2EWLA

Solution structure of the c-terminal domain (monomer) of the hpv45 oncoprotein e7
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
GSHMAEPQRHKILCVCCKCDGRIELTVESSAEDLRTLQQLFLSTLSFVCPWCATNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein E7
publication title Solution structure of the partially folded high-risk human papilloma virus 45 oncoprotein E7.
pubmed doi rcsb
source organism Human papillomavirus
molecule tags Oncoprotein, virus/viral protein
total genus 12
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.730 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2ewlA00
2F8BA 2EWLA
chains in the Genus database with same CATH superfamily
2D9HA 4DR2E 4L8NA 5IXMB 2BB8A 3JTZA 2DIXA 3LMLA 1XNRE 3KWRA 5LMUE 2YWQA 4ZYEA 2EN4A 2JPAA 2YTJA 3BF2A 2LE2A 4NXNE 3T1HE 2L3JA 2EMCA 4LF5E 3M99B 2EORA 4Q28A 2E5LE 2JR1A 1T39A 1A1GA 2EMWA 4YHHE 4R8OA 3P1XA 2EL6A 1UILA 2YRKA 2UXBE 1UN6B 4JI2E 2YTQA 1A1KA 1NEIA 1BB8A 2EMBA 4LFCE 2YTDA 4F9CB 2EPXA 4P7DA 1AH5A 3T1YE 2VE7C 2RSIA 4BBYA 1IQSA 5CFFE 3TQMA 1A1FA 2HJJA 1GZ6A 2EMAA 3QG5C 3BGHA 4O5GA 3ECRA 4R2SA 2R76A 2K7IA 1IBME 1KJKA 2EN3A 3HPSA 4JV5E 2MKDA 3VYYA 2ODRC 2EPOA 2UUAE 4GKJE 2EZ6A 2JXPA 2EN1A 3EPLA 4JI4E 5AE1A 2ZM6E 3DF6A 2EM9A 2ENAA 1RMDA 2EMFA 1ZU1A 5A2QC 2KHXA 1IBLE 2EE8A 3AV0A 4DV0E 1AAYA 5DNYA 2EN7A 4X9JA 1DGCA 2LO3A 2EWLA 4P78A 5AASA 1J26A 1A1LA 2L2MA 1QU6A 2EMYA 3F6GA 2EOYA 4KWYA 4MLQA 4JI0E 2M4IA 3L00A 2ENHA 2YU5A 4X65E 3H09A 3ADLA 2RQLA 4NHRA 5IT9C 4LF8E 3HTXA 2EM2A 2DLKA 4JI6E 2UUBE 5A6AA 1N34E 1SFEA 5IWAE 4X62E 4O24A 2EMKA 2MDGA 2M7QA 4L5NC 3C6KA 1N3GA 2EN6A 2KONA 4WXCA 2WCC3 4NZVA 1ZAAC 2EMXA 1SR9A 1TF6A 2YZTA 1GQEA 4DUZE 4YY3E 4DV6E 4WFTA 4IS1C 4O43A 4LFBE 1X47A 2EM7A 4R2EA 4JI3E 2ODRD 4LF6E 2L33A 2YU8A 4WYQB 4J8ZA 1PJTA 2EOSA 2LRSA 4BC7A 2GLIA 4GZNC 4I8OA 5A6BA 2B9DA 5LMNE 3OMLA 5TSEA 4KZSA 4BS9A 2EOXA 1EH8A 1Z1BA 2H36X 2F8BA 3ZOQB 4DKKA 2LTRA 4GKKE 2DRPA 2EPPA 4WPYA 1EKZA 4ZYDA 3HXLA 4M30A 1FKAE 4B3SE 2JY9A 2EL4A 4B3RE 1YPNA 2RSMA 2JOBA 4K0KE 2VRDA 2EM8A 4Q35B 1ZBTA 3C6MA 2WBSA 4R2QA 4AQYE 2VQFE 