1IQSA

Minimized average structure of mth1880 from methanobacterium thermoautotrophicum
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
88
structure length
88
Chain Sequence
LFIATLKGIFTLKDLPEEFRPFVDYKAGLEKKKLSDDDEIAIISIKGTQSNHVLFLSSYNSVDEIRKELEEAGAKINHTTLKILEGHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a novel calcium binding protein, MTH1880, from Methanobacterium thermoautotrophicum.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Metal binding protein
molecule keywords MTH1880
total genus 13
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2001-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05370 DUF749 Domain of unknown function (DUF749)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.120 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Hypothetical protein MTH1880 1iqsA00
1IQSA 1IQOA
chains in the Genus database with same CATH superfamily
2EOEA 4KHPE 1F2IG 4MLQA 2EN1A 3T1HE 2LTRA 2UUAE 2EP3A 2EMYA 3ECRA 2EOXA 1A1JA 4JYAE 4FK5C 5IWAE 2UXCE 2E1MA 2EN6A 5IT9C 1WXRA 2EORA 2ELYA 2WCC3 2D9HA 1XMOE 2EE8A 2KHXA 1IQSA 1PJQA 4TUIA 1DI2A 2EL6A 3IWDA 2VRDA 1WRJA 4AQYE 4RH8A 1YYOA 2JOXA 4X8WA 3EPLA 2JYAA 2RS6A 4MLVA 3OTOE 1B69A 2EN2A 4DMIA 2RTXA 3TQMA 4DR7E 3C4TA 2ODRC 1SFEA 3IWBA 4NHRA 2EMBA 4R2QA 1RC7A 1MEYC 1HNWE 1N33E 1KYQA 1IBKE 2EN4A 2WZOA 4R2PA 3J80C 5BR8E 1KJKA 1QU6A 2EPNA 4P7DA 2JOBA 4JI3E 3THOB 4GKJE 1X47A 4IJDA 5AASA 4BCAA 2EMHA 4JI7E 2EMZA 4WXDA 4R03A 3K6QA 3DF6A 3ZOQB 1X5WA 2WBTA 3ADJA 1EH6A 1QNTA 3MHHC 2EMXA 5A6BA 2UXBE 2BBGA 4R2RA 2EM7A 1UBDC 1XNQE 1T39A 4IS1C 4ZYGA 5KL7A 2GPIA 1L4SA 3LMLA 2ADRA 2G7HA 2ZM6E 4DUYE 2DB2A 1RMDA 3F6GA 2VQFE 1T4NA 2EPRA 2YTEA 2M4IA 2ELZA 1HR0E 4B3TE 3UK3C 2EM3A 2L2NA 3LLHA 4HTGA 2V89A 4M30A 2K7IA 4ZYHA 3H09A 1T38A 1BBOA 1TN9A 1J26A 4B3ME 3F6HA 4WX9A 1ZR9A 2LV2A 4GEQB 3AUZA 2NUEA 2EOHA 3EPJA 4JI8E 2NABA 4JV5E 3HTXA 3DJWA 4BC7A 1A1LA 1X6EA 1TF3A 3KZZA 4DV6E 1PDAA 1G2FC 2LBSB 3KWRA 1Z1BA 2EPOA 2V8QB 1WHQA 2L92A 2JP9A 2YTNA 4O43A 2MDGA 3ADLA 2EOMA 2EPMX 2LO3A 4J8ZA 2EOZA 2YPNA 