64E 4X65E 4LF8E 2MKNA 3LMLA 2DB2A 2EOEA 3MHHC 2YTGA 2EOMA 2JY9A 2N8XA 2RPCA 4JV5E 5KL7A 3OMLA 1A1LA 1UHZA 3BIDA 3HPSA 2I9IA 4JI2E 2EZ6A 5KL6A 4GEQB 1WHQA 1YZ9A 4LU9A 4GKKE 3THNA 2M1SA 1G2DC 2EJ4A 3C4TA 4JI5E 2CPNA 2EPLX 5LMUE 1MEYC 2BBGA 3VK6A 1XNRE 3F6GA 4BHBA 2WBTA 2EE8A 2HC5A 2V83A 2ENCA 1KYQA 4LF9E 4TUGA 1ZAAC 2EMLA 2G7HA 3RMPA 2EPRA 4J8ZA 1B69A 2JOBA 2EPXA 5DNYA 2UXDE 3C4BA 2UXBE 3VYXA 3AUZA 2L92A 2L6MA 4BC7A 2V8QB 3J81C 3VHTB 4R2AA 3EPHA 2LE2A 1WHNA 2RTXA 2MDGA 4B3RE 1XNQE 1HNWE 1PKPA 1XMQE 2HHHE 2LTSA 2D9HA 4JI3E 2WCC3 4DMIA 2LO3A 1YYWA 2UU9E 1GZ6A 2YRHA 1MGTA 2EMFA 1RQ0A 1X47A 2L8TA 4B3TE 2EMHA 2FTXB 1BBOA 3KZYA 4WFTA 4X8WA 2UUBE 1WXRA 2I13A 2EPKX 2EM7A 1ZBTA 1A1JA 1A1GA 5IXMB 3T1YE 1X6HA 4LTYA 5LL6R 1QU6A 2WBSA 3J80C 4JI0E 2ODRD 2YTOA 2FGGA 1T38A 2EORA 2KONA 1UBDC 1N33E 1PJQA 4MLQA 2YU5A 4JYAE 2EOFA 2EPCA 1JK1A 3HPZA 2EN3A 1J5EE 1A1HA 4F9BB 1A1FA 1WRJA 1T4OA 3F6HA 1N3GA 2FV4B 1T39A 1BBGA 2GHFA 1DQ3A 2IHR1 1SFEA 4DV1E 3BGHA 4WYQB 2EM8A 4IJDA 4F9AB 5KL3A 4R2CA 2E5LE 2EOXA 2YPNA 4F54A 2L3JA 4B3ME 2YWQA 2HJJA 4WSGA 4M30A 2B7TA 4DR3E 2EPMX 2B9DA 1SR9A 5ADZA
chains in the Genus database with same CATH topology
1IQOA 1IQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IQO A;  1IQS A; 
#chains in the Genus database with same CATH topology
 4DR7 E;  2RSM A;  2YRK A;  4IS1 C;  2Q8U A;  3DF6 A;  4ZYD A;  2EPN A;  4DV3 E;  1RMD A;  1HR0 E;  1HNZ E;  2F8B A;  1YUI A;  2R1F A;  3HQ1 A;  5T6J A;  2DIX A;  1X5W A;  2KOU A;  4O43 A;  5A6B D;  1F2I G;  1PJS A;  4DKK A;  4BBY A;  2NUG A;  1IBM E;  2V88 A;  2EOQ A;  4DV4 E;  4LFA E;  3C6M A;  1O0W A;  2BB8 A;  2K4V A;  5IWA E;  5BR8 E;  3HXL A;  2VQF E;  2JPA A;  1IBK E;  2B3T B;  4WSP A;  2JR1 A;  3IWB A;  1G2F C;  1QNT A;  1X6E A;  2RS7 A;  4F6N A;  4JI8 E;  3EPJ A;  3JAM C;  2EN4 A;  2EN6 A;  1T4L B;  5AC5 A;  2DMI A;  2EOH A;  4P78 A;  2J7J A;  2JOX A;  4M9V C;  2DRP A;  4GKJ E;  5A69 A;  4GZN C;  4R2R A;  3H09 A;  2DLK A;  1NCS A;  4BC9 A;  5IV8 B;  4WX9 A;  4WXD A;  4DR1 E;  4DR2 E;  1YUJ A;  5A6J A;  1JK2 A;  2EMI A;  2EN1 A;  2F4V E;  2LRS A;  2YSO A;  3VYY A;  2V86 A;  4O5G A;  2N3H A;  4R2P A;  2JP9 A;  2K7I A;  2YZT A;  2LUP B;  2EMC A;  2EOY A;  5TSE A;  2L2M A;  2LT7 A;  4WXC A;  1AH5 A;  2EQ1 A;  4BCA A;  