2EWLA

Solution structure of the c-terminal domain (monomer) of the hpv45 oncoprotein e7
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
GSHMAEPQRHKILCVCCKCDGRIELTVESSAEDLRTLQQLFLSTLSFVCPWCATNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the partially folded high-risk human papilloma virus 45 oncoprotein E7.
pubmed doi rcsb
source organism Human papillomavirus
molecule tags Oncoprotein, virus/viral protein
molecule keywords Protein E7
total genus 12
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.730 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2ewlA00
2F8BA 2EWLA
chains in the Genus database with same CATH superfamily
4DR1E 4LF7E 2PRTA 1G2FC 2YTFA 3TQMA 4DV3E 4LU9A 4X8WA 1AH5A 2LMZA 1IBME 2DMYA 2WBSA 3ADIA 4R8OA 4BC7A 2E5LE 1UN6B 4KZSA 3OMLA 4F2JC 2BB8A 2N8XA 2UUCE 4JV5E 2NA2A 3RMPA 4O5GA 1QNTA 5A6AA 4DUZE 2EOFA 1MEYC 2YTGA 1T39A 2ENCA 1B69A 2YTQA 2F4VE 2FTXB 3MHHC 3EPHA 4DV7E 2V89A 4ZYEA 4R2QA 4F9BB 4BHBA 4O43A 3JTZA 5TSEA 2EM0A 4F54A 2EPAA 2EMFA 1NCSA 3C4BA 3VYXA 2YU5A 1X6FA 3C6KA 2EPMX 3HTXA 2YSOA 1YSAC 2EMLA 1GTKA 2EPRA 2DSYA 2WBTA 2M9AA 2LCEA 4DR2E 2B7TA 3K6QA 2V86A 1WHQA 2EPOA 2FGGA 4DV6E 4DUYE 2EOJA 1FKAE 1DGCA 2YRMA 1YZ9A 4BMJA 4JI5E 2CPNA 2LUPB 4DR6E 4R03A 4NHRA 1X48A 5A6JA 5IT9C 3THNA 1IMUA 4FK5C 4LFBE 1N32E 4M0VA 4BCAA 3KZYA 1KYQA 3J80C 1A1KA 2EM5A 1DI2A 4WXCA 4AQYE 2LE2A 4X9JA 2I13A 1EH6A 2EMCA 4DMIA 5F3WA 4WFTA 3C4TA 5ADZA 1YYOA 2VE7C 1PJTA 2ZM6E 3F6GA 4DV4E 1A1LA 4DR7E 2DGCA 5AC4A 2R1FA 3IWDA 1EH7A 2EQ3A 4HEIA 2EN2A 1N3GA 1TN9A 2CTDA 1YUIA 1YFHA 2EMYA 2WZOA 3J7AG 2YPNA 2EM3A 4O4KA 3P1XA 1N34E 2EL6A 2ODRC 2YTJA 4DKKA 4JI4E 1PKPA 1BBOA 4F9CB 2B9DA 2EMKA 1WRJA 1LLMC 4DV2E 2L3CA 1X49A 5DNYA 5A6KA 2JVAA 4LTYA 4F6NA 2L33A 2EOYA 2ENHA 3H09A 2G7HA 4NXME 2YTDA 4LF4E 1RMDA 1T4NA 5T6JA 5A2QC 1J26A 2V87A 2EMXA 3AV0A 1T38A 2UXDE 1BBGA 4Q35B 3VHTB 2LTSA 3LLHA 2EPUA 4O24A 1KJKA 3IWBA 4MLVA 2V83A 2ELYA 1TF3A 1GZ6A 2VRDA 2UUBE 1A1JA 3VK6A 3IWCA 1IBKE 2N3GA 1MGTA 2EN6A 1X6EA 2NUGA 1A1FA 2NABA 2EM4A 4L8NA 4OX9E 1UBDC 5BR8E 1HNXE 1ZU1A 3MSWA 