2EWLA

Solution structure of the c-terminal domain (monomer) of the hpv45 oncoprotein e7
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
GSHMAEPQRHKILCVCCKCDGRIELTVESSAEDLRTLQQLFLSTLSFVCPWCATNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oncoprotein, virus/viral protein
molecule keywords Protein E7
publication title Solution structure of the partially folded high-risk human papilloma virus 45 oncoprotein E7.
pubmed doi rcsb
source organism Human papillomavirus
total genus 12
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.730 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2ewlA00
2EWLA 2F8BA
chains in the Genus database with same CATH superfamily
4R2AA 1MEYC 4O5GA 4X66E 2YTGA 1BBOA 1O0WA 2EZ6A 1ZBQA 1HNZE 2B9DA 2V87A 2LJHA 3C4BA 2EQ1A 5T6JA 1MGTA 1RQ0A 2GPIA 4LFAE 4LF8E 1YZ9A 4LU9A 1EKZA 4LF4E 2WBUA 2YRHA 2NUEA 5LL6R 1I94E 4NHRA 1T39A 4JI4E 5AC5A 2JPAA 2YRKA 4WX9A 2ENAA 4O43A 2YRMA 4NZVA 1YYOA 2BB8A 2JYAA 1IBLE 1EH8A 4LFBE 1FJGE 5CFFE 4TUGA 3IWDA 4DUYE 1A1GA 5IWAE 4HTGA 5DNYA 3LLHA 2EPXA 2EOEA 2YPNA 2WZOA 2YTJA 2EPNA 2ADRA 4JI6E 4WSGA 4BHCA 2EMZA 4X64E 4NXME 2V88A 1JK2A 3C4TA 4F2JC 2MC5A 4BMJA 2VQEE 3HXLA 2JXPA 2MC6A 2GLIA 2CT1A 3OTOE 2EPMX 5AASA 2LUPB 2L2KB 1A1IA 1PJQA 1G2FC 1JK1A 3HPZA 1L4SA 1DQ3A 3KZYA 2EOSA 2YSOA 3THNA 2ZM6E 4J8ZA 4F54A 1AAYA 2KONA 2H36X 4JV5E 3P1XA 1UILA 2E5LE 2EMXA 2WCC3 2NABA 4Q28A 2LCEA 1AH5A 2EL5A 5ADZA 2EL6A 2VQFE 1YFHA 2LBSB 1N33E 2EOZA 1WHQA 5AE3A 3EPHA 5KL3A 3MHSC 2YTOA 2B3TB 4RHBB 4DMIA 2EMYA 1YYWA 2EMBA 4F9CB 2GHFA 1DI2A 1PJTA 4KZSA 4LFCE 1PJSA 2LUQA 1ZU1A 3ADJA 4F6NA 2EOYA 2RSIA 4DV2E 2LO3A 1BB8A 1GTKA 2VRDA 4R2EA 1J5EE 5AE1A 2V85A 4YHHE 5IT9C 2ENHA 2M9AA 3IWCA 4JI0E 2EOMA 3EQ1A 3LMLA 1BBGA 2I13A 1A1KA 2EQ0A 2KOUA 3VYYA 5FLXC 2EM0A 2EWLA 2RPCA 2FTXB 2D9HA 4I8OA 2EP3A 1X3CA 2EM4A 4O4KA 4ZYDA 2DIXA 1HNXE 4L5NC 3UK3C 2JOXA 4DR1E 4L8NA 1LLMC 2YSPA 4WSPA 1XNRE 2EOQA 4GZNC 3MSWA 1YPNA 1B69A 5LLQA 2YWQA 2EPUA 2FGGA 4F9AB 2YTDA 1IQSA 4X8WA 2R1FA 2RSMA 4WXCA 2L6MA 4M0VA 2K7IA 1KYQA 3F6GA 4DV1E 1NCSA 2VE7C 5IV8B 5A6KA 2RTXA 