1EH7A 2LUQA 3KZYA 1HNXE 1MEYC 2CT1A 4DV5E 4RH8A 5LL6R 3J80C 4DV1E 4DR6E 2YRMA 1G2FC 1PDAA 2EPUA 4WX9A 4DMIA 3EQ1A 2L2NA 2M9AA 2VQEE 3ADGA 2RS6A 1PKPA 4X66E 2ELYA 4WSPA 2EP3A 2ELZA 4M9VC 1BBGA 2EMGA 2DB2A 4OOGC 1HNWE 2V8QB 1DI2A 5BR8E 4MLVA 4R2CA 4WXDA 2VF1A 4DR4E 2B7TA 2EMHA 2J7JA 2NABA 2UU9E 2L3CA 1XNQE 2LBSB 2YTGA 4X8WA 4NXME 5A6JA 2YTEA 2EPRA 2B7VA 2EPNA 2HGHA 2MDRA 4M2ZA 2EJ4A 3KZZA 2DLQA 4DR3E 4BHBA 1ZBQA 2EOFA 2FGGA 2EN8A 2EQ0A 4BCAA 4LTYA 2EMLA 1JK1A 3HQ1A 1IBKE 1X3CA 2N3HA 1IMUA 1X6EA 2LV2A 2EOEA 3MHHC 4JYAE 3HPZA 2JOXA 1A1HA 3JAMC 4JI5E 1P47A 2V87A 1PJSA 2LCEA 2V83A 2HHHE 2LJUA 1HNZE 2K4VA 5AC5A 5KL5A 3ADJA 4B3ME 5FLXC 1F2IG 1A1IA 4B3TE 1KYQA 2RPCA 2YSPA 2F4VE 1T4NA 2GPIA 4F6MA 4DR7E 2EM5A 4TUGA 4DR1E 2EPZA 4R2PA 2YTNA 2GHFA 1X6FA 3UK3C 1YZ9A 5A6KA 4ZYHA 2DMIA 5AE3A 2V86A 4O4KA 2EOHA 4DV4E 4LF4E 3K6QA 5T6JA 4M0VA 4DV7E 2LMZA 3EPJA 4F54A 2L92A 2EPCA 2DGCA 4LU9A 1MGTA 1RC7A 1RQ0A 4DV3E 3VHTB 1G2DC 2LUPB 2EOQA 5KL7A 2E72A 2EOMA 2EOZA 2FTXB 2EMIA 2PRTA 4LF7E 5A69A 5KL2A 1WJPA 2V85A 1N32E 2N8XA 1TF3A 1EH6A 2V89A 2L8TA 2DSYA 2NUEA 1YUJA 3IWDA 1ZR9A 2G7HA 3J81C 1T4OA 3VYXA 1X49A 2ADRA 1YUIA 4BMJA 2RTXA 4GEQB 2UXDE 1HR0E 2E1MA 2I9IA 2EQ3A 2LVHA 1STUA 5A6BD 1IQOA 2WBUA 1A1JA 2NA2A 4X64E 3THNA 4HEIA 1YFHA 2YTPA 1L4SA 2EOJA 1N36E 4R2RA 4DUYE 2EPMX 1YYWA 1FJGE 4JI8E 3BIDA 2UXCE 1BBOA 1XMOE 4DV2E 3IWCA 2WZOA 2Q8UA 4BC9A 2CTDA 2JYAA 3MHSC 3THOB 3FIGA 3MSWA 4BHCA 2YSOA 2EM4A 1T38A 5KL6A 2M1SA 2EM3A 1N33E 2N3GA 4RHBB 1JK2A 3DJWA 4LFAE 3F6HA 5KL3A 2ENCA 5LLQA 3J7Yp 2EMZA 1DQ3A 2MKNA 1WRJA 2LTSA 2V88A 2CSHA 2MC5A 2EQ1A 2UUCE 2RS7A 3JU0A 2B3TB 2IHR1 2I13A 2NUFA 2KOUA 4KHPE 2L2KB 1YSAC 1TN9A 2HC5A 4OX9E 2EM6A 1XMQE 1NCSA 1UBDC 2BBGA 4ZYGA 4F9AB 5F3WA 3LLHA 2JVAA 4LF9E 2LT7A 3C4BA 4N4RB 3EPKA 1J5EE 1YYKA 3IWBA 2CPNA 2R1FA 4JI7E 4WSGA 2EPLX 2A25A 4F9BB 5ADZA 2FV4B 2EPKX 1YYOA 2EPAA 1WXRA 2JWOA 2YPNA 4FK5C 5AC4A 3RMPA 4R2AA 2WBTA 4F6NA 3J7AG 2YT4A 3C4TA 2YTFA 1O0WA 1LLMC 2YTOA 2L6MA 1QNTA 2LJHA 5IV8B 1B69A 2MC6A 1WHNA 5KL4A 2YRHA 1X6HA 2DMYA 4IJDA 1UHZA 3ADIA 3EPHA 1WHQA 2NUGA 5AE2A 1X5WA 3AUZA 2EN2A 2EOOA 4F2JC 1I94E 4R2DA 1GTKA 3OTOE 2EM0A 1PJQA 1T4LB 3VK6A 1X48A 2EL5A 4TUIA 4JI1E 3BBGA 4HTGA 2JP9A 2YTIA 4DR5E 4R03A 2EOIA