4WYQB 2YTPA 5TSEA 4F9BB 2MC6A 2EN8A 2EWLA 4BHCA 4R8OA 2EM4A 1AH5A 3JTZA 1UILA 4OOGC 4WSPA 1JK2A 4WSGA 2B7VA 2UXDE 2YTOA 2EQ0A 1N32E 2DIXA 1TF6A 4GKKE 1EH8A 1IBLE 1RQ0A 5IV8B 1IBME 3ADGA 3JU0A 5LMUE 1I94E 4JI4E 2L3JA 1XMQE 2V83A 4LFBE 5A2QC 4R2SA 4R2CA 2DRPA 3BGHA 4NXNE 2R1FA 3MHSC 4LF6E 5IXMB 2LVHA 1IMUA 2YTGA 2EQ3A 3VHTB 2EOJA 1FKAE 1N34E 4RHBB 2GLIA 1G2DC 2V85A 4DKKA 3OMLA 3J81C 1UN6B 4JI6E 2EM9A 1HNZE 2CSHA 3KZYA 2EZ6A 2M9AA 1ZBTA 2EJ4A 1P47A 5FLXC 1J5EE 2WBUA 2EL4A 1DGCA 3EPKA 4F2JC 4ZYDA 3IWCA 2EPUA 2L2KB 5T6JA 3JAMC 2EPPA 2EMGA 2YRKA 2ENAA 1IQOA 4WXCA 2M1SA 2LMZA 2EM0A 4F6NA 1YZ9A 4HEIA 5DNYA 4KWYA 2RQLA 2IHR1 5F3WA 4L5NC 2EMKA 4BC9A 4DR1E 2LUQA 1EKZA 3EPHA 5LLQA 4K0KE 3EQ1A 2YSOA 4F9AB 3MSWA 2EQ1A 3C6MA 2EPXA 1UHZA 2EMAA 2HC5A 1YSAC 2LCEA 3VK6A 1WHNA 1YPNA 2CTDA 2EPZA 2EPCA 1EH7A 2LTSA 2EOQA 4NZVA 1T4LB 5LMNE 4JI5E 1N36E 4BHBA 2JXPA 4LF7E 4X64E 4YY3E 2H36X 2UUBE 5AE1A 4WFTA 2EM8A 1LLMC 2JY9A 1X3CA 4I8OA 2M7QA 4B3SE 2R76A 4GZNC 2DLQA 2V86A 3THNA 4F9CB 5LL6R 1YUJA 1STUA 1GZ6A 2MDRA 2YTQA 1NCSA 3HPSA 1ZAAC 4LU9A 1ZBQA 2NUFA 4LFAE 2BB8A 4OX9E 1FJGE 4Q28A 2HGHA 2DSYA 4BS9A 2I9IA 2RSIA 5A6KA 2EM2A 4DUZE 2B9DA 5KL3A 2ODRD 2F8BA 1N3GA 2FTXB 2B3TB 2LT7A 3ADIA 4JI2E 2GHFA 2JPAA 4F54A 2FGGA 4X62E 3P1XA 2NA2A 1GTKA 1YUIA 2EMIA 4X65E 4LF8E 4Q35B 4O5GA 3BIDA 1XNRE 2HJJA 4P78A 2L3CA 2YWQA 4L8NA 2LRSA 2YRMA 3VYYA 2JWOA 4LTYA 4X9JA 5AC4A 1YFHA 3J7AG 2YU5A 2YTIA 1X6FA 2EPLX 5CFFE 2LJUA 4WPYA 5A6JA 1O0WA 4TUGA 1YYWA 2YT4A 2N3GA 4ZYEA 2WBSA 5AC5A 2RSMA 2NUGA 4F6MA 3RMPA 2DLKA 2EM6A 4DV2E 3BBGA 4JI1E 2EM5A 2VF1A 2E72A 1PKPA 1A1GA 2DGCA 3C6KA 1X48A 5KL2A 1BB8A 4DV3E 2L8TA 5AE2A 2FV4B 2V87A 3HQ1A 2UU9E 2F4VE 2EPAA 3FIGA 1A1KA 1A1FA 1SR9A 2EN3A 2V88A 2L33A 2JR1A 4O24A 4DR5E 2HHHE 4M2ZA 2KONA 5KL4A 2L6MA 2YSPA 2YTDA 2ENHA 1HNXE 2UUCE 2KOUA 1X49A 4R2DA 3BF2A 4KZSA 4LF9E 2J7JA 1ZU1A 2EOFA 3HXLA 2N8XA 2LE2A 2LUPB 4YHHE 2EOIA 2LJHA 2YU8A 3AV0A 2YRHA 4DV0E 3J7Yp 3T1YE 4NXME 1WJPA 5AE3A 2EPKX 4DR3E 4DV4E 4DV7E 5KL5A 2EMFA 2B7TA 2YTFA 1NEIA 5A69A 4O4KA 2ENCA 2YZTA 2EOOA 