2VF1A 4MLQA 1FJGE 3BIDA 3HXLA 1X5WA 3MHSC 4JYAE 2VQFE 2ENAA 2B3TB 2EL5A 1DQ3A 4ZYGA 5AE3A 2YRHA 1GQEA 2V8QB 2DIXA 1IQSA 1UILA 4HTGA 2M7QA 2I9IA 2ADRA 1SR9A 4JI0E 2JPAA 2ODRD 4TUIA 2VQEE 1HR0E 3EPLA 2GLIA 2L2KB 2NUEA 4B3TE 2L6MA 2WBUA 1XMOE 4M2ZA 3F6HA 4DR3E 4DV0E 2EN1A 3FIGA 3L00A 4P7DA 2L3JA 5KL3A 4LF6E 5KL5A 2JY9A 2N3HA 2R76A 2EOXA 5A6BA 4JI7E 2KHXA 2CT1A 2EOEA 2EPCA 2JXPA 2DRPA 1X6HA 1XNQE 1A1GA 1PJQA 4JI2E 2EMZA 2LTRA 4JI1E 2B7VA 2EJ4A 1N33E 1X47A 3HQ1A 2LVHA 1G2DC 2M1SA 2JP9A 1YYWA 1PDAA 4YY3E 5CFFE 5IWAE 4B3SE 1Z1BA 2GHFA 4IJDA 1RQ0A 4X65E 3HPZA 2UU9E 3ECRA 2RSMA 2MKDA 2RQLA 4WYQB 2RTXA 4BC9A 2A25A 2EOIA 3QG5C 2MC6A 2EORA 2KOUA 2YWQA 4BHCA 5A6BD 1A1HA 4LF8E 2EOOA 2MDRA 5AC5A 4ZYDA 2J7JA 3LMLA 4NZVA 3J81C 2YRKA 4R2CA 2LJHA 5LMUE 2EQ1A 2FV4B 2EPKX 2RSIA 2EMGA 2DB2A 4GKKE 2H36X 4R2RA 1IQOA 3THOB 4R2SA 1JK2A 1O0WA 2IHR1 2HJJA 3ADGA 4JI6E 1XNRE 2HGHA 4N4RB 4RH8A 4BS9A 2JOBA 1QU6A 3KZZA 4GZNC 2LBSB 4WPYA 2EPNA 3KWRA 3AUZA 2YSPA 4J8ZA 3JU0A 4P78A 2V85A 2EMAA 4WX9A 2EN3A 2ELZA 1ZR9A 2EOQA 4R2PA 4NXNE 3EPKA 1SFEA 4WXDA 4JI3E 2LO3A 2YT4A 5KL7A 2EWLA 2D9HA 2EM8A 4IS1C 1RC7A 2LUQA 4RHBB 4KHPE 2JOXA 4M30A 2WCC3 1XMQE 3UK3C 4LF5E 4JI8E 3HPSA 1ZBQA 1ZAAC 1YYKA 1STUA 2BBGA 2K7IA 2NUFA 2L8TA 4F6MA 1TF6A 1EH8A 2EMIA 1AAYA 2YTIA 4GKJE 2EL4A 5FLXC 4B3RE 2DLKA 4B3ME 2E72A 2LRSA 3DF6A 2EZ6A 2EPZA 2UXBE 4DR5E 5A69A 5KL6A 1A1IA 2EQ0A 4F9AB 3VYYA 2EPPA 2V88A 2EPXA 4LFCE 2UUAE 4M9VC 2JWOA 4R2AA 2L2NA 2EM2A 2YZTA 1T4OA 2UXCE 5AASA 4X62E 2EE8A 1P47A 2Q8UA 2DLQA 4YHHE 2EOSA 4Q28A 2L92A 4R2EA 1UHZA 4I8OA 4R2DA 1X3CA 2L2MA 4GEQB 1F2IG 4TUGA 2MDGA 2EN8A 1L4SA 5LLQA 4X66E 5KL4A 4DR4E 5IXMB 3BBGA 4L5NC 3DJWA 2CSHA 2EN4A 1WJPA 1ZBTA 1J5EE 2YTEA 3ADJA 2JR1A 1HNWE 2EM9A 2YTNA 4K0KE 1NEIA 3BGHA 4WSPA 4KWYA 1WXRA 1HNZE 2EOHA 3C6MA 3J7Yp 4X64E 2EOZA 1PJSA 2YTPA 2HC5A 3OTOE 3M99B 2M4IA 1JK1A 3JAMC 4OOGC 1WHNA 4DV1E 2LT7A 3EPJA 2EP3A 4DV5E 2YTOA 2YU8A 2MKNA 2EM7A 1YUJA 1T4LB 5KL2A 2EOMA 2RS7A 2LV2A 2EM6A 1YPNA 2MC5A 3ADLA 2EPLX 2E1MA 3T1YE 2EMBA 2JYAA 2F8BA 5AE2A 2EMWA 4BBYA 5AE1A 1N36E 5IV8B 2RS6A 2HHHE 2RPCA 4LF9E 2DMIA 3EQ1A 1IBLE 1I94E 3BF2A 3ZOQB 2K4VA 2EN7A 5LL6R 4LFAE 1BB8A 2EMHA 4ZYHA 2LJUA 5LMNE 1EKZA 3T1HE 2KONA 2GPIA 4WSGA