1RC7A 2UU9E 2UUCE 1X6FA 2EM9A 2L3JA 2LT7A 2YU5A 2V86A 2DSYA 4ZYEA 3THOB 1GZ6A 4R2QA 4HEIA 2EM5A 2CPNA 4WYQB 3HPSA 4F6MA 2YTPA 3J7AG 1STUA 4P7DA 2DLKA 5KL2A 1J26A 2EMFA 2LV2A 2EE8A 4F9BB 1QNTA 3JTZA 2EM2A 2LVHA 1YUIA 4NXNE 1N32E 3J81C 4DR3E 2EN6A 1RMDA 2ELZA 5KL6A 1Z1BA 2WBSA 4B3ME 2NUFA 4DV0E 2E72A 2EN4A 4X65E 3EPLA 3DF6A 4R8OA 4BCAA 1UN6B 2RQLA 1X5WA 2K4VA 4DV6E 2YTNA 4ZYGA 4BS9A 2UXBE 2WBTA 2LTRA 4OX9E 2A25A 3FIGA 1GQEA 2RS7A 3DJWA 3VK6A 3K6QA 2JY9A 1T4NA 5A6BA 5F3WA 4N4RB 2EPZA 3J80C 3BGHA 2EMAA 2N8XA 4DV4E 1T4LB 4JYAE 1X6EA 4LTYA 3JAMC 4TUIA 4LF9E 1TF6A 4WFTA 4OOGC 2B7VA 2DMYA 4M2ZA 3T1HE 1XNQE 4WXDA 3BBGA 2L8TA 2LRSA 3VYXA 2CSHA 4YY3E 2EPRA 2VF1A 3EPKA 2RS6A 2KHXA 3KWRA 2HGHA 2M1SA 1WHNA 2UXDE 2EOIA 4K0KE 4AQYE 2EM3A 4DKKA 5A2QC 4DV3E 3C6KA 2V83A 3IWBA 2LE2A 4DV7E 1YYKA 4DV5E 2L33A 2IHR1 1N36E 3EPJA 2N3GA 1PDAA 2MKNA 2EPCA 5A6AA 4WPYA 3L00A 3RMPA 3AUZA 5A6BD 2NA2A 3BIDA 2UXCE 2L3CA 4R2PA 4Q35B 1ZAAC 2ODRC 2EORA 2YT4A 4ZYHA 4DR4E 4X9JA 1YSAC 1X49A 1NEIA 1ZBTA 4P78A 2EPAA 1P47A 4IS1C 5BR8E 2EN8A 3OMLA 1A1HA 3M99B 3MHHC 2YZTA 1X47A 4KHPE 2G7HA 1IBKE 2EPPA 5KL5A 3ECRA 2DB2A 2EM8A 2UUAE 2EPOA 2F4VE 2V89A 4M30A 3JU0A 2EL4A 4BC9A 2V8QB 2HHHE 4LF7E 1EH6A 2EN3A 1N3GA 1IQOA 2EN7A 2LMZA 2YU8A 1N34E 1XMQE 4JI2E 4LF5E 1FKAE 2JP9A 4GEQB 2YTIA 3AV0A 4KWYA 2LTSA 2CTDA 2EOJA 1ZR9A 2EM6A 2LJUA 1WJPA 2L2MA 1YUJA 2M4IA 4DR2E 4JI3E 1SR9A 2EMCA 2EMGA 3F6HA 1A1FA 2JVAA 2R76A 3HQ1A 4DUZE 1SFEA 2M7QA 3TQMA 2HJJA 4MLQA 4DR7E 1DGCA 2F8BA 4O24A 2JR1A 1EH7A 2NUGA 4BBYA 5A69A 5KL7A 1A1LA 2DGCA 2YTEA 2DLQA 3KZZA 3BF2A 4DR6E 1IMUA 2EN1A 4IJDA 3ZOQB 2N3HA 2EOFA 4B3SE 1F2IG 3ADIA 2L92A 5TSEA 2ODRD 4R2RA 5AC4A 1WRJA 1T38A 2E1MA 3QG5C 2EMKA 2PRTA 3C6MA 2EMIA 2MKDA 4B3RE 2EOHA 1T4OA 1XMOE 4GKKE 1HNWE 2EN2A 4R2DA 1TN9A 4RH8A 4X62E 2EMHA 1QU6A 2DMIA 2FV4B 3ADGA 4FK5C 2YTQA 2ELYA 1WXRA 5LMNE 5LMUE 4JI7E 2ENCA 5AE2A 3VHTB 4DR5E 2EPKX 2Q8UA 2J7JA 2UUBE 2JOBA 1UBDC 4JI8E 2MDGA 2I9IA 1G2DC 2EOXA 2L2NA 2EM7A 4M9VC 4MLVA 2B7TA 2HC5A 4B3TE 2EMLA 4GKJE 2EMWA 4LF6E 2EJ4A 1X48A 2YTFA 4R2CA 4R2SA 2BBGA 3T1YE 3H09A 4R03A 1IBME 1UHZA 4JI1E 2DRPA 5IXMB 2EOOA 4JI5E 2EQ3A 3HTXA 1A1JA 2EPLX 1PKPA 4BC7A 2MDRA 1TF3A 3ADLA 5A6JA 3J7Yp 2JWOA 1KJKA 1HR0E 5KL4A 1X6HA 4BHBA
