2EWLA

Solution structure of the c-terminal domain (monomer) of the hpv45 oncoprotein e7
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
GSHMAEPQRHKILCVCCKCDGRIELTVESSAEDLRTLQQLFLSTLSFVCPWCATNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the partially folded high-risk human papilloma virus 45 oncoprotein E7.
pubmed doi rcsb
source organism Human papillomavirus
molecule tags Oncoprotein, virus/viral protein
molecule keywords Protein E7
total genus 12
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.730 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2ewlA00
2F8BA 2EWLA
chains in the Genus database with same CATH superfamily
3HPZA 2LT7A 1KJKA 2ELYA 4F2JC 1IQOA 2YU5A 1IBME 2E1MA 1WHNA 2RS6A 1TN9A 1DI2A 1YPNA 2LJUA 4LFCE 3ADGA 3F6GA 4OOGC 3J81C 2ZM6E 2EN8A 4BCAA 1IMUA 2EOSA 4Q35B 1HNWE 3EPKA 5LLQA 2EP3A 3ADIA 2ODRC 2EPPA 1HNXE 4LU9A 4P7DA 3AV0A 4DV6E 1MGTA 4X62E 2MDGA 3EPJA 2JPAA 2L3JA 2B7TA 2YTOA 2YTDA 3ECRA 2ENHA 2EPZA 2ENCA 2JR1A 2YTFA 3H09A 3JU0A 4X66E 2RSIA 1G2DC 1FKAE 2EM4A 4L5NC 1IQSA 2F8BA 4JI8E 2VRDA 2DRPA 2LMZA 4GKKE 2L2MA 4BHBA 3MHHC 1QNTA 3DJWA 2B7VA 4RH8A 3C6MA 4HEIA 1X6HA 4WXCA 1EH6A 2J7JA 2UUAE 2EOXA 5AC5A 4J8ZA 4I8OA 2EMYA 2DLKA 4R2DA 2EL4A 1LLMC 4M2ZA 4OX9E 1PJSA 2EOIA 2V8QB 2FTXB 1XNQE 2EPKX 1RMDA 3KZZA 2MC6A 2RPCA 2V85A 2EJ4A 3AUZA 3VHTB 1YSAC 2UUCE 5ADZA 2EOQA 4F54A 1X6EA 2YTJA 4WPYA 4LF9E 1N32E 1T4NA 2LRSA 5KL5A 2LBSB 1GTKA 2EOMA 1BBGA 4WXDA 3IWCA 5KL4A 2EWLA 2L2NA 1HR0E 5A6BD 5A69A 3JAMC 2LTRA 2B9DA 4JI4E 1YYOA 1YZ9A 2DSYA 2D9HA 2LCEA 2PRTA 2LV2A 2NUFA 4B3TE 4LF4E 4LFAE 1STUA 2YTNA 2IHR1 2EOJA 2KOUA 2EPXA 3FIGA 1N34E 1J5EE 3P1XA 2VQEE 5AC4A 5AE1A 4BBYA 2L6MA 1X6FA 2EM0A 1T39A 1N36E 1MEYC 1UBDC 1FJGE 4R2QA 4NXME 4GKJE 4ZYDA 3VK6A 3OMLA 1KYQA 2EM7A 2DIXA 1A1FA 3RMPA 2EM6A 2MKNA 2YPNA 4ZYEA 4B3ME 2EMGA 3DF6A 2DB2A 4M9VC 4O4KA 1F2IG 2YTEA 4R2CA 4DUYE 4DR7E 4R2AA 3BBGA 2WBSA 2EN3A 2EOZA 2HC5A 3OTOE 2L33A 4ZYHA 2EPOA 2CT1A 5F3WA 2EOYA 3VYYA 5KL6A 1PJQA 2EOEA 5IT9C 3TQMA 3IWBA 2EQ0A 5IV8B 2EPCA 2YT4A 2YZTA 3J7AG 2EN1A 2YRMA 2Q8UA 