chains in the Genus database with same CATH topology
2JY9A 2N3HA 4JI7E 2KHXA 3IWDA 4DR1E 4LF7E 4GKJE 1XNQE 4DV3E 5FLXC 4LU9A 4B3RE 4X8WA 4B3ME 2LMZA 2LRSA 3DF6A 1IBME 4JI2E 2EZ6A 2LTRA 2WZOA 4JI1E 4DR5E 2B7VA 3J7AG 2UXBE 2DMYA 1N33E 4F9AB 3VYYA 2V88A 3P1XA 3ADIA 1X47A 3HQ1A 1N34E 4LFCE 2M1SA 2ODRC 2UUAE 4R8OA 4BC7A 4DKKA 1PKPA 2JWOA 2E5LE 4JI4E 2L2NA 4F9CB 1YYWA 2B9DA 4YY3E 4KZSA 3OMLA 2YZTA 4DV2E 2L3CA 1X49A 5CFFE 5IWAE 1T4OA 5DNYA 5AASA 2UUCE 2NA2A 2JVAA 4X62E 4B3SE 3RMPA 4LTYA 4JV5E 1RQ0A 4X65E 3HPZA 2UU9E 4DUZE 2L33A 2RSMA 4WYQB 2RTXA 4BC9A 3H09A 2G7HA 4YHHE 4NXME 2MC6A 2KOUA 4LF4E 4LF8E 1T4NA 5T6JA 4Q28A 2L92A 5A2QC 2F4VE 1UHZA 2FTXB 2MDRA 4I8OA 1J26A 2L2MA 2V87A 4DV7E 3AV0A 4GEQB 3LMLA 3J81C 2V89A 4TUGA 2UXDE 4F9BB 4X66E 2LTSA 3LLHA 2LJHA 3JTZA 5LMUE 4DR4E 4L5NC 3DJWA 4F54A 2FV4B 1ZBTA 3IWBA 1J5EE 2V83A 3ADJA 2JR1A 2DB2A 4GKKE 1HNWE 2H36X 1GZ6A 3C4BA 2UUBE 3IWCA 3VK6A 1IBKE 3VYXA 2N3GA 4K0KE 4WSPA 2NUGA 1YYKA 1O0WA 2IHR1 1WXRA 1HNZE 3J7Yp 3HTXA 4X64E 3ADGA 4JI6E 1XNRE 2UXCE 4L8NA 4BS9A 4OX9E 2DSYA 2JOBA 5BR8E 1HNXE 4DR2E 1QU6A 2LBSB 4WPYA 2B7TA 3K6QA 2VF1A 2V86A 3AUZA 3KWRA 2M4IA 1WHQA 3MSWA 3OTOE 3JAMC 4J8ZA 1WHNA 2FGGA 3JU0A 4OOGC 4DV1E 4DV6E 3HXLA 4DUYE 4P78A 2V85A 1FJGE 4JYAE 4DV5E 2VQFE 1FKAE 2B3TB 1T4LB 1DQ3A 1YZ9A 4BMJA 4JI5E 5AE3A 2RS7A 2CPNA 2LUPB 4DR6E 1GQEA 2V8QB 2MC5A 2DIXA 1UILA 4R03A 4NXNE 3ADLA 1X48A 2M7QA 2E1MA 3T1YE 5IT9C 4JI3E 2F8BA 1SR9A 4JI0E 5AE2A 2YT4A 4LFBE 4BBYA 2EWLA 1N32E 2ODRD 4M0VA 4BCAA 5AE1A 2RS6A 4TUIA 2VQEE 3J80C 1N36E 1HR0E 2HHHE 2L2KB 4LF9E 2NUEA 4B3TE 1RC7A 1IBLE 1DI2A 1I94E 2L6MA 2LUQA 4AQYE 4KHPE 2LE2A 3ZOQB 1XMOE 2JOXA 2K4VA 4M2ZA 4DMIA 5F3WA 3F6HA 4WFTA 4DR3E 4DV0E 3C4TA 5LL6R 4M30A 1XMQE 4LFAE 5ADZA 4LF5E 3FIGA 4JI8E 5LMNE 3HPSA 1YYOA 1EKZA 1ZBQA 4P7DA 2VE7C 2ZM6E 2KONA 1STUA 3F6GA 2L3JA 4DV4E 3T1HE 4LF6E 2NUFA 4DR7E 2L8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F8B A;  2EWL A; 