2CPNA 2EMCA 2MKDA 1T4OA 5A6BD 2VQEE 4R2EA 1AAYA 4LFCE 2YTJA 3C4BA 2MC5A 4X66E 3M99B 1PJTA 2PRTA 1A1IA 4DR6E 2EMLA 1PJSA 2E5LE 4B3RE 4LF4E 4JI0E 1MGTA 4BMJA 2MKNA 2EMWA 4DV1E 2I13A 1GQEA 2Q8UA 2JVAA 2RS7A 2EL5A 1DQ3A 3L00A 4N4RB 1A1HA 1YYKA 5A6AA 2VE7C 4DV5E 4BBYA 5ADZA 4DR2E 2K4VA 2L2MA 2EOSA 2CT1A 2A25A 2EOYA 3HPZA 2DMIA 3QG5C 1JK1A 2RPCA 4R2AA 2DMYA 5KL6A 2EN7A 2N3HA 4M9VC 3VYXA 1X6HA 1BBGA 4DR4E 4M0VA 4LF5E
chains in the Genus database with same CATH topology
1IQSA 1IQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IQS A;  1IQO A; 
#chains in the Genus database with same CATH topology
 2EOE A;  4KHP E;  1F2I G;  4MLQ A;  2EN1 A;  3T1H E;  2LTR A;  2UUA E;  2EP3 A;  2EMY A;  3ECR A;  2EOX A;  1A1J A;  4JYA E;  4FK5 C;  5IWA E;  2UXC E;  2E1M A;  2EN6 A;  5IT9 C;  1WXR A;  2EOR A;  2ELY A;  2WCC 3;  2D9H A;  1XMO E;  2EE8 A;  2KHX A;  1IQS A;  1PJQ A;  4TUI A;  1DI2 A;  2EL6 A;  3IWD A;  2VRD A;  1WRJ A;  4AQY E;  4RH8 A;  1YYO A;  2JOX A;  4X8W A;  3EPL A;  2JYA A;  2RS6 A;  4MLV A;  3OTO E;  1B69 A;  2EN2 A;  4DMI A;  2RTX A;  3TQM A;  4DR7 E;  3C4T A;  2ODR C;  1SFE A;  3IWB A;  4NHR A;  2EMB A;  4R2Q A;  1RC7 A;  1MEY C;  1HNW E;  1N33 E;  1KYQ A;  1IBK E;  2EN4 A;  2WZO A;  4R2P A;  3J80 C;  5BR8 E;  1KJK A;  1QU6 A;  2EPN A;  4P7D A;  2JOB A;  4JI3 E;  3THO B;  4GKJ E;  1X47 A;  4IJD A;  5AAS A;  4BCA A;  2EMH A;  4JI7 E;  2EMZ A;  4WXD A;  4R03 A;  3K6Q A;  3DF6 A;  3ZOQ B;  1X5W A;  2WBT A;  3ADJ A;  1EH6 A;  1QNT A;  3MHH C;  2EMX A;  5A6B A;  2UXB E;  2BBG A;  4R2R A;  2EM7 A;  1UBD C;  1XNQ E;  1T39 A;  4IS1 C;  4ZYG A;  5KL7 A;  2GPI A;  1L4S A;  3LML A;  2ADR A;  2G7H A;  2ZM6 E;  4DUY E;  2DB2 A;  1RMD A;  3F6G A;  2VQF E;  1T4N A;  2EPR A;  2YTE A;  2M4I A;  2ELZ A;  1HR0 E;  4B3T E;  3UK3 C;  2EM3 A;  2L2N A;  3LLH A;  4HTG A;  2V89 A;  4M30 A;  2K7I A;  4ZYH A;  3H09 A;  1T38 A;  1BBO A;  1TN9 A;  1J26 A;  4B3M E;  3F6H A;  4WX9 A;  1ZR9 A;  2LV2 A;  4GEQ B;  3AUZ A;  2NUE A;  2EOH A;  3EPJ A;  4JI8 E;  2NAB A;  4JV5 E;  3HTX