2NUEA 4BHCA 2HJJA 4R2SA 2YSOA 1RC7A 3HTXA 2NABA 1TF3A 2WZOA 4KZSA 5A6AA 4F9BB 4JI5E 2V83A 4B3SE 2RQLA 3UK3C 5TSEA 3ADJA 1YYKA 2V87A 1TF6A 5AASA 4WYQB 4DKKA 3LMLA 5CFFE 2L92A 4NZVA 2EQ3A 1X49A 3K6QA 4GZNC 2M1SA 4BC9A 4DV2E 4R2EA 2GHFA 2V86A 2LTSA 4DR1E 1JK2A 2GLIA 1BB8A 2KONA 4BS9A 4DR6E 5LL6R 1X48A 2RSMA 2EPLX 4F6NA 1AH5A 4X64E 5A2QC 1XMQE 1N33E 2CTDA 1HNZE 4X8WA 4B3RE 2JP9A 2BBGA 4X9JA 2ENAA 2EPNA 2YTGA 5LMUE 4R03A 1EH8A 4JI7E 2LVHA 2FV4B 2GPIA 4IJDA 1NEIA 2UU9E 2WBUA 4F6MA 1A1JA 4R8OA 2MDRA 2L8TA 5KL3A 2L3CA 1IBKE 2DMIA 4BMJA 1X3CA 4AQYE 3HXLA 2M4IA 4DR4E 3THNA 5IXMB 2JOXA 1ZBTA 2EN2A 2EZ6A 1T4LB 2N3HA 1Z1BA 3F6HA 2EM3A 3L00A 1GQEA 2M9AA 4R2PA 2EOOA 4TUGA 2EMBA 2K4VA 4DUZE 4DR5E 2EMWA 2DGCA 3ADLA 2N8XA 3MSWA 5AE3A 4NHRA 1ZR9A 3MHSC 2EMAA 2JVAA 4KWYA 1BBOA 4JV5E 1QU6A 2DMYA 3EPLA 2EN7A 5BR8E 3LLHA 4LF8E 1YUJA 3T1HE 1L4SA 4K0KE 4BC7A 1G2FC 4JI2E 2EMXA 4LF5E 5A6BA 4RHBB 3JTZA 4WSGA 4DV5E 3KZYA 4MLQA 2NUGA 2EM2A 1PJTA 4HTGA 5LMNE 1A1LA 1WXRA 1X5WA 2RTXA 2EPAA 2UXDE 2YTQA 3T1YE 1SFEA 2CSHA 2MC5A 2I9IA 1PKPA 2R76A 3BF2A 2ELZA 2EOFA 2JY9A 1P47A 3THOB 2M7QA 5IWAE 1YFHA 1EKZA 4L8NA 4O5GA 5T6JA 3C6KA 5A6JA 1T38A 3HPSA 2YRKA 4P78A 4YHHE 1WRJA 1B69A 2JXPA 2HGHA 4WX9A 2JYAA 2EPMX 1JK1A 1J26A 2EE8A 2V88A 2YTIA 4O24A 2CPNA 4DMIA 1I94E 4DR2E 1A1HA 1RQ0A 1EH7A 2G7HA 2FGGA 4DR3E 4JI1E 3IWDA 2DLQA 4JI6E 2E5LE 5A6KA 2WCC3 4MLVA 4DV1E 4DV0E 2LUPB 2N3GA 4M0VA 1O0WA 4YY3E 2YWQA 4F9AB 1DGCA 2EMZA 5DNYA 1IBLE 2EMKA 4ZYGA 2UXBE 2EM5A 2VQFE 3ZOQB 3HQ1A 5KL2A 4TUIA 3EPHA 1XMOE 4X65E 2K7IA 2EMIA 4LF7E 1A1GA 2A25A 1ZAAC 1YYWA 4WFTA 1SR9A 2WBTA 2EM8A 4N4RB 2F4VE 4LFBE 2ADRA 2VE7C 2H36X 1A1IA 1UHZA 2EMFA 2EM9A 4IS1C 1WJPA 2B3TB 2EOHA 3J7Yp 2LJHA 2L2KB 1GZ6A 1PDAA 2VF1A 1NCSA 3M99B 4JYAE 2KHXA 1XNRE 2EL6A 3EQ1A 1A1KA 2HHHE 4DV3E 3C4BA 4JI0E 4GEQB 2YU8A 4M30A 3QG5C 1T4OA 2RS7A 2NA2A 2MKDA 2JOBA 5FLXC 4Q28A 1WHQA 1ZU1A 2E72A 4R2RA 3C4TA 4DV4E 2YSPA 2YRHA 2LO3A 2ODRD 2EMCA 2EORA 2V89A 5KL7A 2LE2A 4JI3E 1UILA 2EPUA 2UXCE 2LUQA 3KWRA 5AE2A 2BB8A 2EPRA 4F9CB 1AAYA 2EN4A 4NXNE 1YUIA 2R1FA 1UN6B 1ZBQA 4O43A 2JWOA 2EMLA 4FK5C 4WSPA 3VYXA 3J80C 3BGHA 2EN6A 2EMHA 1DQ3A 2EQ1A 4KHPE 2I13A 4LF6E 4DV7E 1N3GA 4LTYA 1X47A 2UUBE 3BIDA 2YTPA 2EL5A
