4R2RA

Wilms tumor protein (wt1) zinc fingers in complex with carboxylated dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
88
Chain Sequence
SEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Wilms tumor protein, isoform 4/CRA_a
total genus 29
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4r2rA00
2EMZA 2EMYA 3M99B 2DGCA 2EP3A 2EPPA 2RPCA 3EPKA 5KL6A 2E72A 2ENAA 2EMWA 1ZAAC 2YTEA 4R2CA 1A1LA 2ELZA 2EOHA 1A1JA 2LV2A 2WBSA 1A1IA 2EOSA 2MKNA 2EOJA 2EM4A 2LO3A 2HGHA 1F2IG 2RSIA 2EM2A 2EN4A 2EM9A 1MEYC 1NCSA 2DRPA 1A1FA 2EOQA 1G2DC 2EOZA 1YUJA 3EPJA 2DMIA 2GLIA 2EMCA 2EMLA 1LLMC 2YRHA 5KL5A 2M9AA 2EN8A 1WJPA 2EORA 1G2FC 2MDGA 2EM7A 2EPUA 2EPZA 2YTJA 2YTDA 2CSHA 2WBTA 2EPXA 4IJDA 1YSAC 2ENHA 2BB8A 2YTIA 2EN1A 1X6EA 2EN7A 4R2EA 3VHTB 1AAYA 2JPAA 2EPCA 2EOXA 1TF3A 2JP9A 1A1KA 2EOYA 2YTPA 4R2PA 2WCC3 4IS1C 4GZNC 2EOOA 2YTFA 1KJKA 4F6NA 2EL5A 2YTQA 2EOEA 4R2SA 2LCEA 2YSOA 1UN6B 2J7JA 1TN9A 1ZU1A 1RMDA 4WSGA 1Z1BA 2YRKA 2EPRA 2EOFA 2NABA 2EMBA 4M9VC 2WBUA 2EN3A 2EOMA 3EPLA 3UK3C 2EN6A 3MHSC 2DLKA 2EMHA 1ZR9A 2YU8A 1DGCA 1B69A 2I13A 2YTNA 2YSPA 1X6FA 2EM6A 2YRMA 2EMGA 2PRTA 1A1HA 4F2JC 5KL4A 2ELYA 2ENCA 2EQ3A 4R2QA 4F6MA 2MKDA 2EQ0A 2YTOA 4R2DA 2EN2A 2EMAA 3MHHC 2EL6A 2EM3A 2R1FA 2EQ1A 2ADRA 2EJ4A 2CT1A 2YTGA 2EPAA 2EM8A 1X5WA 2VRDA 1X3CA 1JK2A 2GHFA 2YU5A 4X9JA 1A1GA 2CTDA 2EMFA 5KL2A 1UBDC 1TF6A 2EM5A 1X6HA 4R2RA 4FK5C 1P47A 2EOIA 5KL7A 1BB8A 2EL4A 4R2AA 1YUIA 2EE8A 2D9HA 1BBOA 1JK1A 2LT7A 2A25A 5KL3A 2EMIA 2DLQA 2LVHA 3EPHA 2EMKA 2EMXA 2EM0A
chains in the Genus database with same CATH superfamily
