1IQSA

Minimized average structure of mth1880 from methanobacterium thermoautotrophicum
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
88
structure length
88
Chain Sequence
b'LFIATLKGIFTLKDLPEEFRPFVDYKAGLEKKKLSDDDEIAIISIKGTQSNHVLFLSSYNSVDEIRKELEEAGAKINHTTLKILEGHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MTH1880
publication title Solution structure of a novel calcium binding protein, MTH1880, from Methanobacterium thermoautotrophicum.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Metal binding protein
total genus 13
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2001-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05370 DUF749 Domain of unknown function (DUF749)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.120 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Hypothetical protein MTH1880 1iqsA00
1IQSA 1IQOA
chains in the Genus database with same CATH superfamily
5ADZA 4DR3E 4LU9A 2MDGA 2R76A 3VK6A 2EZ6A 4JI5E 1UHZA 2EOXA 2DB2A 2VQEE 2GHFA 4ZYHA 2L33A 1T39A 5A2QC 2JWOA 1G2FC 2CTDA 2EM7A 4LF8E 2EQ3A 2EP3A 4O5GA 5LMNE 4RH8A 1WHQA 2V87A 4ZYEA 5T6JA 2YTDA 1YFHA 2FTXB 2N3GA 5LMUE 2EOIA 4K0KE 2EN8A 4LF6E 1A1IA 1A1LA 1GQEA 3TQMA 2EM6A 1MEYC 1UILA 2YTNA 4TUIA 4GKKE 3J7AG 4IJDA 4WFTA 1EH8A 1KYQA 2ENHA 2JR1A 4NXNE 4LF7E 2V85A 2V88A 4F9BB 2JXPA 2EM0A 2V83A 2HGHA 2RQLA 4R2PA 2EOMA 1X49A 2VE7C 2EORA 2YTQA 1YUJA 1N32E 1ZR9A 2D9HA 2LTRA 5AASA 4F9AB 1SR9A 4R2AA 2JOBA 2EMCA 2WCC3 1PDAA 2EMHA 2RSMA 2YTEA 2EM9A 2EOQA 1X5WA 1G2DC 2UUBE 2MC6A 2G7HA 2EPOA 1YSAC 4LF5E 2BB8A 3THOB 1MGTA 2L2MA 3VYYA 2MC5A 3L00A 1N3GA 4LF9E 2EM2A 5IT9C 1HNZE 4JV5E 2GLIA 2DMIA 4DR4E 2LTSA 2EM8A 1T38A 5AE1A 4B3TE 4JI3E 4R2RA 1X47A 1JK1A 1JK2A 1UN6B 4FK5C 2JOXA 1XNQE 3VHTB 1IQSA 4DMIA 1IBME 2JP9A 4YHHE 2FV4B 2EMFA 4WXCA 2LV2A 1DGCA 4F2JC 2UU9E 1WHNA 4R2SA 3EPHA 3KZZA 1EH7A 4O24A 1A1KA 4M2ZA 3MHSC 2EPCA 2V8QB 1RQ0A 4DV5E 3RMPA 2YTJA 4WPYA 4GKJE 4O4KA 1YYOA 3VYXA 2EOSA 2EE8A 2V86A 2HJJA 2M4IA 3AV0A 5A69A 2ODRD 2L6MA 2YSPA 4GEQB 1X48A 1AAYA 4HTGA 2ODRC 2RS7A 