chains in the Genus database with same CATH topology
3HPZA 1ZBTA 1DI2A 1IBME 2E1MA 1WHNA 2G7HA 2RS6A 2FGGA 4NXME 4DR3E 4LFCE 4JI1E 1T4LB 3IWDA 2N3HA 2EZ6A 4GKJE 3ADGA 3F6GA 3F6HA 3OMLA 4OOGC 3VK6A 3J81C 2ZM6E 4BCAA 2E5LE 2DIXA 1GQEA 4DV1E 4DV0E 2LUPB 2N3GA 3RMPA 4TUGA 4M0VA 1O0WA 4B3ME 2K4VA 4DUZE 4YY3E 4F9AB 1HNWE 3DF6A 4DR5E 2DB2A 5DNYA 3ADLA 1IBLE 3MSWA 5AE3A 2UXBE 3ADIA 2ODRC 2JVAA 2VQFE 3ZOQB 3HQ1A 1HNXE 4LU9A 4P7DA 3AV0A 4DUYE 4DV6E 4DR7E 4TUIA 4JV5E 4X62E 1QU6A 1XMOE 2DMYA 4X65E 4LF7E 2L3JA 2B7TA 2L33A 3OTOE 1YYWA 4WFTA 5BR8E 5F3WA 3VYYA 1SR9A 2F4VE 5IT9C 3LLHA 4LF8E 2JR1A 4LFBE 3H09A 3IWBA 3JU0A 4X66E 3T1HE 1FKAE 2YT4A 2YZTA 2VE7C 4L5NC 3J7AG 4K0KE 4BC7A 2H36X 2F8BA 4JI8E 1UHZA 4JI2E 2NUEA 2LMZA 4GKKE 2L2MA 2B3TB 3J7Yp 4LF5E 3JTZA 2LJHA 4DV5E 2L2KB 1GZ6A 3DJWA 2B7VA 1RC7A 3HTXA 2VF1A 2WZOA 2KHXA 4KZSA 1XNRE 4JYAE 2NUGA 4F9BB 4JI5E 2V83A 4DV3E 3C4BA 2HHHE 4B3SE 4JI0E 5LMNE 2UUAE 3ADJA 4GEQB 1WXRA 1YYKA 2V87A 4J8ZA 4M30A 4I8OA 5AASA 4WYQB 4DKKA 1T4OA 3LMLA 2RTXA 2UXDE 2RS7A 2NA2A 5CFFE 2L92A 4M2ZA 4OX9E 3T1YE 2MC5A 1X49A 2JOBA 2V8QB 5FLXC 3K6QA 2FTXB 1PKPA 2M1SA 4Q28A 4BC9A 1XNQE 1WHQA 4DV2E 2V86A 2JY9A 2MC6A 2V85A 4JI6E 2LTSA 3C4TA 4DV4E 4DR1E 2KONA 4BS9A 2M7QA 5LL6R 5IWAE 4DR6E 2ODRD 3AUZA 1EKZA 2UUCE 1X48A 2V89A 4L8NA 5ADZA 2LE2A 2RSMA 5T6JA 4F54A 4JI3E 4X64E 5A2QC 4WPYA 4LF9E 1N32E 1XMQE 3HPSA 1UILA 5AE1A 1N33E 2LRSA 2LUQA 1T4NA 3KWRA 5AE2A 2LBSB 1HNZE 2UXCE 4X8WA 4LF6E 4F9CB 4B3RE 3IWCA 4NXNE 2EWLA 2L2NA 1HR0E 5LMUE 3JAMC 2LTRA 1ZBQA 4P78A 4R03A 2B9DA 4YHHE 4JI4E 4JI7E 1YYOA 2JWOA 2FV4B 2UU9E 1YZ9A 2DSYA 4R8OA 1J26A 4WSPA 2NUFA 3VYXA 2MDRA 3J80C 4B3TE 2L8TA 2V88A 2CPNA 4LF4E 2L3CA 1STUA 1IBKE 4DMIA 4LFAE 1DQ3A 2IHR1 4BMJA 1I94E 4KHPE 2KOUA 4DV7E 4LTYA 3FIGA 4AQYE 1N34E 3HXLA 1X47A 4DR2E 3P1XA 2M4IA 1J5EE 2UUBE 4DR4E 2VQEE 2JOXA 1RQ0A 4BBYA 2L6MA 1N36E 1FJGE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F8B A;  2EWL A; 