2EMYA 3M99B 2DGCA 2EP3A 2H36X 4Q35B 3EPKA 3THOB 2E72A 4NHRA 2LRSA 5BR8E 4BBYA 3F6HA 2UXBE 1L4SA 4JV5E 1F2IG 4RHBB 1X49A 2EM2A 4O43A 5IT9C 2EM9A 1XMQE 2DRPA 5LMUE 5A6BA 4BC9A 5AASA 5A6BD 4WFTA 2G7HA 4LTYA 2EPOA 4JYAE 2BBGA 2JYAA 1G2FC 2EM7A 2EPUA 4BS9A 2EPZA 2YTJA 2WBTA 1STUA 2BB8A 1YZ9A 3OMLA 2JPAA 1T4OA 4DV5E 1HNWE 2WCC3 4R03A 4GZNC 1YYWA 2V8QB 4F6NA 2YTQA 2EZ6A 1XNRE 4JI0E 1GQEA 2J7JA 3J7Yp 1ZU1A 1YFHA 4X64E 3J80C 1GTKA 2YRKA 4KZSA 3THNA 4O24A 2NABA 5LL6R 2WBUA 1SR9A 4B3RE 3UK3C 2VQEE 2LE2A 2FTXB 4HTGA 2DB2A 1UHZA 4DUZE 2FV4B 3HXLA 2YSPA 2CPNA 4DV2E 2LTRA 1ZBTA 5FLXC 2VQFE 2EMGA 2PRTA 2ODRD 2RSMA 4K0KE 4KHPE 2LTSA 3JU0A 4ZYEA 4R2DA 2EN2A 2EMAA 1UILA 4N4RB 3C6MA 1BBGA 2JOXA 2EM3A 2V83A 4LF7E 4MLVA 2EQ1A 1FJGE 2EJ4A 4LF4E 2EPAA 2V89A 4X62E 2LUQA 2YU5A 1N3GA 2CTDA 4KWYA 4R8OA 3C6KA 1TF6A 2EM5A 3LLHA 4R2RA 4FK5C 2KHXA 3J81C 2B9DA 2YT4A 3H09A 3LMLA 2EWLA 4B3SE 2UU9E 4BMJA 1PKPA 4R2AA 2DIXA 3T1HE 4X65E 4F9BB 1N32E 3TQMA 4DR3E 2DSYA 2L8TA 2EPPA 4LFBE 2ENAA 2EMWA 4BC7A 2HC5A 4DR1E 5CFFE 3C4BA 4OOGC 4DUYE 2WBSA 2EOSA 5AE1A 4ZYHA 2EOJA 2EM4A 5IWAE 2HGHA 2EPKX 4F54A 5DNYA 2F4VE 2LJUA 1RC7A 1XMOE 3KZZA 1DQ3A 3EPJA 1EKZA 3IWCA 1EH7A 2EMLA 1AH5A 2L33A 2M9AA 2EN8A 3P1XA 1WHNA 4NZVA 2JR1A 2MC6A 2CSHA 1YPNA 1PJQA 1HR0E 2ZM6E 3ADLA 2JP9A 1TF3A 1KYQA 3ADIA 1A1KA 3QG5C 2EOYA 4R2PA 1O0WA 2FGGA 4DKKA 3OTOE 1HNZE 2YSOA 2JXPA 2UUBE 1RMDA 4WSGA 4LF6E 3VYYA 4MLQA 3VYXA 4JI3E 4OX9E 2EN3A 3KZYA 1YYOA 4JI5E 2DLKA 2EMHA 1ZR9A 2YU8A 1DGCA 2RQLA 2R76A 1PJTA 4O4KA 1X6FA 1A1HA 2LBSB 2DMYA 4M2ZA 2EQ3A 2ENCA 4F6MA 4B3TE 2EQ0A 2L3JA 1T38A 3RMPA 2L92A 2L2KB 5IV8B 1X5WA 2MC5A 2VRDA 1X3CA 4LF9E 2B3TB 4TUIA 4X9JA 3IWBA 4DV4E 4AQYE 3HPSA 4DV3E 2UXCE 1P47A 2M1SA 2JY9A 5IXMB 5KL7A 2EL4A 2EPLX 1GZ6A 2D9HA 2RS7A 1BBOA 2EMIA 2YTPA 2LVHA 5AE3A 4I8OA 2EMXA 5A6AA 2YPNA 2RPCA 3ADGA 4JI6E 4WSPA 3ADJA 5KL6A 2NUFA 4WX9A 5LMNE 4R2CA 4DV6E 1A1LA 2ELZA 4P7DA 2WZOA 1PDAA 4BHBA 3J7AG 2LO3A 4LU9A 2RSIA 1HNXE 2EN4A 1MEYC 4DMIA 4GKJE 2UXDE 3BGHA 1A1FA 2EPMX 