chains in the Genus database with same CATH topology
3LMLA 4JI2E 4LF5E 3K6QA 1FKAE 2JY9A 1T4NA 5F3WA 4GEQB 2KOUA 3VYYA 5FLXC 3J80C 4X66E 2EWLA 3AV0A 1O0WA 2EZ6A 1ZBQA 2FTXB 2LTSA 2B9DA 2V87A 2LJHA 4DV4E 1HNZE 4I8OA 3C4BA 2L2MA 1T4LB 4JI0E 2M4IA 4LTYA 4DR2E 3JAMC 4JI3E 4JYAE 4TUIA 4LF9E 5T6JA 1RQ0A 1SR9A 2B7VA 2DMYA 4WFTA 2DIXA 4LU9A 4OOGC 1EKZA 1HNXE 4LF4E 4L5NC 4LFAE 4LF8E 3F6HA 3T1HE 4M2ZA 1XNQE 2JOXA 2JVAA 2NUEA 3HQ1A 2L8TA 2LRSA 5LL6R 4DUZE 4L8NA 4DR1E 1I94E 3VYXA 1YZ9A 2M7QA 4YY3E 3RMPA 4WSPA 2VF1A 4JI4E 2RS6A 2KHXA 1XNRE 4DR7E 3MSWA 3KWRA 2F8BA 2JR1A 1YYOA 1IBLE 4LFBE 2NUGA 4BBYA 2FGGA 2M1SA 4F9AB 1FJGE 1WHNA 3IWCA 5CFFE 2UXDE 4TUGA 3IWDA 4DUYE 4K0KE 4AQYE 5IWAE 4DKKA 4DR6E 5DNYA 5A2QC 3LLHA 4X8WA 3ZOQB 2RSMA 4DV3E 2N3HA 2L6MA 4M0VA 2WZOA 4B3SE 3ADIA 3F6GA 4JI6E 4DV1E 2L92A 2V83A 2VE7C 3IWBA 2ODRD 2RTXA 2LE2A 4X64E 4NXME 2E1MA 2V88A 1RC7A 3C4TA 4DV7E 2UU9E 2UUCE 1YYKA 2L3JA 2MC5A 4DV5E 2L33A 4BMJA 2V86A 2IHR1 2DSYA 2VQEE 3HXLA 1N36E 2MC6A 4B3RE 1GZ6A 1T4OA 2N3GA 1XMOE 3OTOE 4GKKE 1HNWE 5AASA 2LUPB 4X62E 2L2KB 4WPYA 1QU6A 2CPNA 2FV4B 3ADGA 3AUZA 3HPZA 1DQ3A 3HPSA 4WYQB 1WXRA 2NA2A 5LMNE 5LMUE 1XMQE 4JI7E 2ZM6E 2UXCE 2L3CA 3J7AG 4J8ZA 5AE2A 1STUA 4DR5E 4F54A 4P7DA 2KONA 2H36X 4JV5E 2ODRC 1J26A 3P1XA 1UILA 2E5LE 2YT4A 2UUBE 2JOBA 4F9BB 4JI8E 3JTZA 4Q28A 4DR4E 4NXNE 5ADZA 2VQFE 1X49A 1N32E 3J81C 2L2NA 4DR3E 1ZBTA 2LBSB 1N33E 4P78A 2B7TA 4B3TE 1WHQA 5BR8E 3OMLA 5AE3A 4GKJE 4LF6E 2B3TB 3VK6A 4DMIA 2NUFA 4B3ME 2YZTA 1X48A 1X47A 4F9CB 1YYWA 4KHPE 4DV0E 1DI2A 4X65E 2G7HA 1IBKE 3DF6A 4KZSA 3T1YE 3H09A 4R8OA 4BCAA 2DB2A 4LFCE 4R03A 1IBME 1UHZA 2LUQA 4JI1E 2UUAE 3ADJA 4DV6E 2K4VA 2F4VE 2V89A 4DV2E 4M30A 3JU0A 4JI5E 3HTXA 4BS9A 1PKPA 4BC7A 2MDRA 2UXBE 4BC9A 3ADLA 2V8QB 1J5EE 2LTRA 5AE1A 2V85A 3J7Yp 4YHHE 2HHHE 4LF7E 4OX9E 2JWOA 5IT9C 3FIGA 1HR0E 1GQEA 2LMZA 2RS7A 1N34E 3DJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EWL A;  2F8B A; 