#chains in the Genus database with same CATH topology
 3HPZ A;  2LT7 A;  1KJK A;  2ELY A;  4F2J C;  1IQO A;  2YU5 A;  1IBM E;  2E1M A;  1WHN A;  2RS6 A;  1TN9 A;  1DI2 A;  1YPN A;  2LJU A;  4LFC E;  3ADG A;  3F6G A;  4OOG C;  3J81 C;  2ZM6 E;  2EN8 A;  4BCA A;  1IMU A;  2EOS A;  4Q35 B;  1HNW E;  3EPK A;  5LLQ A;  2EP3 A;  3ADI A;  2ODR C;  2EPP A;  1HNX E;  4LU9 A;  4P7D A;  3AV0 A;  4DV6 E;  1MGT A;  4X62 E;  2MDG A;  3EPJ A;  2JPA A;  2L3J A;  2B7T A;  2YTO A;  2YTD A;  3ECR A;  2ENH A;  2EPZ A;  2ENC A;  2JR1 A;  2YTF A;  3H09 A;  3JU0 A;  4X66 E;  2RSI A;  1G2D C;  1FKA E;  2EM4 A;  4L5N C;  1IQS A;  2F8B A;  4JI8 E;  2VRD A;  2DRP A;  2LMZ A;  4GKK E;  2L2M A;  4BHB A;  3MHH C;  1QNT A;  3DJW A;  2B7V A;  4RH8 A;  3C6M A;  4HEI A;  1X6H A;  4WXC A;  1EH6 A;  2J7J A;  2UUA E;  2EOX A;  5AC5 A;  4J8Z A;  4I8O A;  2EMY A;  2DLK A;  4R2D A;  2EL4 A;  1LLM C;  4M2Z A;  4OX9 E;  1PJS A;  2EOI A;  2V8Q B;  2FTX B;  1XNQ E;  2EPK X;  1RMD A;  3KZZ A;  2MC6 A;  2RPC A;  2V85 A;  2EJ4 A;  3AUZ A;  3VHT B;  1YSA C;  2UUC E;  5ADZ A;  2EOQ A;  4F54 A;  1X6E A;  2YTJ A;  4WPY A;  4LF9 E;  1N32 E;  1T4N A;  2LRS A;  5KL5 A;  2LBS B;  1GTK A;  2EOM A;  1BBG A;  4WXD A;  3IWC A;  5KL4 A;  2EWL A;  2L2N A;  1HR0 E;  5A6B D;  5A69 A;  3JAM C;  2LTR A;  2B9D A;  4JI4 E;  1YYO A;  1YZ9 A;  2DSY A;  2D9H A;  2LCE A;  2PRT A;  2LV2 A;  2NUF A;  4B3T E;  4LF4 E;  4LFA E;  1STU A;  2YTN A;  2IHR 1;  2EOJ A;  2KOU A;  2EPX A;  3FIG A;  1N34 E;  1J5E E;  3P1X A;  2VQE E;  5AC4 A;  5AE1 A;  4BBY A;  2L6M A;  1X6F A;  2EM0 A;  1T39 A;  1N36 E;  1MEY C;  1UBD C;  1FJG E;  4R2Q A;  4NXM E;  4GKJ E;  4ZYD A;  3VK6 A;  3OML A;  1KYQ A;  2EM7 A;  2DIX A;  1A1F A;  3RMP A;  2EM6 A;  2MKN A;  2YPN A;  4ZYE A;  4B3M E;  2EMG A;  3DF6 A;  2DB2 A;  4M9V C;  4O4K A;  1F2I G;  2YTE A;  4R2C A;  4DUY E;  4DR7 E;  4R2A A;  3BBG A;  2WBS A;  2EN3 A;  2EOZ A;  2HC5 A;  3OTO E;  2L33 A;  4ZYH A;  2EPO A;  2CT1 A;  5F3W A;  2EOY A;  3VYY A;  5KL6 A;  1PJQ A;  2EOE A;  5IT9 C;  3TQM A;  3IWB A;  2EQ0 A;  