chains in the Genus database with same CATH topology
1N34E 4BC9A 5IWAE 4X62E 4DR2E 4L8NA 4DR3E 1ZBQA 4BCAA 2FGGA 3JTZA 2DIXA 3FIGA 3LMLA 3MSWA 2M7QA 1XNRE 4L5NC 4LTYA 3KWRA 5LMUE 2M1SA 3HQ1A 2KONA 1N33E 2N3GA 1IBKE 3DJWA 4LFAE 3F6HA 1SR9A 2N3HA 2LE2A 4NXNE 2YZTA 3T1HE 1GQEA 3J7Yp 2L3JA 4DUZE 4YY3E 4LF5E 1DQ3A 4JYAE 4Q28A 3HPZA 2JOXA 4DV6E 3JAMC 4JI5E 2V87A 4WFTA 2LTSA 4LFBE 2V88A 1X47A 2E5LE 2V83A 2JR1A 2HHHE 1HNZE 2K4VA 4JI3E 3ADJA 4B3ME 2MC5A 2ODRD 5FLXC 4LF6E 2UUCE 2RS7A 2L33A 2B3TB 3JU0A 4WYQB 4YHHE 2IHR1 4J8ZA 2NUFA 2KOUA 4R8OA 4KHPE 2LRSA 4B3TE 3P1XA 4BC7A 2L2KB 1UILA 2F4VE 4I8OA 1T4NA 2UXBE 2B9DA 5LMNE 3OMLA 4OX9E 1XMQE 4JI2E 4KZSA 4DR7E 4BS9A 4F9AB 4LFCE 2H36X 5F3WA 2F8BA 2JVAA 3LLHA 3ZOQB 4DKKA 2LTRA 3C4BA 4P7DA 4F9CB 4TUGA 4DR1E 4LF9E 4GKKE 4WPYA 1EKZA 3HXLA 4M30A 3T1YE 1FKAE 2JY9A 4B3SE 2VE7C 1J5EE 1YZ9A 4BBYA 1YYKA 3IWBA 4B3RE 2CPNA 5CFFE 5AE3A 2V86A 4JI7E 4DV4E 1GZ6A 4F9BB 2RSMA 4LF4E 5ADZA 2FV4B 2JOBA 3K6QA 5T6JA 4K0KE 1YYOA 4M0VA 4DV7E 1WXRA 2JWOA 2LMZA 1ZBTA 3RMPA 4F54A 2L92A 1IBME 3J7AG 4AQYE 2VQFE 2LUQA 4LU9A 1RC7A 2YT4A 1RQ0A 3C4TA 1HNXE 4DV3E 4DV5E 2LUPB 1O0WA 3HPSA 4JV5E 3VYYA 5LL6R 2ODRC 3J80C 2UUAE 4GKJE 4DV1E 2EZ6A 4DR6E 2FTXB 2L6MA 4LF7E 4R03A 2V85A 4DMIA 2L2NA 5AE1A 2ZM6E 4JI4E 1N32E 3DF6A 2LJHA 2VQEE 3ADGA 2RS6A 2MC6A 1PKPA 1WHNA 4X66E 4WSPA 2V89A 5A2QC 2L8TA 2DSYA 2DMYA 2KHXA 1IBLE 2NUEA 3IWDA 3J81C 2G7HA 1T4OA 2DB2A 3VYXA 4OOGC 1X49A 1HNWE 1UHZA 2V8QB 3AV0A 1DI2A 4BMJA 2RTXA 4DV0E 4GEQB 5BR8E 5DNYA 3ADIA 1HR0E 2E1MA 2EWLA 2UXDE 1STUA 2VF1A 1WHQA 2B7TA 4P78A 5AE2A 2UU9E 2NUGA 5AASA 4DR4E 2L3CA 1XNQE 2LBSB 2NA2A 1J26A 3AUZA 4X8WA 4X64E 2L2MA 1I94E 1QU6A 4NXME 3F6GA 1N36E 4DUYE 3OTOE 1T4LB 4JI0E 2M4IA 3VK6A 1YYWA 1FJGE 4JI8E 1X48A 4TUIA 2UXCE 4X65E 4JI1E 3H09A 2B7VA 1XMOE 3ADLA 5IT9C 4LF8E 3HTXA 4DV2E 4DR5E 3IWCA 4JI6E 2WZOA 2MDRA 4M2ZA 2UUBE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F8B A;  2EWL A; 