#chains in the Genus database with same CATH topology
 4R2A A;  1MEY C;  4O5G A;  4X66 E;  2YTG A;  1BBO A;  1O0W A;  2EZ6 A;  1ZBQ A;  1HNZ E;  2B9D A;  2V87 A;  2LJH A;  3C4B A;  2EQ1 A;  5T6J A;  1MGT A;  1RQ0 A;  2GPI A;  4LFA E;  4LF8 E;  1YZ9 A;  4LU9 A;  1EKZ A;  4LF4 E;  2WBU A;  2YRH A;  2NUE A;  5LL6 R;  1I94 E;  4NHR A;  1T39 A;  4JI4 E;  5AC5 A;  2JPA A;  2YRK A;  4WX9 A;  2ENA A;  4O43 A;  2YRM A;  4NZV A;  1YYO A;  2BB8 A;  2JYA A;  1IBL E;  1EH8 A;  4LFB E;  1FJG E;  5CFF E;  4TUG A;  3IWD A;  4DUY E;  1A1G A;  5IWA E;  4HTG A;  5DNY A;  3LLH A;  2EPX A;  2EOE A;  2YPN A;  2WZO A;  2YTJ A;  2EPN A;  2ADR A;  4JI6 E;  4WSG A;  4BHC A;  2EMZ A;  4X64 E;  4NXM E;  2V88 A;  1JK2 A;  3C4T A;  4F2J C;  2MC5 A;  4BMJ A;  2VQE E;  3HXL A;  2JXP A;  2MC6 A;  2GLI A;  2CT1 A;  3OTO E;  2EPM X;  5AAS A;  2LUP B;  2L2K B;  1A1I A;  1PJQ A;  1G2F C;  1JK1 A;  3HPZ A;  1L4S A;  1DQ3 A;  3KZY A;  2EOS A;  2YSO A;  3THN A;  2ZM6 E;  4J8Z A;  4F54 A;  1AAY A;  2KON A;  2H36 X;  4JV5 E;  3P1X A;  1UIL A;  2E5L E;  2EMX A;  2WCC 3;  2NAB A;  4Q28 A;  2LCE A;  1AH5 A;  2EL5 A;  5ADZ A;  2EL6 A;  2VQF E;  1YFH A;  2LBS B;  1N33 E;  2EOZ A;  1WHQ A;  5AE3 A;  3EPH A;  5KL3 A;  3MHS C;  2YTO A;  2B3T B;  4RHB B;  4DMI A;  2EMY A;  1YYW A;  2EMB A;  4F9C B;  2GHF A;  1DI2 A;  1PJT A;  4KZS A;  4LFC E;  1PJS A;  2LUQ A;  1ZU1 A;  3ADJ A;  4F6N A;  2EOY A;  2RSI A;  4DV2 E;  2LO3 A;  1BB8 A;  1GTK A;  2VRD A;  4R2E A;  1J5E E;  5AE1 A;  2V85 A;  4YHH E;  5IT9 C;  2ENH A;  2M9A A;  3IWC A;  4JI0 E;  2EOM A;  3EQ1 A;  3LML A;  1BBG A;  2I13 A;  1A1K A;  2EQ0 A;  2KOU A;  3VYY A;  5FLX C;  2EM0 A;  2EWL A;  2RPC A;  2FTX B;  2D9H A;  4I8O A;  2EP3 A;  1X3C A;  2EM4 A;  4O4K A;  4ZYD A;  2DIX A;  1HNX E;  4L5N C;  3UK3 C;  2JOX A;  4DR1 E;  4L8N A;  1LLM C;  2YSP A;  4WSP A;  1XNR E;  2EOQ A;  4GZN C;  3MSW A;  1YPN A;  1B69 A;  5LLQ A;  2YWQ A;  2EPU A;  2FGG A;  4F9A B;  2YTD A;  1IQS A;  4X8W A;  2R1F A;  2RSM A;  4WXC A;  2L6M A;  4M0V A;  2K7I A;  1KYQ A;  3F6G A;  