5IV8 B;  2EPC A;  2YT4 A;  2YZT A;  3J7A G;  2EN1 A;  2YRM A;  2Q8U A;  2NUE A;  4BHC A;  2HJJ A;  4R2S A;  2YSO A;  1RC7 A;  3HTX A;  2NAB A;  1TF3 A;  2WZO A;  4KZS A;  5A6A A;  4F9B B;  4JI5 E;  2V83 A;  4B3S E;  2RQL A;  3UK3 C;  5TSE A;  3ADJ A;  1YYK A;  2V87 A;  1TF6 A;  5AAS A;  4WYQ B;  4DKK A;  3LML A;  5CFF E;  2L92 A;  4NZV A;  2EQ3 A;  1X49 A;  3K6Q A;  4GZN C;  2M1S A;  4BC9 A;  4DV2 E;  4R2E A;  2GHF A;  2V86 A;  2LTS A;  4DR1 E;  1JK2 A;  2GLI A;  1BB8 A;  2KON A;  4BS9 A;  4DR6 E;  5LL6 R;  1X48 A;  2RSM A;  2EPL X;  4F6N A;  1AH5 A;  4X64 E;  5A2Q C;  1XMQ E;  1N33 E;  2CTD A;  1HNZ E;  4X8W A;  4B3R E;  2JP9 A;  2BBG A;  4X9J A;  2ENA A;  2EPN A;  2YTG A;  5LMU E;  4R03 A;  1EH8 A;  4JI7 E;  2LVH A;  2FV4 B;  2GPI A;  4IJD A;  1NEI A;  2UU9 E;  2WBU A;  4F6M A;  1A1J A;  4R8O A;  2MDR A;  2L8T A;  5KL3 A;  2L3C A;  1IBK E;  2DMI A;  4BMJ A;  1X3C A;  4AQY E;  3HXL A;  2M4I A;  4DR4 E;  3THN A;  5IXM B;  2JOX A;  1ZBT A;  2EN2 A;  2EZ6 A;  1T4L B;  2N3H A;  1Z1B A;  3F6H A;  2EM3 A;  3L00 A;  1GQE A;  2M9A A;  4R2P A;  2EOO A;  4TUG A;  2EMB A;  2K4V A;  4DUZ E;  4DR5 E;  2EMW A;  2DGC A;  3ADL A;  2N8X A;  3MSW A;  5AE3 A;  4NHR A;  1ZR9 A;  3MHS C;  2EMA A;  2JVA A;  4KWY A;  1BBO A;  4JV5 E;  1QU6 A;  2DMY A;  3EPL A;  2EN7 A;  5BR8 E;  3LLH A;  4LF8 E;  1YUJ A;  3T1H E;  1L4S A;  4K0K E;  4BC7 A;  1G2F C;  4JI2 E;  2EMX A;  4LF5 E;  5A6B A;  4RHB B;  3JTZ A;  4WSG A;  4DV5 E;  3KZY A;  4MLQ A;  2NUG A;  2EM2 A;  1PJT A;  4HTG A;  5LMN E;  1A1L A;  1WXR A;  1X5W A;  2RTX A;  2EPA A;  2UXD E;  2YTQ A;  3T1Y E;  1SFE A;  2CSH A;  2MC5 A;  2I9I A;  1PKP A;  2R76 A;  3BF2 A;  2ELZ A;  2EOF A;  2JY9 A;  1P47 A;  3THO B;  2M7Q A;  5IWA E;  1YFH A;  1EKZ A;  4L8N A;  4O5G A;  5T6J A;  3C6K A;  5A6J A;  1T38 A;  3HPS A;  2YRK A;  4P78 A;  4YHH E;  1WRJ A;  1B69 A;  2JXP A;  2HGH A;  4WX9 A;  2JYA A;  2EPM X;  1JK1 A;  1J26 A;  2EE8 A;  2V88 A;  2YTI A;  4O24 A;  2CPN A;  4DMI A;  1I94 E;  4DR2 E;  1A1H A;  1RQ0 A;  1EH7 A;  2G7H A;  2FGG A;  4DR3 E;  4JI1 