#chains in the Genus database with same CATH topology
 2D9H A;  4DR2 E;  4L8N A;  5IXM B;  2BB8 A;  3JTZ A;  2DIX A;  3LML A;  1XNR E;  3KWR A;  5LMU E;  2YWQ A;  4ZYE A;  2EN4 A;  2JPA A;  2YTJ A;  3BF2 A;  2LE2 A;  4NXN E;  3T1H E;  2L3J A;  2EMC A;  4LF5 E;  3M99 B;  2EOR A;  4Q28 A;  2E5L E;  2JR1 A;  1T39 A;  1A1G A;  2EMW A;  4YHH E;  4R8O A;  3P1X A;  2EL6 A;  1UIL A;  2YRK A;  2UXB E;  1UN6 B;  4JI2 E;  2YTQ A;  1A1K A;  1NEI A;  1BB8 A;  2EMB A;  4LFC E;  2YTD A;  4F9C B;  2EPX A;  4P7D A;  1AH5 A;  3T1Y E;  2VE7 C;  2RSI A;  4BBY A;  1IQS A;  5CFF E;  3TQM A;  1A1F A;  2HJJ A;  1GZ6 A;  2EMA A;  3QG5 C;  3BGH A;  4O5G A;  3ECR A;  4R2S A;  2R76 A;  2K7I A;  1IBM E;  1KJK A;  2EN3 A;  3HPS A;  4JV5 E;  2MKD A;  3VYY A;  2ODR C;  2EPO A;  2UUA E;  4GKJ E;  2EZ6 A;  2JXP A;  2EN1 A;  3EPL A;  4JI4 E;  5AE1 A;  2ZM6 E;  3DF6 A;  2EM9 A;  2ENA A;  1RMD A;  2EMF A;  1ZU1 A;  5A2Q C;  2KHX A;  1IBL E;  2EE8 A;  3AV0 A;  4DV0 E;  1AAY A;  5DNY A;  2EN7 A;  4X9J A;  1DGC A;  2LO3 A;  2EWL A;  4P78 A;  5AAS A;  1J26 A;  1A1L A;  2L2M A;  1QU6 A;  2EMY A;  3F6G A;  2EOY A;  4KWY A;  4MLQ A;  4JI0 E;  2M4I A;  3L00 A;  2ENH A;  2YU5 A;  4X65 E;  3H09 A;  3ADL A;  2RQL A;  4NHR A;  5IT9 C;  4LF8 E;  3HTX A;  2EM2 A;  2DLK A;  4JI6 E;  2UUB E;  5A6A A;  1N34 E;  1SFE A;  5IWA E;  4X62 E;  4O24 A;  2EMK A;  2MDG A;  2M7Q A;  4L5N C;  3C6K A;  1N3G A;  2EN6 A;  2KON A;  4WXC A;  2WCC 3;  4NZV A;  1ZAA C;  2EMX A;  1SR9 A;  1TF6 A;  2YZT A;  1GQE A;  4DUZ E;  4YY3 E;  4DV6 E;  4WFT A;  4IS1 C;  4O43 A;  4LFB E;  1X47 A;  2EM7 A;  4R2E A;  4JI3 E;  2ODR D;  4LF6 E;  2L33 A;  2YU8 A;  4WYQ B;  4J8Z A;  1PJT A;  2EOS A;  2LRS A;  4BC7 A;  2GLI A;  4GZN C;  4I8O A;  5A6B A;  2B9D A;  5LMN E;  3OML A;  5TSE A;  4KZS A;  4BS9 A;  2EOX A;  1EH8 A;  1Z1B A;  2H36 X;  2F8B A;  3ZOQ B;  4DKK A;  2LTR A;  4GKK E;  2DRP A;  2EPP A;  4WPY A;  1EKZ A;  4ZYD A;  3HXL A;  4M30 A;  1FKA E;  4B3S E;  2JY9 A;  2EL4 A;  4B3R E;  1YPN A;  2RSM A;  2JOB A;  4K0K E;  2VRD A;  2EM8 A;  4Q35 