4DV1 E;  1NCS A;  2VE7 C;  5IV8 B;  5A6K A;  2RTX A;  1RC7 A;  2UU9 E;  2UUC E;  1X6F A;  2EM9 A;  2L3J A;  2LT7 A;  2YU5 A;  2V86 A;  2DSY A;  4ZYE A;  3THO B;  1GZ6 A;  4R2Q A;  4HEI A;  2EM5 A;  2CPN A;  4WYQ B;  3HPS A;  4F6M A;  2YTP A;  3J7A G;  1STU A;  4P7D A;  2DLK A;  5KL2 A;  1J26 A;  2EMF A;  2LV2 A;  2EE8 A;  4F9B B;  1QNT A;  3JTZ A;  2EM2 A;  2LVH A;  1YUI A;  4NXN E;  1N32 E;  3J81 C;  4DR3 E;  2EN6 A;  1RMD A;  2ELZ A;  5KL6 A;  1Z1B A;  2WBS A;  4B3M E;  2NUF A;  4DV0 E;  2E72 A;  2EN4 A;  4X65 E;  3EPL A;  3DF6 A;  4R8O A;  4BCA A;  1UN6 B;  2RQL A;  1X5W A;  2K4V A;  4DV6 E;  2YTN A;  4ZYG A;  4BS9 A;  2UXB E;  2WBT A;  2LTR A;  4OX9 E;  2A25 A;  3FIG A;  1GQE A;  2RS7 A;  3DJW A;  3VK6 A;  3K6Q A;  2JY9 A;  1T4N A;  5A6B A;  5F3W A;  4N4R B;  2EPZ A;  3J80 C;  3BGH A;  2EMA A;  2N8X A;  4DV4 E;  1T4L B;  4JYA E;  1X6E A;  4LTY A;  3JAM C;  4TUI A;  4LF9 E;  1TF6 A;  4WFT A;  4OOG C;  2B7V A;  2DMY A;  4M2Z A;  3T1H E;  1XNQ E;  4WXD A;  3BBG A;  2L8T A;  2LRS A;  3VYX A;  2CSH A;  4YY3 E;  2EPR A;  2VF1 A;  3EPK A;  2RS6 A;  2KHX A;  3KWR A;  2HGH A;  2M1S A;  1WHN A;  2UXD E;  2EOI A;  4K0K E;  4AQY E;  2EM3 A;  4DKK A;  5A2Q C;  4DV3 E;  3C6K A;  2V83 A;  3IWB A;  2LE2 A;  4DV7 E;  1YYK A;  4DV5 E;  2L33 A;  2IHR 1;  1N36 E;  3EPJ A;  2N3G A;  1PDA A;  2MKN A;  2EPC A;  5A6A A;  4WPY A;  3L00 A;  3RMP A;  3AUZ A;  5A6B D;  2NA2 A;  3BID A;  2UXC E;  2L3C A;  4R2P A;  4Q35 B;  1ZAA C;  2ODR C;  2EOR A;  2YT4 A;  4ZYH A;  4DR4 E;  4X9J A;  1YSA C;  1X49 A;  1NEI A;  1ZBT A;  4P78 A;  2EPA A;  1P47 A;  4IS1 C;  5BR8 E;  2EN8 A;  3OML A;  1A1H A;  3M99 B;  3MHH C;  2YZT A;  1X47 A;  4KHP E;  2G7H A;  1IBK E;  2EPP A;  5KL5 A;  3ECR A;  2DB2 A;  2EM8 A;  2UUA E;  2EPO A;  2F4V E;  2V89 A;  4M30 A;  3JU0 A;  2EL4 A;  4BC9 A;  2V8Q B;  2HHH E;  4LF7 E;  1EH6 A;  2EN3 A;  1N3G A;  1IQO A;  2EN7 A;  2LMZ A;  2YU8 A;  1N34 E;  1XMQ E;  4JI2 E;  4LF5 E;  1FKA E;  2JP9 A;  4GEQ B;  2YTI A;  3AV0 A;  4KWY A;  2LTS A;  2CTD A;  2EOJ A;  1ZR9 A;  2EM6 A;  2LJU