E;  3IWD A;  2DLQ A;  4JI6 E;  2E5L E;  5A6K A;  2WCC 3;  4MLV A;  4DV1 E;  4DV0 E;  2LUP B;  2N3G A;  4M0V A;  1O0W A;  4YY3 E;  2YWQ A;  4F9A B;  1DGC A;  2EMZ A;  5DNY A;  1IBL E;  2EMK A;  4ZYG A;  2UXB E;  2EM5 A;  2VQF E;  3ZOQ B;  3HQ1 A;  5KL2 A;  4TUI A;  3EPH A;  1XMO E;  4X65 E;  2K7I A;  2EMI A;  4LF7 E;  1A1G A;  2A25 A;  1ZAA C;  1YYW A;  4WFT A;  1SR9 A;  2WBT A;  2EM8 A;  4N4R B;  2F4V E;  4LFB E;  2ADR A;  2VE7 C;  2H36 X;  1A1I A;  1UHZ A;  2EMF A;  2EM9 A;  4IS1 C;  1WJP A;  2B3T B;  2EOH A;  3J7Y p;  2LJH A;  2L2K B;  1GZ6 A;  1PDA A;  2VF1 A;  1NCS A;  3M99 B;  4JYA E;  2KHX A;  1XNR E;  2EL6 A;  3EQ1 A;  1A1K A;  2HHH E;  4DV3 E;  3C4B A;  4JI0 E;  4GEQ B;  2YU8 A;  4M30 A;  3QG5 C;  1T4O A;  2RS7 A;  2NA2 A;  2MKD A;  2JOB A;  5FLX C;  4Q28 A;  1WHQ A;  1ZU1 A;  2E72 A;  4R2R A;  3C4T A;  4DV4 E;  2YSP A;  2YRH A;  2LO3 A;  2ODR D;  2EMC A;  2EOR A;  2V89 A;  5KL7 A;  2LE2 A;  4JI3 E;  1UIL A;  2EPU A;  2UXC E;  2LUQ A;  3KWR A;  5AE2 A;  2BB8 A;  2EPR A;  4F9C B;  1AAY A;  2EN4 A;  4NXN E;  1YUI A;  2R1F A;  1UN6 B;  1ZBQ A;  4O43 A;  2JWO A;  2EML A;  4FK5 C;  4WSP A;  3VYX A;  3J80 C;  3BGH A;  2EN6 A;  2EMH A;  1DQ3 A;  2EQ1 A;  4KHP E;  2I13 A;  4LF6 E;  4DV7 E;  1N3G A;  4LTY A;  1X47 A;  2UUB E;  3BID A;  2YTP A;  2EL5 A; 
#chains in the Genus database with same CATH homology
 3HPZ A;  1ZBT A;  1DI2 A;  1IBM E;  2E1M A;  1WHN A;  2G7H A;  2RS6 A;  2FGG A;  4NXM E;  4DR3 E;  4LFC E;  4JI1 E;  1T4L B;  3IWD A;  2N3H A;  2EZ6 A;  4GKJ E;  3ADG A;  3F6G A;  3F6H A;  3OML A;  4OOG C;  3VK6 A;  3J81 C;  2ZM6 E;  4BCA A;  2E5L E;  2DIX A;  1GQE A;  4DV1 E;  4DV0 E;  2LUP B;  2N3G A;  3RMP A;  4TUG A;  4M0V A;  1O0W A;  4B3M E;  2K4V A;  4DUZ E;  4YY3 E;  4F9A B;  1HNW E;  3DF6 A;  4DR5 E;  2DB2 A;  5DNY A;  3ADL A;  1IBL E;  3MSW A;  5AE3 A;  2UXB E;  3ADI A;  2ODR C;  2JVA A;  2VQF E;  3ZOQ B;  3HQ1 A;  1HNX E;  4LU9 A;  4P7D A;  3AV0 A;  4DUY E;  4DV6 E;  4DR7 E;  4TUI A;  4JV5 E;  4X62 E;  1QU6 A;  1XMO E;  2DMY A;  4X65 E;  4LF7 E;  2L3J