2EOZA 3DF6A 2B7TA 3HQ1A 4DV7E 1YUJA 4RH8A 2EMCA 4WPYA 3HTXA 2YRHA 3ZOQB 4F9AB 4M0VA 4BCAA 2EORA 3BIDA 2YTDA 2EPXA 1WXRA 2ENHA 3IWDA 1T4LB 4GEQB 1J5EE 2YWQA 2EN1A 4R2EA 3VHTB 1N33E 2EOXA 1YYKA 4JI1E 3JAMC 1EH6A 4DV0E 2LJHA 4IS1C 5LLQA 2LMZA 1KJKA 4R2SA 2EOEA 3AV0A 1TN9A 2F8BA 4DR2E 1Z1BA 5A6JA 4WXDA 2JWOA 4DR4E 4GKKE 2EOFA 4M9VC 1FKAE 1IBME 2N3GA 2EPNA 2EN6A 3MHSC 2N8XA 1SFEA 2B7VA 4LF5E 2Q8UA 4J8ZA 2I13A 4JI2E 2EM6A 2YRMA 5ADZA 1J26A 4F2JC 3T1YE 1PJSA 3HPZA 4DR7E 2MKDA 3K6QA 2V87A 2EL6A 4DR5E 2R1FA 2YTGA 3JTZA 2RS6A 2GHFA 4X66E 3VK6A 1A1GA 1ZBQA 2EMFA 1UBDC 2V88A 2M4IA 4YHHE 2K4VA 4O5GA 4F9CB 1BB8A 1X48A 4JI4E 3C4TA 1I94E 3F6GA 4WXCA 1DI2A 1QU6A 1JK1A 2A25A 3AUZA 2DLQA 3EPHA 2YTEA 2EMKA 2EM0A 2EMZA 3DJWA 1RQ0A 5A6KA 1IBKE 1ZAAC 2E1MA 2EOHA 1A1JA 2LV2A 1A1IA 2MKNA 5F3WA 4LFCE 2LUPB 2HHHE 5AE2A 1XNQE 4ZYGA 1NCSA 3EQ1A 4L5NC 5T6JA 2L3CA 2EOQA 1G2DC 2NA2A 4LF8E 5AC4A 3BF2A 2DMIA 2GLIA 4HEIA 2E5LE 1LLMC 5KL5A 2VF1A 1IQOA 1WJPA 1N36E 4JI7E 1N34E 2MDGA 4IJDA 2K7IA 1YSAC 3ECRA 4WYQB 1X47A 2MDRA 2YTIA 2EN7A 1X6EA 1AAYA 4TUGA 2YZTA 2KONA 4P78A 4DR6E 4Q28A 2I9IA 2L2NA 1T4NA 2EOOA 2YTFA 2ODRC 2EL5A 2KOUA 2LCEA 1UN6B 5AC5A 1EH8A 2UUAE 1QNTA 4L8NA 2NUGA 2EPRA 2EMBA 3L00A 4DV1E 2EOMA 4X8WA 1WRJA 3FIGA 4YY3E 3EPLA 5A69A 2NUEA 2JVAA 4LFAE 4JI8E 1IQSA 1B69A 4NXME 2YTNA 1IBLE 2VE7C 2M7QA 2L2MA 5KL4A 2ELYA 1NEIA 5A2QC 4R2QA 2UUCE 2RTXA 2YTOA 5TSEA 2L6MA 3MHHC 2ADRA 2CT1A 2IHR1 4B3ME 2EM8A 1T39A 1JK2A 2V86A 5KL2A 3BBGA 4BHCA 4NXNE 2N3HA 1IMUA 1X6HA 4M30A 1MGTA 3MSWA 2JOBA 2EOIA 4ZYDA 2V85A 2HJJA 2GPIA 1YUIA 1WHQA 2EE8A 3KWRA 2LT7A 5KL3A 2EPCA
chains in the Genus database with same CATH topology