2EPZ A;  2DLQ A;  2YTE A;  2UUA E;  3THO B;  2YTN A;  2EN2 A;  4JI6 E;  3DJW A;  5A6B A;  2YSP A;  1EKZ A;  3IWC A;  2JXP A;  3UK3 C;  5A6K A;  2EMK A;  3EPK A;  4DR6 E;  1IQO A;  4NZV A;  2DMY A;  1X3C A;  2ADR A;  2NUF A;  4LF5 E;  2LCE A;  2YTQ A;  2UXC E;  3ADG A;  2EPU A;  2GLI A;  1WJP A;  2M4I A;  2L2K B;  4LF4 E;  2DSY A;  4F9C B;  3LLH A;  2YU8 A;  1X49 A;  3J7A G;  4R8O A;  2EM5 A;  2R76 A;  1TN9 A;  1PDA A;  3TQM A;  4Q28 A;  2ENA A;  2LVH A;  4DV7 E;  1P47 A;  4LFB E;  4O24 A;  1ZBQ A;  1LLM C;  4AQY E;  2EWL A;  1Z1B A;  2JYA A;  2EOZ A;  3M99 B;  1ZR9 A;  4DV0 E;  2CT1 A;  2EPA A;  2LJU A;  2WBU A;  1A1I A;  5A6A A;  4KWY A;  4O4K A;  4JI7 E;  1TF3 A;  2EQ3 A;  5IT9 C;  4NXN E;  1FKA E;  5AE3 A;  2VF1 A;  1IBL E;  4FK5 C;  5KL4 A;  2LBS B;  3P1X A;  2EL5 A;  4X62 E;  4M2Z A;  4R2E A;  4KZS A;  2EOJ A;  2EM4 A;  2GPI A;  2YRM A;  2KHX A;  2HGH A;  1DGC A;  4RH8 A;  2EMG A;  4L8N A;  1EH6 A;  1KJK A;  5A2Q C;  1X6F A;  1AAY A;  2WZO A;  1STU A;  5F3W A;  1ZU1 A;  3ZOQ B;  2ODR C;  2RS6 A;  2YTJ A;  2V89 A;  5CFF E;  1DI2 A;  2EMA A;  4DUY E;  1A1K A;  1YSA C;  2LV2 A;  2EM0 A;  4B3S E;  2V85 A;  1IMU A;  2EPO A;  1UN6 B;  3HTX A;  4R2D A;  4JI4 E;  4L5N C;  4YY3 E;  1N36 E;  4F2J C;  2RSI A;  1GQE A;  4BHC A;  4BMJ A;  4R2Q A;  3L00 A;  4JI1 E;  4RHB B;  4M0V A;  2MC5 A;  1YYK A;  4KHP E;  2JWO A;  2CTD A;  2L3C A;  2A25 A;  3OTO E;  2ENH A;  4TUI A;  2EMY A;  2ZM6 E;  1EH8 A;  2MDR A;  4Q35 B;  3KWR A;  1TF6 A;  2EOS A;  2L33 A;  2DGC A;  3ADL A;  3C6K A;  2M9A A;  4DV2 E;  3KZZ A;  5AE1 A;  1RC7 A;  1I94 E;  4X66 E;  2VQE E;  1XMO E;  2YTP A;  4DR5 E;  3AV0 A;  4ZYE A;  1T4N A;  2EP3 A;  5AE2 A;  2EM9 A;  3MSW A;  1EH7 A;  5LLQ A;  2YTI A;  3JTZ A;  3ADJ A;  2CSH A;  3EPL A;  3ADI A;  2EOI A;  1X48 A;  4HTG A;  3QG5 C;  4NHR A;  4LF7 E;  3K6Q A;  1N32 E;  2N3G A;  3ECR A;  1YFH A;  1N34 E;  4HEI A;  2B7V A;  2ELZ A;  2E72 A;  4DUZ E;  4ZYG A;  2V87 A;  4OOG C;  5AAS A;  2EL4 A;  1FJG E;  1L4S A;  3EQ1 A;  4I8O A;  4NXM E;  4R2S A;  4N4R B;  2NAB A;  3MHS C;  2LUQ A;  3T1H E;  1GTK A;  4R03 A;  2RQL A;  1BB8 A;  2NUE A;  5KL2 A;  4ZYH A;  2EQ0 A;  4DV6 E;  2LMZ A;  2H36 X;  1YPN A;  2E1M A;  2LTR A;  1NEI A;  2NA2 A;  4K0K E;  2EL6 A;  4LFC E;  1J26 A;  4WPY A;  3BBG A;  2PRT A;  2EMB A;  2YTF A;  2EM6 A;  5KL5 A;  3IWD A;  1PJT A;  1IQS A;  4BS9 A;  5FLX C;  4X9J A;  2EM2 A;  4OX9 E;  1YYO A;  2MC6 A;  4F6M A;  3BF2 A;  4LF6 E;  2VE7 C;  2EN8 A;  2ELY A;  2EM3 A;  2YT4 A;  2EMZ A;  2EN7 A;  4MLV A;  1HNX E;  1UIL A;  4DV5 E;  3J7Y p;  2EMX A;  4DR4 E;  4P7D A;  2JVA A;  2VRD A;  5AC4 A;  2EOO A;  2M7Q A;  2L2N A;  3FIG A;  3JU0 A;  2YTD A;  4YHH E;  2EMW A;  5LMN E;  2LJH A;  2UUC E;  2EPP A;  2MKD A;  4X64 E;  4X65 E;  4LF8 E;  2MKN A;  3LML A;  2DB2 A;  2EOE A;  3MHH C;  2YTG A;  2EOM A;  2JY9 A;  2N8X A;  2RPC A;  4JV5 E;  5KL7 A;  3OML A;  1A1L A;  1UHZ A;  3BID A;  3HPS A;  2I9I A;  4JI2 E;  2EZ6 A;  5KL6 A;  4GEQ B;  1WHQ A;  1YZ9 A;  4LU9 A;  4GKK E;  3THN A;  2M1S A;  1G2D C;  2EJ4 A;  3C4T A;  4JI5 E;  2CPN A;  2EPL X;  5LMU E;  1MEY C;  2BBG A;  3VK6 A;  1XNR E;  3F6G A;  4BHB A;  2WBT A;  2EE8 A;  2HC5 A;  2V83 A;  2ENC A;  1KYQ A;  4LF9 E;  4TUG A;  1ZAA C;  2EML A;  2G7H A;  3RMP A;  2EPR A;  4J8Z A;  1B69 A;  2JOB A;  2EPX A;  5DNY A;  2UXD E;  3C4B A;  2UXB E;  3VYX A;  3AUZ A;  2L92 A;  2L6M A;  4BC7 A;  2V8Q B;  3J81 C;  3VHT B;  4R2A A;  3EPH A;  2LE2 A;  1WHN A;  2RTX A;  2MDG A;  4B3R E;  1XNQ E;  1HNW E;  1PKP A;  1XMQ E;  2HHH E;  2LTS A;  2D9H A;  4JI3 E;  2WCC 3;  4DMI A;  2LO3 A;  1YYW A;  2UU9 E;  1GZ6 A;  2YRH A;  1MGT A;  2EMF A;  1RQ0 A;  1X47 A;  2L8T A;  4B3T E;  2EMH A;  2FTX B;  1BBO A;  3KZY A;  4WFT A;  4X8W A;  2UUB E;  1WXR A;  2I13 A;  2EPK X;  2EM7 A;  1ZBT A;  1A1J A;  1A1G A;  5IXM B;  3T1Y E;  1X6H A;  4LTY A;  5LL6 R;  1QU6 A;  2WBS A;  3J80 C;  4JI0 E;  2ODR D;  2YTO A;  2FGG A;  1T38 A;  2EOR A;  2KON A;  1UBD C;  1N33 E;  1PJQ A;  4MLQ A;  2YU5 A;  4JYA E;  2EOF A;  2EPC A;  1JK1 A;  3HPZ A;  2EN3 A;  1J5E E;  1A1H A;  4F9B B;  1A1F A;  1WRJ A;  1T4O A;  3F6H A;  1N3G A;  2FV4 B;  1T39 A;  1BBG A;  2GHF A;  1DQ3 A;  2IHR 1;  1SFE A;  4DV1 E;  3BGH A;  4WYQ B;  2EM8 A;  4IJD A;  4F9A B;  5KL3 A;  4R2C A;  2E5L E;  2EOX A;  2YPN A;  4F54 A;  2L3J A;  4B3M E;  2YWQ A;  2HJJ A;  4WSG A;  4M30 A;  2B7T A;  4DR3 E;  2EPM X;  2B9D A;  1SR9 A;  5ADZ A; 
#chains in the Genus database with same CATH homology
 1IQO A;  1IQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...