A;  1WJP A;  2L2M A;  1YUJ A;  2M4I A;  4DR2 E;  4JI3 E;  1SR9 A;  2EMC A;  2EMG A;  3F6H A;  1A1F A;  2JVA A;  2R76 A;  3HQ1 A;  4DUZ E;  1SFE A;  2M7Q A;  3TQM A;  2HJJ A;  4MLQ A;  4DR7 E;  1DGC A;  2F8B A;  4O24 A;  2JR1 A;  1EH7 A;  2NUG A;  4BBY A;  5A69 A;  5KL7 A;  1A1L A;  2DGC A;  2YTE A;  2DLQ A;  3KZZ A;  3BF2 A;  4DR6 E;  1IMU A;  2EN1 A;  4IJD A;  3ZOQ B;  2N3H A;  2EOF A;  4B3S E;  1F2I G;  3ADI A;  2L92 A;  5TSE A;  2ODR D;  4R2R A;  5AC4 A;  1WRJ A;  1T38 A;  2E1M A;  3QG5 C;  2EMK A;  2PRT A;  3C6M A;  2EMI A;  2MKD A;  4B3R E;  2EOH A;  1T4O A;  1XMO E;  4GKK E;  1HNW E;  2EN2 A;  4R2D A;  1TN9 A;  4RH8 A;  4X62 E;  2EMH A;  1QU6 A;  2DMI A;  2FV4 B;  3ADG A;  4FK5 C;  2YTQ A;  2ELY A;  1WXR A;  5LMN E;  5LMU E;  4JI7 E;  2ENC A;  5AE2 A;  3VHT B;  4DR5 E;  2EPK X;  2Q8U A;  2J7J A;  2UUB E;  2JOB A;  1UBD C;  4JI8 E;  2MDG A;  2I9I A;  1G2D C;  2EOX A;  2L2N A;  2EM7 A;  4M9V C;  4MLV A;  2B7T A;  2HC5 A;  4B3T E;  2EML A;  4GKJ E;  2EMW A;  4LF6 E;  2EJ4 A;  1X48 A;  2YTF A;  4R2C A;  4R2S A;  2BBG A;  3T1Y E;  3H09 A;  4R03 A;  1IBM E;  1UHZ A;  4JI1 E;  2DRP A;  5IXM B;  2EOO A;  4JI5 E;  2EQ3 A;  3HTX A;  1A1J A;  2EPL X;  1PKP A;  4BC7 A;  2MDR A;  1TF3 A;  3ADL A;  5A6J A;  3J7Y p;  2JWO A;  1KJK A;  1HR0 E;  5KL4 A;  1X6H A;  4BHB A; 
#chains in the Genus database with same CATH homology
 3LML A;  4JI2 E;  4LF5 E;  3K6Q A;  1FKA E;  2JY9 A;  1T4N A;  5F3W A;  4GEQ B;  2KOU A;  3VYY A;  5FLX C;  3J80 C;  4X66 E;  2EWL A;  3AV0 A;  1O0W A;  2EZ6 A;  1ZBQ A;  2FTX B;  2LTS A;  2B9D A;  2V87 A;  2LJH A;  4DV4 E;  1HNZ E;  4I8O A;  3C4B A;  2L2M A;  1T4L B;  4JI0 E;  2M4I A;  4LTY A;  4DR2 E;  3JAM C;  4JI3 E;  4JYA E;  4TUI A;  4LF9 E;  5T6J A;  1RQ0 A;  1SR9 A;  2B7V A;  2DMY A;  4WFT A;  2DIX A;  4LU9 A;  4OOG C;  1EKZ A;  1HNX E;  4LF4 E;  4L5N C;  4LFA E;  4LF8 E;  3F6H A;  3T1H E;  4M2Z A;  1XNQ E;  2JOX A;  2JVA A;  2NUE A;  3HQ1 A;  2L8T A;  2LRS A;  5LL6 R;  4DUZ E;  4L8N A;  4DR1 E;  1I94 E;  3VYX A;  1YZ9 A;  2M7Q A;  4YY3 E;  3RMP A;  