2B7TA 3LLHA 1YZ9A 4BC9A 3J81C 1A1HA 2YRHA 2WBSA 1HR0E 4J8ZA 1GZ6A 2L3CA 3HXLA 4JI8E 4OX9E 1XNRE 4X66E 2EPZA 2RS6A 2VF1A 2EMLA 2YT4A 2DMYA 4X8WA 2YZTA 2UUCE 2NUGA 3AUZA 4F54A 3EPKA 2F8BA 2VQFE 1EKZA 4JI4E 2EPUA 2I9IA 1ZU1A 5KL5A 2NUFA 3JTZA 5KL4A 2LRSA 4AQYE 1IMUA 4BC7A 4KHPE 2RPCA 4WSPA 2Q8UA 3P1XA 3UK3C 2RSIA 2LBSB 1T4NA 2LVHA 4BHCA 2EMKA 3HPZA 1IBKE 1TN9A 2F4VE 2ENCA 2HC5A 4DR6E 3DF6A 2JYAA 2ELYA 1A1JA 1HNWE 3HPSA 4LFAE 2EPNA 3BIDA 4NZVA 2L92A 1YYWA 1WRJA 2EMGA 1EH6A 4JI0E 2L2NA 4X62E 2NABA 3EPJA 1SFEA 4DV1E 2YRKA 1QU6A 2CSHA 2UXBE 4DUZE 2EN3A 4M30A 4N4RB 2YTGA 2H36X 4JI6E 4B3RE 3H09A 2B3TB 2M9AA 4R2EA 4X65E 2DIXA 2DSYA 1HNXE 5KL3A 5AE2A 1XMOE 2EN4A 3IWBA 2YSOA 4LFBE 2EMIA 1KJKA 3HQ1A 4M9VC 1X6HA 5TSEA 4MLQA 4OOGC 2YTFA 3IWDA 1T4OA 2NA2A 4JI7E 4NXME 3JAMC 4LFCE 1J26A 1RC7A 3LMLA 3ADGA 4BMJA 4GZNC 4P78A 2K7IA 2CT1A 2N3HA 2I13A 2ENAA 3C4TA 2MDRA 4DV2E 1BBGA 2R1FA 3BF2A 1T4LB 2EJ4A 1FKAE 1I94E 1A1FA 2UXCE 4WSGA 2JVAA 4X9JA 2EPAA 1N33E 4JI1E 2B9DA 4HEIA 2LUPB 1FJGE 2EMZA 3ADJA 2YTPA 3J7Yp 2DLQA 2ZM6E 2K4VA 2KOUA 2VRDA 4B3ME 2EM5A 2EWLA 2EMWA 4DV7E 1ZBTA 5IV8B 1PJSA 4R2CA 2E72A 2NUEA 2MKNA 2EPXA 2DGCA 5IXMB 1X6EA 3C4BA 1P47A 2EPRA 2WBUA 5A6JA 5CFFE 1RMDA 2UXDE 1YUIA 1B69A 2MKDA 5AC4A 1QNTA 2EOYA 2DRPA 2LJUA 2RTXA 2EPPA 1DQ3A 5F3WA 4DR5E 3ADIA 2E5LE 3QG5C 2EOZA 4RHBB 4DR7E 4P7DA 1ZBQA 3BBGA 4DUYE 4DV6E 4BCAA 3EQ1A 4JYAE 1AH5A 4IS1C 2EN1A 3OTOE 3ZOQB 4I8OA 4R03A 2LT7A 2EPLX 4R2QA 4L5NC 2EOEA 1WJPA 4LTYA 1O0WA 1L4SA 5BR8E 4DKKA 1PJQA 2YWQA 2EMAA 2IHR1 2HHHE 2FGGA 3ECRA 1IBLE 1BB8A 2BBGA 4WXDA 4BHBA 4TUGA 1NCSA 5KL7A 2V89A 2YU5A 2EOOA 2EM3A 2M7QA 3KWRA 4MLVA 2EL4A 3F6GA 2ADRA 4DV4E 3T1HE 1X6FA 2GPIA 3C6MA 3EPLA 1J5EE 2EL6A 2EN6A 5DNYA 3BGHA 2EMBA 2LJHA 2YPNA 4KWYA 4ZYGA 3T1YE 2B7VA 4R2DA 1N34E 2EQ0A 3MHHC 1IQOA 2KONA 3OMLA 1STUA 1DI2A 3IWCA 2YU8A 4X64E 2L2KB 4YY3E 1GTKA 4R8OA 4B3SE 5A6BD 2LO3A 4F9CB 2L3JA 2EMXA 2M1SA 2EN2A 1LLMC 2EOJA 4NHRA 1YYKA 5AE3A 5AC5A 4WX9A 2JPAA 4LF4E 1BBOA 5A6AA 2EOFA 4JI2E 5FLXC 2YRMA 3HTXA 1ZAAC 2UUAE 1XMQE 4F6MA 1TF3A 1TF6A 3FIGA 