#chains in the Genus database with same CATH topology
 4DR1 E;  4LF7 E;  2PRT A;  1G2F C;  2YTF A;  3TQM A;  4DV3 E;  4LU9 A;  4X8W A;  1AH5 A;  2LMZ A;  1IBM E;  2DMY A;  2WBS A;  3ADI A;  4R8O A;  4BC7 A;  2E5L E;  1UN6 B;  4KZS A;  3OML A;  4F2J C;  2BB8 A;  2N8X A;  2UUC E;  4JV5 E;  2NA2 A;  3RMP A;  4O5G A;  1QNT A;  5A6A A;  4DUZ E;  2EOF A;  1MEY C;  2YTG A;  1T39 A;  2ENC A;  1B69 A;  2YTQ A;  2F4V E;  2FTX B;  3MHH C;  3EPH A;  4DV7 E;  2V89 A;  4ZYE A;  4R2Q A;  4F9B B;  4BHB A;  4O43 A;  3JTZ A;  5TSE A;  2EM0 A;  4F54 A;  2EPA A;  2EMF A;  1NCS A;  3C4B A;  3VYX A;  2YU5 A;  1X6F A;  3C6K A;  2EPM X;  3HTX A;  2YSO A;  1YSA C;  2EML A;  1GTK A;  2EPR A;  2DSY A;  2WBT A;  2M9A A;  2LCE A;  4DR2 E;  2B7T A;  3K6Q A;  2V86 A;  1WHQ A;  2EPO A;  2FGG A;  4DV6 E;  4DUY E;  2EOJ A;  1FKA E;  1DGC A;  2YRM A;  1YZ9 A;  4BMJ A;  4JI5 E;  2CPN A;  2LUP B;  4DR6 E;  4R03 A;  4NHR A;  1X48 A;  5A6J A;  5IT9 C;  3THN A;  1IMU A;  4FK5 C;  4LFB E;  1N32 E;  4M0V A;  4BCA A;  3KZY A;  1KYQ A;  3J80 C;  1A1K A;  2EM5 A;  1DI2 A;  4WXC A;  4AQY E;  2LE2 A;  4X9J A;  2I13 A;  1EH6 A;  2EMC A;  4DMI A;  5F3W A;  4WFT A;  3C4T A;  5ADZ A;  1YYO A;  2VE7 C;  1PJT A;  2ZM6 E;  3F6G A;  4DV4 E;  1A1L A;  4DR7 E;  2DGC A;  5AC4 A;  2R1F A;  3IWD A;  1EH7 A;  2EQ3 A;  4HEI A;  2EN2 A;  1N3G A;  1TN9 A;  2CTD A;  1YUI A;  1YFH A;  2EMY A;  2WZO A;  3J7A G;  2YPN A;  2EM3 A;  4O4K A;  3P1X A;  1N34 E;  2EL6 A;  2ODR C;  2YTJ A;  4DKK A;  4JI4 E;  1PKP A;  1BBO A;  4F9C B;  2B9D A;  2EMK A;  1WRJ A;  1LLM C;  4DV2 E;  2L3C A;  1X49 A;  5DNY A;  5A6K A;  2JVA A;  4LTY A;  4F6N A;  2L33 A;  2EOY A;  2ENH A;  3H09 A;  2G7H A;  4NXM E;  2YTD A;  4LF4 E;  1RMD A;  1T4N A;  5T6J A;  5A2Q C;  1J26 A;  2V87 A;  2EMX A;  3AV0 A;  1T38 A;  2UXD E;  1BBG A;  4Q35 B;  3VHT B;  2LTS A;  3LLH A;  2EPU A;  4O24 A;  1KJK A;  3IWB A;  4MLV A;  2V83 A;  2ELY A;  1TF3 A;  1GZ6 A;  2VRD A;  2UUB E;  1A1J A;  3VK6 A;  3IWC A;  1IBK E;  2N3G A;  1MGT A;  2EN6 A;  1X6E A;  2NUG A;  1A1F A;  2NAB A;  