2EMZA 2EMYA 3M99B 2DGCA 2EP3A 2EPPA 2RPCA 3EPKA 5KL6A 2E72A 2ENAA 2EMWA 1ZAAC 2YTEA 4R2CA 1A1LA 2ELZA 2EOHA 1A1JA 2LV2A 2WBSA 1A1IA 2EOSA 2MKNA 2EOJA 2EM4A 2LO3A 2HGHA 1F2IG 2RSIA 2EM2A 2EN4A 2EM9A 1MEYC 1NCSA 2DRPA 1A1FA 2EOQA 1G2DC 2EOZA 1YUJA 3EPJA 2DMIA 2GLIA 2EMCA 2EMLA 1LLMC 2YRHA 5KL5A 2M9AA 2EN8A 1WJPA 2EORA 1G2FC 2MDGA 2EM7A 2EPUA 2EPZA 2YTJA 2YTDA 2CSHA 2WBTA 2EPXA 4IJDA 1YSAC 2ENHA 2BB8A 2YTIA 2EN1A 1X6EA 2EN7A 4R2EA 3VHTB 1AAYA 2JPAA 2EPCA 2EOXA 1TF3A 2JP9A 1A1KA 2EOYA 2YTPA 4R2PA 2WCC3 4IS1C 4GZNC 2EOOA 2YTFA 1KJKA 4F6NA 2EL5A 2YTQA 2EOEA 4R2SA 2LCEA 2YSOA 1UN6B 2J7JA 1TN9A 1ZU1A 1RMDA 4WSGA 1Z1BA 2YRKA 2EPRA 2EOFA 2NABA 2EMBA 4M9VC 2WBUA 2EN3A 2EOMA 3EPLA 3UK3C 2EN6A 3MHSC 2DLKA 2EMHA 1ZR9A 2YU8A 1DGCA 1B69A 2I13A 2YTNA 2YSPA 1X6FA 2EM6A 2YRMA 2EMGA 2PRTA 1A1HA 4F2JC 5KL4A 2ELYA 2ENCA 2EQ3A 4R2QA 4F6MA 2MKDA 2EQ0A 2YTOA 4R2DA 2EN2A 2EMAA 3MHHC 2EL6A 2EM3A 2R1FA 2EQ1A 2ADRA 2EJ4A 2CT1A 2YTGA 2EPAA 2EM8A 1X5WA 2VRDA 1X3CA 1JK2A 2GHFA 2YU5A 4X9JA 1A1GA 2CTDA 2EMFA 5KL2A 1UBDC 1TF6A 2EM5A 1X6HA 4R2RA 4FK5C 1P47A 2EOIA 5KL7A 1BB8A 2EL4A 4R2AA 1YUIA 2EE8A 2D9HA 1BBOA 1JK1A 2LT7A 2A25A 5KL3A 2EMIA 2DLQA 2LVHA 3EPHA 2EMKA 2EMXA 2EM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMZ A;  2EMY A;  3M99 B;  2DGC A;  2EP3 A;  2EPP A;  2RPC A;  3EPK A;  5KL6 A;  2E72 A;  2ENA A;  2EMW A;  1ZAA C;  2YTE A;  4R2C A;  1A1L A;  2ELZ A;  2EOH A;  1A1J A;  2LV2 A;  2WBS A;  1A1I A;  2EOS A;  2MKN A;  2EOJ A;  2EM4 A;  2LO3 A;  2HGH A;  1F2I G;  2RSI A;  2EM2 A;  2EN4 A;  2EM9 A;  1MEY C;  1NCS A;  2DRP A;  1A1F A;  2EOQ A;  1G2D C;  2EOZ A;  1YUJ A;  3EPJ A;  2DMI A;  2GLI A;  2EMC A;  2EML A;  1LLM C;  2YRH A;  5KL5 A;  2M9A A;  2EN8 A;  1WJP A;  2EOR A;  1G2F C;  2MDG A;  2EM7 A;  2EPU A;  2EPZ A;  2YTJ A;  2YTD A;  2CSH A;  2WBT A;  2EPX A;  4IJD A;  1YSA C;  2ENH A;  2BB8 A;  2YTI A;  2EN1 A;  1X6E A;  2EN7 A;  4R2E A;  3VHT B;  