A;  3DJW A;  4BC7 A;  1A1L A;  1X6E A;  1TF3 A;  3KZZ A;  4DV6 E;  1PDA A;  1G2F C;  2LBS B;  3KWR A;  1Z1B A;  2EPO A;  2V8Q B;  1WHQ A;  2L92 A;  2JP9 A;  2YTN A;  4O43 A;  2MDG A;  3ADL A;  2EOM A;  2EPM X;  2LO3 A;  4J8Z A;  2EOZ A;  2YPN A;  4WYQ B;  2YTP A;  5TSE A;  4F9B B;  2MC6 A;  2EN8 A;  2EWL A;  4BHC A;  4R8O A;  2EM4 A;  1AH5 A;  3JTZ A;  1UIL A;  4OOG C;  4WSP A;  1JK2 A;  4WSG A;  2B7V A;  2UXD E;  2YTO A;  2EQ0 A;  1N32 E;  2DIX A;  1TF6 A;  4GKK E;  1EH8 A;  1IBL E;  1RQ0 A;  5IV8 B;  1IBM E;  3ADG A;  3JU0 A;  5LMU E;  1I94 E;  4JI4 E;  2L3J A;  1XMQ E;  2V83 A;  4LFB E;  5A2Q C;  4R2S A;  4R2C A;  2DRP A;  3BGH A;  4NXN E;  2R1F A;  3MHS C;  4LF6 E;  5IXM B;  2LVH A;  1IMU A;  2YTG A;  2EQ3 A;  3VHT B;  2EOJ A;  1FKA E;  1N34 E;  4RHB B;  2GLI A;  1G2D C;  2V85 A;  4DKK A;  3OML A;  3J81 C;  1UN6 B;  4JI6 E;  2EM9 A;  1HNZ E;  2CSH A;  3KZY A;  2EZ6 A;  2M9A A;  1ZBT A;  2EJ4 A;  1P47 A;  5FLX C;  1J5E E;  2WBU A;  2EL4 A;  1DGC A;  3EPK A;  4F2J C;  4ZYD A;  3IWC A;  2EPU A;  2L2K B;  5T6J A;  3JAM C;  2EPP A;  2EMG A;  2YRK A;  2ENA A;  1IQO A;  4WXC A;  2M1S A;  2LMZ A;  2EM0 A;  4F6N A;  1YZ9 A;  4HEI A;  5DNY A;  4KWY A;  2RQL A;  2IHR 1;  5F3W A;  4L5N C;  2EMK A;  4BC9 A;  4DR1 E;  2LUQ A;  1EKZ A;  3EPH A;  5LLQ A;  4K0K E;  3EQ1 A;  2YSO A;  4F9A B;  3MSW A;  2EQ1 A;  3C6M A;  2EPX A;  1UHZ A;  2EMA A;  2HC5 A;  1YSA C;  2LCE A;  3VK6 A;  1WHN A;  1YPN A;  2CTD A;  2EPZ A;  2EPC A;  1EH7 A;  2LTS A;  2EOQ A;  4NZV A;  1T4L B;  5LMN E;  4JI5 E;  1N36 E;  4BHB A;  2JXP A;  4LF7 E;  4X64 E;  4YY3 E;  2H36 X;  2UUB E;  5AE1 A;  4WFT A;  2EM8 A;  1LLM C;  2JY9 A;  1X3C A;  4I8O A;  2M7Q A;  4B3S E;  2R76 A;  4GZN C;  2DLQ A;  2V86 A;  3THN A;  4F9C B;  5LL6 R;  1YUJ A;  1STU A;  1GZ6 A;  2MDR A;  2YTQ A;  1NCS A;  3HPS A;  1ZAA C;  4LU9 A;  1ZBQ A;  2NUF A;  4LFA E;  2BB8 A;  4OX9 E;  1FJG E;  4Q28 A;  2HGH A;  2DSY A;  4BS9 A;  2I9I A;  2RSI A;  5A6K A;  2EM2 A;  4DUZ E;  2B9D A;  5KL3 A;  2ODR D;  2F8B A;  1N3G A;  2FTX