B;  1ZBT A;  3C6M A;  2WBS A;  4R2Q A;  4AQY E;  2VQF E;  1EH7 A;  2LUQ A;  3KZY A;  1HNX E;  1MEY C;  2CT1 A;  4DV5 E;  4RH8 A;  5LL6 R;  3J80 C;  4DV1 E;  4DR6 E;  2YRM A;  1G2F C;  1PDA A;  2EPU A;  4WX9 A;  4DMI A;  3EQ1 A;  2L2N A;  2M9A A;  2VQE E;  3ADG A;  2RS6 A;  1PKP A;  4X66 E;  2ELY A;  4WSP A;  2EP3 A;  2ELZ A;  4M9V C;  1BBG A;  2EMG A;  2DB2 A;  4OOG C;  1HNW E;  2V8Q B;  1DI2 A;  5BR8 E;  4MLV A;  4R2C A;  4WXD A;  2VF1 A;  4DR4 E;  2B7T A;  2EMH A;  2J7J A;  2NAB A;  2UU9 E;  2L3C A;  1XNQ E;  2LBS B;  2YTG A;  4X8W A;  4NXM E;  5A6J A;  2YTE A;  2EPR A;  2B7V A;  2EPN A;  2HGH A;  2MDR A;  4M2Z A;  2EJ4 A;  3KZZ A;  2DLQ A;  4DR3 E;  4BHB A;  1ZBQ A;  2EOF A;  2FGG A;  2EN8 A;  2EQ0 A;  4BCA A;  4LTY A;  2EML A;  1JK1 A;  3HQ1 A;  1IBK E;  1X3C A;  2N3H A;  1IMU A;  1X6E A;  2LV2 A;  2EOE A;  3MHH C;  4JYA E;  3HPZ A;  2JOX A;  1A1H A;  3JAM C;  4JI5 E;  1P47 A;  2V87 A;  1PJS A;  2LCE A;  2V83 A;  2HHH E;  2LJU A;  1HNZ E;  2K4V A;  5AC5 A;  5KL5 A;  3ADJ A;  4B3M E;  5FLX C;  1F2I G;  1A1I A;  4B3T E;  1KYQ A;  2RPC A;  2YSP A;  2F4V E;  1T4N A;  2GPI A;  4F6M A;  4DR7 E;  2EM5 A;  4TUG A;  4DR1 E;  2EPZ A;  4R2P A;  2YTN A;  2GHF A;  1X6F A;  3UK3 C;  1YZ9 A;  5A6K A;  4ZYH A;  2DMI A;  5AE3 A;  2V86 A;  4O4K A;  2EOH A;  4DV4 E;  4LF4 E;  3K6Q A;  5T6J A;  4M0V A;  4DV7 E;  2LMZ A;  3EPJ A;  4F54 A;  2L92 A;  2EPC A;  2DGC A;  4LU9 A;  1MGT A;  1RC7 A;  1RQ0 A;  4DV3 E;  3VHT B;  1G2D C;  2LUP B;  2EOQ A;  5KL7 A;  2E72 A;  2EOM A;  2EOZ A;  2FTX B;  2EMI A;  2PRT A;  4LF7 E;  5A69 A;  5KL2 A;  1WJP A;  2V85 A;  1N32 E;  2N8X A;  1TF3 A;  1EH6 A;  2V89 A;  2L8T A;  2DSY A;  2NUE A;  1YUJ A;  3IWD A;  1ZR9 A;  2G7H A;  3J81 C;  1T4O A;  3VYX A;  1X49 A;  2ADR A;  1YUI A;  4BMJ A;  2RTX A;  4GEQ B;  2UXD E;  1HR0 E;  2E1M A;  2I9I A;  2EQ3 A;  2LVH A;  1STU A;  5A6B D;  1IQO A;  2WBU A;  1A1J A;  2NA2 A;  4X64 E;  3THN A;  4HEI A;  1YFH A;  2YTP A;  1L4S A;  2EOJ A;  1N36 E;  4R2R A;  4DUY E;  2EPM X;  1YYW A;  1FJG E;  4JI8 E;  3BID A;  2UXC E;  