4DR2E 3F6HA 2JY9A 3THNA 2LCEA 2LMZA 4DR1E 2LE2A 2ELZA 3KZYA 5A6KA 5IWAE 4Q28A 2EMYA 2EPKX 1WXRA 2YTIA 2EOHA 4O43A 3K6QA 1NEIA 1UBDC 4DV0E 5LL6R 2EN7A 2KHXA 1X3CA 3M99B 4DV3E 3JU0A 2J7JA 1N36E 2A25A 4Q35B 2WZOA 2WBTA 4F6NA 3J80C 4L8NA 4KZSA 3ADLA 2EPMX 3DJWA 2L8TA 2CPNA 2E1MA 5KL2A 4BS9A 4M0VA 1A1GA 2N8XA 2YTOA 1YPNA 5LLQA 2PRTA 5KL6A 1Z1BA 3MSWA 2EM4A 2DLKA 2EQ1A 4BBYA 1PJTA 1F2IG 1PKPA 4ZYDA 2LUQA 2EL5A 3C6KA 4WYQB 5A6BA
chains in the Genus database with same CATH topology
1IQSA 1IQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IQS A;  1IQO A; 
#chains in the Genus database with same CATH topology
 5ADZ A;  4DR3 E;  4LU9 A;  2MDG A;  2R76 A;  3VK6 A;  2EZ6 A;  4JI5 E;  1UHZ A;  2EOX A;  2DB2 A;  2VQE E;  2GHF A;  4ZYH A;  2L33 A;  1T39 A;  5A2Q C;  2JWO A;  1G2F C;  2CTD A;  2EM7 A;  4LF8 E;  2EQ3 A;  2EP3 A;  4O5G A;  5LMN E;  4RH8 A;  1WHQ A;  2V87 A;  4ZYE A;  5T6J A;  2YTD A;  1YFH A;  2FTX B;  2N3G A;  5LMU E;  2EOI A;  4K0K E;  2EN8 A;  4LF6 E;  1A1I A;  1A1L A;  1GQE A;  3TQM A;  2EM6 A;  1MEY C;  1UIL A;  2YTN A;  4TUI A;  4GKK E;  3J7A G;  4IJD A;  4WFT A;  1EH8 A;  1KYQ A;  2ENH A;  2JR1 A;  4NXN E;  4LF7 E;  2V85 A;  2V88 A;  4F9B B;  2JXP A;  2EM0 A;  2V83 A;  2HGH A;  2RQL A;  4R2P A;  2EOM A;  1X49 A;  2VE7 C;  2EOR A;  2YTQ A;  1YUJ A;  1N32 E;  1ZR9 A;  2D9H A;  2LTR A;  5AAS A;  4F9A B;  1SR9 A;  4R2A A;  2JOB A;  2EMC A;  2WCC 3;  1PDA A;  2EMH A;  2RSM A;  2YTE A;  2EM9 A;  2EOQ A;  1X5W A;  1G2D C;  2UUB E;  2MC6 A;  2G7H A;  2EPO A;  1YSA C;  4LF5 E;  2BB8 A;  3THO B;  1MGT A;  2L2M A;  3VYY A;  2MC5 A;  3L00 A;  1N3G A;  4LF9 E;  2EM2 A;  5IT9 C;  1HNZ E;  4JV5 E;  2GLI A;  2DMI A;  4DR4 E;  2LTS A;  2EM8 A;  1T38 A;  5AE1 A;  4B3T E;  4JI3 E;  4R2R A;  1X47 A;  1JK1 A;  1JK2 A;  1UN6 B;  4FK5 C;  2JOX A;  1XNQ E;  3VHT B;  1IQS A;  4DMI A;  1IBM E;  2JP9 A;  4YHH E;  2FV4 B;  2EMF A;  4WXC A;  2LV2 A;  1DGC A;  4F2J C;  2UU9 E;  1WHN A;  4R2S A;  3EPH A;  3KZZ A;  1EH7 A;  4O24 A;  1A1K A;  4M2Z A;  3MHS C;  2EPC A;  2V8Q