4WSP A;  2VF1 A;  4JI4 E;  2RS6 A;  2KHX A;  1XNR E;  4DR7 E;  3MSW A;  3KWR A;  2F8B A;  2JR1 A;  1YYO A;  1IBL E;  4LFB E;  2NUG A;  4BBY A;  2FGG A;  2M1S A;  4F9A B;  1FJG E;  1WHN A;  3IWC A;  5CFF E;  2UXD E;  4TUG A;  3IWD A;  4DUY E;  4K0K E;  4AQY E;  5IWA E;  4DKK A;  4DR6 E;  5DNY A;  5A2Q C;  3LLH A;  4X8W A;  3ZOQ B;  2RSM A;  4DV3 E;  2N3H A;  2L6M A;  4M0V A;  2WZO A;  4B3S E;  3ADI A;  3F6G A;  4JI6 E;  4DV1 E;  2L92 A;  2V83 A;  2VE7 C;  3IWB A;  2ODR D;  2RTX A;  2LE2 A;  4X64 E;  4NXM E;  2E1M A;  2V88 A;  1RC7 A;  3C4T A;  4DV7 E;  2UU9 E;  2UUC E;  1YYK A;  2L3J A;  2MC5 A;  4DV5 E;  2L33 A;  4BMJ A;  2V86 A;  2IHR 1;  2DSY A;  2VQE E;  3HXL A;  1N36 E;  2MC6 A;  4B3R E;  1GZ6 A;  1T4O A;  2N3G A;  1XMO E;  3OTO E;  4GKK E;  1HNW E;  5AAS A;  2LUP B;  4X62 E;  2L2K B;  4WPY A;  1QU6 A;  2CPN A;  2FV4 B;  3ADG A;  3AUZ A;  3HPZ A;  1DQ3 A;  3HPS A;  4WYQ B;  1WXR A;  2NA2 A;  5LMN E;  5LMU E;  1XMQ E;  4JI7 E;  2ZM6 E;  2UXC E;  2L3C A;  3J7A G;  4J8Z A;  5AE2 A;  1STU A;  4DR5 E;  4F54 A;  4P7D A;  2KON A;  2H36 X;  4JV5 E;  2ODR C;  1J26 A;  3P1X A;  1UIL A;  2E5L E;  2YT4 A;  2UUB E;  2JOB A;  4F9B B;  4JI8 E;  3JTZ A;  4Q28 A;  4DR4 E;  4NXN E;  5ADZ A;  2VQF E;  1X49 A;  1N32 E;  3J81 C;  2L2N A;  4DR3 E;  1ZBT A;  2LBS B;  1N33 E;  4P78 A;  2B7T A;  4B3T E;  1WHQ A;  5BR8 E;  3OML A;  5AE3 A;  4GKJ E;  4LF6 E;  2B3T B;  3VK6 A;  4DMI A;  2NUF A;  4B3M E;  2YZT A;  1X48 A;  1X47 A;  4F9C B;  1YYW A;  4KHP E;  4DV0 E;  1DI2 A;  4X65 E;  2G7H A;  1IBK E;  3DF6 A;  4KZS A;  3T1Y E;  3H09 A;  4R8O A;  4BCA A;  2DB2 A;  4LFC E;  4R03 A;  1IBM E;  1UHZ A;  2LUQ A;  4JI1 E;  2UUA E;  3ADJ A;  4DV6 E;  2K4V A;  2F4V E;  2V89 A;  4DV2 E;  4M30 A;  3JU0 A;  4JI5 E;  3HTX A;  4BS9 A;  1PKP A;  4BC7 A;  2MDR A;  2UXB E;  4BC9 A;  3ADL A;  2V8Q B;  1J5E E;  2LTR A;  5AE1 A;  2V85 A;  3J7Y p;  4YHH E;  2HHH E;  4LF7 E;  4OX9 E;  2JWO A;  5IT9 C;  3FIG A;  1HR0 E;  1GQE A;  2LMZ A;  2RS7 A;  1N34 E;  3DJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...