1BBO A;  1XMO E;  4DV2 E;  3IWC A;  2WZO A;  2Q8U A;  4BC9 A;  2CTD A;  2JYA A;  3MHS C;  3THO B;  3FIG A;  3MSW A;  4BHC A;  2YSO A;  2EM4 A;  1T38 A;  5KL6 A;  2M1S A;  2EM3 A;  1N33 E;  2N3G A;  4RHB B;  1JK2 A;  3DJW A;  4LFA E;  3F6H A;  5KL3 A;  2ENC A;  5LLQ A;  3J7Y p;  2EMZ A;  1DQ3 A;  2MKN A;  1WRJ A;  2LTS A;  2V88 A;  2CSH A;  2MC5 A;  2EQ1 A;  2UUC E;  2RS7 A;  3JU0 A;  2B3T B;  2IHR 1;  2I13 A;  2NUF A;  2KOU A;  4KHP E;  2L2K B;  1YSA C;  1TN9 A;  2HC5 A;  4OX9 E;  2EM6 A;  1XMQ E;  1NCS A;  1UBD C;  2BBG A;  4ZYG A;  4F9A B;  5F3W A;  3LLH A;  2JVA A;  4LF9 E;  2LT7 A;  3C4B A;  4N4R B;  3EPK A;  1J5E E;  1YYK A;  3IWB A;  2CPN A;  2R1F A;  4JI7 E;  4WSG A;  2EPL X;  2A25 A;  4F9B B;  5ADZ A;  2FV4 B;  2EPK X;  1YYO A;  2EPA A;  1WXR A;  2JWO A;  2YPN A;  4FK5 C;  5AC4 A;  3RMP A;  4R2A A;  2WBT A;  4F6N A;  3J7A G;  2YT4 A;  3C4T A;  2YTF A;  1O0W A;  1LLM C;  2YTO A;  2L6M A;  1QNT A;  2LJH A;  5IV8 B;  1B69 A;  2MC6 A;  1WHN A;  5KL4 A;  2YRH A;  1X6H A;  2DMY A;  4IJD A;  1UHZ A;  3ADI A;  3EPH A;  1WHQ A;  2NUG A;  5AE2 A;  1X5W A;  3AUZ A;  2EN2 A;  2EOO A;  4F2J C;  1I94 E;  4R2D A;  1GTK A;  3OTO E;  2EM0 A;  1PJQ A;  1T4L B;  3VK6 A;  1X48 A;  2EL5 A;  4TUI A;  4JI1 E;  3BBG A;  4HTG A;  2JP9 A;  2YTI A;  4DR5 E;  4R03 A;  2EOI A; 
#chains in the Genus database with same CATH homology
 1N34 E;  4BC9 A;  5IWA E;  4X62 E;  4DR2 E;  4L8N A;  4DR3 E;  1ZBQ A;  4BCA A;  2FGG A;  3JTZ A;  2DIX A;  3FIG A;  3LML A;  3MSW A;  2M7Q A;  1XNR E;  4L5N C;  4LTY A;  3KWR A;  5LMU E;  2M1S A;  3HQ1 A;  2KON A;  1N33 E;  2N3G A;  1IBK E;  3DJW A;  4LFA E;  3F6H A;  1SR9 A;  2N3H A;  2LE2 A;  4NXN E;  2YZT A;  3T1H E;  1GQE A;  3J7Y p;  2L3J A;  4DUZ E;  4YY3 E;  4LF5 E;  1DQ3 A;  4JYA E;  4Q28 A;  3HPZ A;  2JOX A;  4DV6 E;  3JAM C;  4JI5 E;  2V87 A;  4WFT A;  2LTS A;  4LFB E;  2V88 A;  1X47 A;  2E5L E;  2V83 A;  2JR1 A;  2HHH E;  1HNZ E;  2K4V A;  4JI3 E;  3ADJ A;  4B3M E;  2MC5 A;  2ODR D;  5FLX C;  4LF6 E;  2UUC E;  2RS7 A;  2L33 A;  2B3T B;  3JU0 A;  4WYQ B;  4YHH E;  2IHR 1;  4J8Z A;  2NUF A;  2KOU A;  4R8O A;  4KHP E;  2LRS A;  4B3T E;  3P1X A;  4BC7 A;  2L2K B;  1UIL A;  2F4V E;  4I8O A;  1T4N A;  2UXB E;  2B9D A;  5LMN E;  3OML A;  4OX9 E;  1XMQ E;  4JI2 E;  4KZS A;  4DR7 E;  4BS9 A;  4F9A B;  4LFC E;  2H36 X;  5F3W A;  2F8B A;  2JVA A;  3LLH A;  3ZOQ B;  4DKK A;  2LTR A;  3C4B A;  4P7D A;  4F9C B;  4TUG A;  4DR1 E;  4LF9 E;  4GKK E;  4WPY A;  1EKZ A;  3HXL A;  4M30 A;  3T1Y E;  1FKA E;  2JY9 A;  4B3S E;  2VE7 C;  1J5E E;  1YZ9 A;  4BBY A;  1YYK A;  3IWB A;  4B3R E;  2CPN A;  5CFF E;  5AE3 A;  2V86 A;  4JI7 E;  4DV4 E;  1GZ6 A;  4F9B B;  2RSM A;  4LF4 E;  5ADZ A;  2FV4 B;  2JOB A;  3K6Q A;  5T6J A;  4K0K E;  1YYO A;  4M0V A;  4DV7 E;  1WXR A;  2JWO A;  2LMZ A;  1ZBT A;  3RMP A;  4F54 A;  2L92 A;  1IBM E;  3J7A G;  4AQY E;  2VQF E;  2LUQ A;  4LU9 A;  1RC7 A;  2YT4 A;  1RQ0 A;  3C4T A;  1HNX E;  4DV3 E;  4DV5 E;  2LUP B;  1O0W A;  3HPS A;  4JV5 E;  3VYY A;  5LL6 R;  2ODR C;  3J80 C;  2UUA E;  4GKJ E;  4DV1 E;  2EZ6 A;  4DR6 E;  2FTX B;  2L6M A;  4LF7 E;  4R03 A;  2V85 A;  4DMI A;  2L2N A;  5AE1 A;  2ZM6 E;  4JI4 E;  1N32 E;  3DF6 A;  2LJH A;  2VQE E;  3ADG A;  2RS6 A;  2MC6 A;  1PKP A;  1WHN A;  4X66 E;  4WSP A;  2V89 A;  5A2Q C;  2L8T A;  2DSY A;  2DMY A;  2KHX A;  1IBL E;  2NUE A;  3IWD A;  3J81 C;  2G7H A;  1T4O A;  2DB2 A;  3VYX A;  4OOG C;  1X49 A;  1HNW E;  1UHZ A;  2V8Q B;  3AV0 A;  1DI2 A;  4BMJ A;  2RTX A;  4DV0 E;  4GEQ B;  5BR8 E;  5DNY A;  3ADI A;  1HR0 E;  2E1M A;  2EWL A;  2UXD E;  1STU A;  2VF1 A;  1WHQ A;  2B7T A;  4P78 A;  5AE2 A;  2UU9 E;  2NUG A;  5AAS A;  4DR4 E;  2L3C A;  1XNQ E;  2LBS B;  2NA2 A;  1J26 A;  3AUZ A;  4X8W A;  4X64 E;  2L2M A;  1I94 E;  1QU6 A;  4NXM E;  3F6G A;  1N36 E;  4DUY E;  3OTO E;  1T4L B;  4JI0 E;  2M4I A;  3VK6 A;  1YYW A;  1FJG E;  4JI8 E;  1X48 A;  4TUI A;  2UXC E;  4X65 E;  4JI1 E;  3H09 A;  2B7V A;  1XMO E;  3ADL A;  5IT9 C;  4LF8 E;  3HTX A;  4DV2 E;  4DR5 E;  3IWC A;  4JI6 E;  2WZO A;  2MDR A;  4M2Z A;  2UUB E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...