B;  1RQ0 A;  4DV5 E;  3RMP A;  2YTJ A;  4WPY A;  4GKJ E;  4O4K A;  1YYO A;  3VYX A;  2EOS A;  2EE8 A;  2V86 A;  2HJJ A;  2M4I A;  3AV0 A;  5A69 A;  2ODR D;  2L6M A;  2YSP A;  4GEQ B;  1X48 A;  1AAY A;  4HTG A;  2ODR C;  2RS7 A;  2B7T A;  3LLH A;  1YZ9 A;  4BC9 A;  3J81 C;  1A1H A;  2YRH A;  2WBS A;  1HR0 E;  4J8Z A;  1GZ6 A;  2L3C A;  3HXL A;  4JI8 E;  4OX9 E;  1XNR E;  4X66 E;  2EPZ A;  2RS6 A;  2VF1 A;  2EML A;  2YT4 A;  2DMY A;  4X8W A;  2YZT A;  2UUC E;  2NUG A;  3AUZ A;  4F54 A;  3EPK A;  2F8B A;  2VQF E;  1EKZ A;  4JI4 E;  2EPU A;  2I9I A;  1ZU1 A;  5KL5 A;  2NUF A;  3JTZ A;  5KL4 A;  2LRS A;  4AQY E;  1IMU A;  4BC7 A;  4KHP E;  2RPC A;  4WSP A;  2Q8U A;  3P1X A;  3UK3 C;  2RSI A;  2LBS B;  1T4N A;  2LVH A;  4BHC A;  2EMK A;  3HPZ A;  1IBK E;  1TN9 A;  2F4V E;  2ENC A;  2HC5 A;  4DR6 E;  3DF6 A;  2JYA A;  2ELY A;  1A1J A;  1HNW E;  3HPS A;  4LFA E;  2EPN A;  3BID A;  4NZV A;  2L92 A;  1YYW A;  1WRJ A;  2EMG A;  1EH6 A;  4JI0 E;  2L2N A;  4X62 E;  2NAB A;  3EPJ A;  1SFE A;  4DV1 E;  2YRK A;  1QU6 A;  2CSH A;  2UXB E;  4DUZ E;  2EN3 A;  4M30 A;  4N4R B;  2YTG A;  2H36 X;  4JI6 E;  4B3R E;  3H09 A;  2B3T B;  2M9A A;  4R2E A;  4X65 E;  2DIX A;  2DSY A;  1HNX E;  5KL3 A;  5AE2 A;  1XMO E;  2EN4 A;  3IWB A;  2YSO A;  4LFB E;  2EMI A;  1KJK A;  3HQ1 A;  4M9V C;  1X6H A;  5TSE A;  4MLQ A;  4OOG C;  2YTF A;  3IWD A;  1T4O A;  2NA2 A;  4JI7 E;  4NXM E;  3JAM C;  4LFC E;  1J26 A;  1RC7 A;  3LML A;  3ADG A;  4BMJ A;  4GZN C;  4P78 A;  2K7I A;  2CT1 A;  2N3H A;  2I13 A;  2ENA A;  3C4T A;  2MDR A;  4DV2 E;  1BBG A;  2R1F A;  3BF2 A;  1T4L B;  2EJ4 A;  1FKA E;  1I94 E;  1A1F A;  2UXC E;  4WSG A;  2JVA A;  4X9J A;  2EPA A;  1N33 E;  4JI1 E;  2B9D A;  4HEI A;  2LUP B;  1FJG E;  2EMZ A;  3ADJ A;  2YTP A;  3J7Y p;  2DLQ A;  2ZM6 E;  2K4V A;  2KOU A;  2VRD A;  4B3M E;  2EM5 A;  2EWL A;  2EMW A;  4DV7 E;  1ZBT A;  5IV8 B;  1PJS A;  4R2C A;  2E72 A;  2NUE A;  2MKN A;  2EPX A;  2DGC A;  5IXM B;  1X6E A;  3C4B A;  1P47 A;  2EPR A;  2WBU A;  5A6J A;  5CFF E;  1RMD A;  