2EM4 A;  4L8N A;  4OX9 E;  1UBD C;  5BR8 E;  1HNX E;  1ZU1 A;  3MSW A;  2VF1 A;  4MLQ A;  1FJG E;  3BID A;  3HXL A;  1X5W A;  3MHS C;  4JYA E;  2VQF E;  2ENA A;  2B3T B;  2EL5 A;  1DQ3 A;  4ZYG A;  5AE3 A;  2YRH A;  1GQE A;  2V8Q B;  2DIX A;  1IQS A;  1UIL A;  4HTG A;  2M7Q A;  2I9I A;  2ADR A;  1SR9 A;  4JI0 E;  2JPA A;  2ODR D;  4TUI A;  2VQE E;  1HR0 E;  3EPL A;  2GLI A;  2L2K B;  2NUE A;  4B3T E;  2L6M A;  2WBU A;  1XMO E;  4M2Z A;  3F6H A;  4DR3 E;  4DV0 E;  2EN1 A;  3FIG A;  3L00 A;  4P7D A;  2L3J A;  5KL3 A;  4LF6 E;  5KL5 A;  2JY9 A;  2N3H A;  2R76 A;  2EOX A;  5A6B A;  4JI7 E;  2KHX A;  2CT1 A;  2EOE A;  2EPC A;  2JXP A;  2DRP A;  1X6H A;  1XNQ E;  1A1G A;  1PJQ A;  4JI2 E;  2EMZ A;  2LTR A;  4JI1 E;  2B7V A;  2EJ4 A;  1N33 E;  1X47 A;  3HQ1 A;  2LVH A;  1G2D C;  2M1S A;  2JP9 A;  1YYW A;  1PDA A;  4YY3 E;  5CFF E;  5IWA E;  4B3S E;  1Z1B A;  2GHF A;  4IJD A;  1RQ0 A;  4X65 E;  3HPZ A;  2UU9 E;  3ECR A;  2RSM A;  2MKD A;  2RQL A;  4WYQ B;  2RTX A;  4BC9 A;  2A25 A;  2EOI A;  3QG5 C;  2MC6 A;  2EOR A;  2KOU A;  2YWQ A;  4BHC A;  5A6B D;  1A1H A;  4LF8 E;  2EOO A;  2MDR A;  5AC5 A;  4ZYD A;  2J7J A;  3LML A;  4NZV A;  3J81 C;  2YRK A;  4R2C A;  2LJH A;  5LMU E;  2EQ1 A;  2FV4 B;  2EPK X;  2RSI A;  2EMG A;  2DB2 A;  4GKK E;  2H36 X;  4R2R A;  1IQO A;  3THO B;  4R2S A;  1JK2 A;  1O0W A;  2IHR 1;  2HJJ A;  3ADG A;  4JI6 E;  1XNR E;  2HGH A;  4N4R B;  4RH8 A;  4BS9 A;  2JOB A;  1QU6 A;  3KZZ A;  4GZN C;  2LBS B;  4WPY A;  2EPN A;  3KWR A;  3AUZ A;  2YSP A;  4J8Z A;  3JU0 A;  4P78 A;  2V85 A;  2EMA A;  4WX9 A;  2EN3 A;  2ELZ A;  1ZR9 A;  2EOQ A;  4R2P A;  4NXN E;  3EPK A;  1SFE A;  4WXD A;  4JI3 E;  2LO3 A;  2YT4 A;  5KL7 A;  2EWL A;  2D9H A;  2EM8 A;  4IS1 C;  1RC7 A;  2LUQ A;  4RHB B;  4KHP E;  2JOX A;  4M30 A;  2WCC 3;  1XMQ E;  3UK3 C;  4LF5 E;  4JI8 E;  3HPS A;  1ZBQ A;  1ZAA C;  1YYK A;  1STU A;  2BBG A;  2K7I A;  2NUF A;  2L8T A;  4F6M A;  1TF6 A;  1EH8 A;  2EMI A;  1AAY A;  2YTI A;  4GKJ E;  2EL4 A;  5FLX C;  4B3R E;  2DLK A;  4B3M E;  2E72 A;  2LRS A;  