A;  2B7T A;  2L33 A;  3OTO E;  1YYW A;  4WFT A;  5BR8 E;  5F3W A;  3VYY A;  1SR9 A;  2F4V E;  5IT9 C;  3LLH A;  4LF8 E;  2JR1 A;  4LFB E;  3H09 A;  3IWB A;  3JU0 A;  4X66 E;  3T1H E;  1FKA E;  2YT4 A;  2YZT A;  2VE7 C;  4L5N C;  3J7A G;  4K0K E;  4BC7 A;  2H36 X;  2F8B A;  4JI8 E;  1UHZ A;  4JI2 E;  2NUE A;  2LMZ A;  4GKK E;  2L2M A;  2B3T B;  3J7Y p;  4LF5 E;  3JTZ A;  2LJH A;  4DV5 E;  2L2K B;  1GZ6 A;  3DJW A;  2B7V A;  1RC7 A;  3HTX A;  2VF1 A;  2WZO A;  2KHX A;  4KZS A;  1XNR E;  4JYA E;  2NUG A;  4F9B B;  4JI5 E;  2V83 A;  4DV3 E;  3C4B A;  2HHH E;  4B3S E;  4JI0 E;  5LMN E;  2UUA E;  3ADJ A;  4GEQ B;  1WXR A;  1YYK A;  2V87 A;  4J8Z A;  4M30 A;  4I8O A;  5AAS A;  4WYQ B;  4DKK A;  1T4O A;  3LML A;  2RTX A;  2UXD E;  2RS7 A;  2NA2 A;  5CFF E;  2L92 A;  4M2Z A;  4OX9 E;  3T1Y E;  2MC5 A;  1X49 A;  2JOB A;  2V8Q B;  5FLX C;  3K6Q A;  2FTX B;  1PKP A;  2M1S A;  4Q28 A;  4BC9 A;  1XNQ E;  1WHQ A;  4DV2 E;  2V86 A;  2JY9 A;  2MC6 A;  2V85 A;  4JI6 E;  2LTS A;  3C4T A;  4DV4 E;  4DR1 E;  2KON A;  4BS9 A;  2M7Q A;  5LL6 R;  5IWA E;  4DR6 E;  2ODR D;  3AUZ A;  1EKZ A;  2UUC E;  1X48 A;  2V89 A;  4L8N A;  5ADZ A;  2LE2 A;  2RSM A;  5T6J A;  4F54 A;  4JI3 E;  4X64 E;  5A2Q C;  4WPY A;  4LF9 E;  1N32 E;  1XMQ E;  3HPS A;  1UIL A;  5AE1 A;  1N33 E;  2LRS A;  2LUQ A;  1T4N A;  3KWR A;  5AE2 A;  2LBS B;  1HNZ E;  2UXC E;  4X8W A;  4LF6 E;  4F9C B;  4B3R E;  3IWC A;  4NXN E;  2EWL A;  2L2N A;  1HR0 E;  5LMU E;  3JAM C;  2LTR A;  1ZBQ A;  4P78 A;  4R03 A;  2B9D A;  4YHH E;  4JI4 E;  4JI7 E;  1YYO A;  2JWO A;  2FV4 B;  2UU9 E;  1YZ9 A;  2DSY A;  4R8O A;  1J26 A;  4WSP A;  2NUF A;  3VYX A;  2MDR A;  3J80 C;  4B3T E;  2L8T A;  2V88 A;  2CPN A;  4LF4 E;  2L3C A;  1STU A;  1IBK E;  4DMI A;  4LFA E;  1DQ3 A;  2IHR 1;  4BMJ A;  1I94 E;  4KHP E;  2KOU A;  4DV7 E;  4LTY A;  3FIG A;  4AQY E;  1N34 E;  3HXL A;  1X47 A;  4DR2 E;  3P1X A;  2M4I A;  1J5E E;  2UUB E;  4DR4 E;  2VQE E;  2JOX A;  1RQ0 A;  4BBY A;  2L6M A;  1N36 E;  1FJG E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...