2UXD E;  1YUI A;  1B69 A;  2MKD A;  5AC4 A;  1QNT A;  2EOY A;  2DRP A;  2LJU A;  2RTX A;  2EPP A;  1DQ3 A;  5F3W A;  4DR5 E;  3ADI A;  2E5L E;  3QG5 C;  2EOZ A;  4RHB B;  4DR7 E;  4P7D A;  1ZBQ A;  3BBG A;  4DUY E;  4DV6 E;  4BCA A;  3EQ1 A;  4JYA E;  1AH5 A;  4IS1 C;  2EN1 A;  3OTO E;  3ZOQ B;  4I8O A;  4R03 A;  2LT7 A;  2EPL X;  4R2Q A;  4L5N C;  2EOE A;  1WJP A;  4LTY A;  1O0W A;  1L4S A;  5BR8 E;  4DKK A;  1PJQ A;  2YWQ A;  2EMA A;  2IHR 1;  2HHH E;  2FGG A;  3ECR A;  1IBL E;  1BB8 A;  2BBG A;  4WXD A;  4BHB A;  4TUG A;  1NCS A;  5KL7 A;  2V89 A;  2YU5 A;  2EOO A;  2EM3 A;  2M7Q A;  3KWR A;  4MLV A;  2EL4 A;  3F6G A;  2ADR A;  4DV4 E;  3T1H E;  1X6F A;  2GPI A;  3C6M A;  3EPL A;  1J5E E;  2EL6 A;  2EN6 A;  5DNY A;  3BGH A;  2EMB A;  2LJH A;  2YPN A;  4KWY A;  4ZYG A;  3T1Y E;  2B7V A;  4R2D A;  1N34 E;  2EQ0 A;  3MHH C;  1IQO A;  2KON A;  3OML A;  1STU A;  1DI2 A;  3IWC A;  2YU8 A;  4X64 E;  2L2K B;  4YY3 E;  1GTK A;  4R8O A;  4B3S E;  5A6B D;  2LO3 A;  4F9C B;  2L3J A;  2EMX A;  2M1S A;  2EN2 A;  1LLM C;  2EOJ A;  4NHR A;  1YYK A;  5AE3 A;  5AC5 A;  4WX9 A;  2JPA A;  4LF4 E;  1BBO A;  5A6A A;  2EOF A;  4JI2 E;  5FLX C;  2YRM A;  3HTX A;  1ZAA C;  2UUA E;  1XMQ E;  4F6M A;  1TF3 A;  1TF6 A;  3FIG A;  4DR2 E;  3F6H A;  2JY9 A;  3THN A;  2LCE A;  2LMZ A;  4DR1 E;  2LE2 A;  2ELZ A;  3KZY A;  5A6K A;  5IWA E;  4Q28 A;  2EMY A;  2EPK X;  1WXR A;  2YTI A;  2EOH A;  4O43 A;  3K6Q A;  1NEI A;  1UBD C;  4DV0 E;  5LL6 R;  2EN7 A;  2KHX A;  1X3C A;  3M99 B;  4DV3 E;  3JU0 A;  2J7J A;  1N36 E;  2A25 A;  4Q35 B;  2WZO A;  2WBT A;  4F6N A;  3J80 C;  4L8N A;  4KZS A;  3ADL A;  2EPM X;  3DJW A;  2L8T A;  2CPN A;  2E1M A;  5KL2 A;  4BS9 A;  4M0V A;  1A1G A;  2N8X A;  2YTO A;  1YPN A;  5LLQ A;  2PRT A;  5KL6 A;  1Z1B A;  3MSW A;  2EM4 A;  2DLK A;  2EQ1 A;  4BBY A;  1PJT A;  1F2I G;  1PKP A;  4ZYD A;  2LUQ A;  2EL5 A;  3C6K A;  4WYQ B;  5A6B A; 
#chains in the Genus database with same CATH homology
 1IQS A;  1IQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...