3DF6 A;  2EZ6 A;  2EPZ A;  2UXB E;  4DR5 E;  5A69 A;  5KL6 A;  1A1I A;  2EQ0 A;  4F9A B;  3VYY A;  2EPP A;  2V88 A;  2EPX A;  4LFC E;  2UUA E;  4M9V C;  2JWO A;  4R2A A;  2L2N A;  2EM2 A;  2YZT A;  1T4O A;  2UXC E;  5AAS A;  4X62 E;  2EE8 A;  1P47 A;  2Q8U A;  2DLQ A;  4YHH E;  2EOS A;  4Q28 A;  2L92 A;  4R2E A;  1UHZ A;  4I8O A;  4R2D A;  1X3C A;  2L2M A;  4GEQ B;  1F2I G;  4TUG A;  2MDG A;  2EN8 A;  1L4S A;  5LLQ A;  4X66 E;  5KL4 A;  4DR4 E;  5IXM B;  3BBG A;  4L5N C;  3DJW A;  2CSH A;  2EN4 A;  1WJP A;  1ZBT A;  1J5E E;  2YTE A;  3ADJ A;  2JR1 A;  1HNW E;  2EM9 A;  2YTN A;  4K0K E;  1NEI A;  3BGH A;  4WSP A;  4KWY A;  1WXR A;  1HNZ E;  2EOH A;  3C6M A;  3J7Y p;  4X64 E;  2EOZ A;  1PJS A;  2YTP A;  2HC5 A;  3OTO E;  3M99 B;  2M4I A;  1JK1 A;  3JAM C;  4OOG C;  1WHN A;  4DV1 E;  2LT7 A;  3EPJ A;  2EP3 A;  4DV5 E;  2YTO A;  2YU8 A;  2MKN A;  2EM7 A;  1YUJ A;  1T4L B;  5KL2 A;  2EOM A;  2RS7 A;  2LV2 A;  2EM6 A;  1YPN A;  2MC5 A;  3ADL A;  2EPL X;  2E1M A;  3T1Y E;  2EMB A;  2JYA A;  2F8B A;  5AE2 A;  2EMW A;  4BBY A;  5AE1 A;  1N36 E;  5IV8 B;  2RS6 A;  2HHH E;  2RPC A;  4LF9 E;  2DMI A;  3EQ1 A;  1IBL E;  1I94 E;  3BF2 A;  3ZOQ B;  2K4V A;  2EN7 A;  5LL6 R;  4LFA E;  1BB8 A;  2EMH A;  4ZYH A;  2LJU A;  5LMN E;  1EKZ A;  3T1H E;  2KON A;  2GPI A;  4WSG A; 
#chains in the Genus database with same CATH homology
 2JY9 A;  2N3H A;  4JI7 E;  2KHX A;  3IWD A;  4DR1 E;  4LF7 E;  4GKJ E;  1XNQ E;  4DV3 E;  5FLX C;  4LU9 A;  4B3R E;  4X8W A;  4B3M E;  2LMZ A;  2LRS A;  3DF6 A;  1IBM E;  4JI2 E;  2EZ6 A;  2LTR A;  2WZO A;  4JI1 E;  4DR5 E;  2B7V A;  3J7A G;  2UXB E;  2DMY A;  1N33 E;  4F9A B;  3VYY A;  2V88 A;  3P1X A;  3ADI A;  1X47 A;  3HQ1 A;  1N34 E;  4LFC E;  2M1S A;  2ODR C;  2UUA E;  4R8O A;  4BC7 A;  4DKK A;  1PKP A;  2JWO A;  2E5L E;  4JI4 E;  2L2N A;  4F9C B;  1YYW A;  2B9D A;  4YY3 E;  4KZS A;  3OML A;  2YZT A;  4DV2 E;  2L3C A;  1X49 A;  5CFF E;  5IWA E;  1T4O A;  5DNY A;  5AAS A;  2UUC E;  2NA2 A;  2JVA A;  4X62 E;  4B3S E;  3RMP A;  4LTY A;  4JV5 E;  1RQ0 A;  4X65 