B;  2B3T B;  2LT7 A;  3ADI A;  4JI2 E;  2GHF A;  2JPA A;  4F54 A;  2FGG A;  4X62 E;  3P1X A;  2NA2 A;  1GTK A;  1YUI A;  2EMI A;  4X65 E;  4LF8 E;  4Q35 B;  4O5G A;  3BID A;  1XNR E;  2HJJ A;  4P78 A;  2L3C A;  2YWQ A;  4L8N A;  2LRS A;  2YRM A;  3VYY A;  2JWO A;  4LTY A;  4X9J A;  5AC4 A;  1YFH A;  3J7A G;  2YU5 A;  2YTI A;  1X6F A;  2EPL X;  5CFF E;  2LJU A;  4WPY A;  5A6J A;  1O0W A;  4TUG A;  1YYW A;  2YT4 A;  2N3G A;  4ZYE A;  2WBS A;  5AC5 A;  2RSM A;  2NUG A;  4F6M A;  3RMP A;  2DLK A;  2EM6 A;  4DV2 E;  3BBG A;  4JI1 E;  2EM5 A;  2VF1 A;  2E72 A;  1PKP A;  1A1G A;  2DGC A;  3C6K A;  1X48 A;  5KL2 A;  1BB8 A;  4DV3 E;  2L8T A;  5AE2 A;  2FV4 B;  2V87 A;  3HQ1 A;  2UU9 E;  2F4V E;  2EPA A;  3FIG A;  1A1K A;  1A1F A;  1SR9 A;  2EN3 A;  2V88 A;  2L33 A;  2JR1 A;  4O24 A;  4DR5 E;  2HHH E;  4M2Z A;  2KON A;  5KL4 A;  2L6M A;  2YSP A;  2YTD A;  2ENH A;  1HNX E;  2UUC E;  2KOU A;  1X49 A;  4R2D A;  3BF2 A;  4KZS A;  4LF9 E;  2J7J A;  1ZU1 A;  2EOF A;  3HXL A;  2N8X A;  2LE2 A;  2LUP B;  4YHH E;  2EOI A;  2LJH A;  2YU8 A;  3AV0 A;  2YRH A;  4DV0 E;  3J7Y p;  3T1Y E;  4NXM E;  1WJP A;  5AE3 A;  2EPK X;  4DR3 E;  4DV4 E;  4DV7 E;  5KL5 A;  2EMF A;  2B7T A;  2YTF A;  1NEI A;  5A69 A;  4O4K A;  2ENC A;  2YZT A;  2EOO A;  2CPN A;  2EMC A;  2MKD A;  1T4O A;  5A6B D;  2VQE E;  4R2E A;  1AAY A;  4LFC E;  2YTJ A;  3C4B A;  2MC5 A;  4X66 E;  3M99 B;  1PJT A;  2PRT A;  1A1I A;  4DR6 E;  2EML A;  1PJS A;  2E5L E;  4B3R E;  4LF4 E;  4JI0 E;  1MGT A;  4BMJ A;  2MKN A;  2EMW A;  4DV1 E;  2I13 A;  1GQE A;  2Q8U A;  2JVA A;  2RS7 A;  2EL5 A;  1DQ3 A;  3L00 A;  4N4R B;  1A1H A;  1YYK A;  5A6A A;  2VE7 C;  4DV5 E;  4BBY A;  5ADZ A;  4DR2 E;  2K4V A;  2L2M A;  2EOS A;  2CT1 A;  2A25 A;  2EOY A;  3HPZ A;  2DMI A;  3QG5 C;  1JK1 A;  2RPC A;  4R2A A;  2DMY A;  5KL6 A;  2EN7 A;  2N3H A;  4M9V C;  3VYX A;  1X6H A;  1BBG A;  4DR4 E;  4M0V A;  4LF5 E; 
#chains in the Genus database with same CATH homology
 1IQS A;  1IQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...