E;  3HPZ A;  2UU9 E;  4DUZ E;  2L33 A;  2RSM A;  4WYQ B;  2RTX A;  4BC9 A;  3H09 A;  2G7H A;  4YHH E;  4NXM E;  2MC6 A;  2KOU A;  4LF4 E;  4LF8 E;  1T4N A;  5T6J A;  4Q28 A;  2L92 A;  5A2Q C;  2F4V E;  1UHZ A;  2FTX B;  2MDR A;  4I8O A;  1J26 A;  2L2M A;  2V87 A;  4DV7 E;  3AV0 A;  4GEQ B;  3LML A;  3J81 C;  2V89 A;  4TUG A;  2UXD E;  4F9B B;  4X66 E;  2LTS A;  3LLH A;  2LJH A;  3JTZ A;  5LMU E;  4DR4 E;  4L5N C;  3DJW A;  4F54 A;  2FV4 B;  1ZBT A;  3IWB A;  1J5E E;  2V83 A;  3ADJ A;  2JR1 A;  2DB2 A;  4GKK E;  1HNW E;  2H36 X;  1GZ6 A;  3C4B A;  2UUB E;  3IWC A;  3VK6 A;  1IBK E;  3VYX A;  2N3G A;  4K0K E;  4WSP A;  2NUG A;  1YYK A;  1O0W A;  2IHR 1;  1WXR A;  1HNZ E;  3J7Y p;  3HTX A;  4X64 E;  3ADG A;  4JI6 E;  1XNR E;  2UXC E;  4L8N A;  4BS9 A;  4OX9 E;  2DSY A;  2JOB A;  5BR8 E;  1HNX E;  4DR2 E;  1QU6 A;  2LBS B;  4WPY A;  2B7T A;  3K6Q A;  2VF1 A;  2V86 A;  3AUZ A;  3KWR A;  2M4I A;  1WHQ A;  3MSW A;  3OTO E;  3JAM C;  4J8Z A;  1WHN A;  2FGG A;  3JU0 A;  4OOG C;  4DV1 E;  4DV6 E;  3HXL A;  4DUY E;  4P78 A;  2V85 A;  1FJG E;  4JYA E;  4DV5 E;  2VQF E;  1FKA E;  2B3T B;  1T4L B;  1DQ3 A;  1YZ9 A;  4BMJ A;  4JI5 E;  5AE3 A;  2RS7 A;  2CPN A;  2LUP B;  4DR6 E;  1GQE A;  2V8Q B;  2MC5 A;  2DIX A;  1UIL A;  4R03 A;  4NXN E;  3ADL A;  1X48 A;  2M7Q A;  2E1M A;  3T1Y E;  5IT9 C;  4JI3 E;  2F8B A;  1SR9 A;  4JI0 E;  5AE2 A;  2YT4 A;  4LFB E;  4BBY A;  2EWL A;  1N32 E;  2ODR D;  4M0V A;  4BCA A;  5AE1 A;  2RS6 A;  4TUI A;  2VQE E;  3J80 C;  1N36 E;  1HR0 E;  2HHH E;  2L2K B;  4LF9 E;  2NUE A;  4B3T E;  1RC7 A;  1IBL E;  1DI2 A;  1I94 E;  2L6M A;  2LUQ A;  4AQY E;  4KHP E;  2LE2 A;  3ZOQ B;  1XMO E;  2JOX A;  2K4V A;  4M2Z A;  4DMI A;  5F3W A;  3F6H A;  4WFT A;  4DR3 E;  4DV0 E;  3C4T A;  5LL6 R;  4M30 A;  1XMQ E;  4LFA E;  5ADZ A;  4LF5 E;  3FIG A;  4JI8 E;  5LMN E;  3HPS A;  1YYO A;  1EKZ A;  1ZBQ A;  4P7D A;  2VE7 C;  2ZM6 E;  2KON A;  1STU A;  3F6G A;  2L3J A;  4DV4 E;  3T1H E;  4LF6 E;  2NUF A;  4DR7 E;  2L8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...