1AAY A;  2JPA A;  2EPC A;  2EOX A;  1TF3 A;  2JP9 A;  1A1K A;  2EOY A;  2YTP A;  4R2P A;  2WCC 3;  4IS1 C;  4GZN C;  2EOO A;  2YTF A;  1KJK A;  4F6N A;  2EL5 A;  2YTQ A;  2EOE A;  4R2S A;  2LCE A;  2YSO A;  1UN6 B;  2J7J A;  1TN9 A;  1ZU1 A;  1RMD A;  4WSG A;  1Z1B A;  2YRK A;  2EPR A;  2EOF A;  2NAB A;  2EMB A;  4M9V C;  2WBU A;  2EN3 A;  2EOM A;  3EPL A;  3UK3 C;  2EN6 A;  3MHS C;  2DLK A;  2EMH A;  1ZR9 A;  2YU8 A;  1DGC A;  1B69 A;  2I13 A;  2YTN A;  2YSP A;  1X6F A;  2EM6 A;  2YRM A;  2EMG A;  2PRT A;  1A1H A;  4F2J C;  5KL4 A;  2ELY A;  2ENC A;  2EQ3 A;  4R2Q A;  4F6M A;  2MKD A;  2EQ0 A;  2YTO A;  4R2D A;  2EN2 A;  2EMA A;  3MHH C;  2EL6 A;  2EM3 A;  2R1F A;  2EQ1 A;  2ADR A;  2EJ4 A;  2CT1 A;  2YTG A;  2EPA A;  2EM8 A;  1X5W A;  2VRD A;  1X3C A;  1JK2 A;  2GHF A;  2YU5 A;  4X9J A;  1A1G A;  2CTD A;  2EMF A;  5KL2 A;  1UBD C;  1TF6 A;  2EM5 A;  1X6H A;  4R2R A;  4FK5 C;  1P47 A;  2EOI A;  5KL7 A;  1BB8 A;  2EL4 A;  4R2A A;  1YUI A;  2EE8 A;  2D9H A;  1BBO A;  1JK1 A;  2LT7 A;  2A25 A;  5KL3 A;  2EMI A;  2DLQ A;  2LVH A;  3EPH A;  2EMK A;  2EMX A;  2EM0 A; 
#chains in the Genus database with same CATH topology
 2EMY A;  3M99 B;  2DGC A;  2EP3 A;  2H36 X;  4Q35 B;  3EPK A;  3THO B;  2E72 A;  4NHR A;  2LRS A;  5BR8 E;  4BBY A;  3F6H A;  2UXB E;  1L4S A;  4JV5 E;  1F2I G;  4RHB B;  1X49 A;  2EM2 A;  4O43 A;  5IT9 C;  2EM9 A;  1XMQ E;  2DRP A;  5LMU E;  5A6B A;  4BC9 A;  5AAS A;  5A6B D;  4WFT A;  2G7H A;  4LTY A;  2EPO A;  4JYA E;  2BBG A;  2JYA A;  1G2F C;  2EM7 A;  2EPU A;  4BS9 A;  2EPZ A;  2YTJ A;  2WBT A;  1STU A;  2BB8 A;  1YZ9 A;  3OML A;  2JPA A;  1T4O A;  4DV5 E;  1HNW E;  2WCC 3;  4R03 A;  4GZN C;  1YYW A;  2V8Q B;  4F6N A;  2YTQ A;  2EZ6 A;  1XNR E;  4JI0 E;  1GQE A;  2J7J A;  3J7Y p;  1ZU1 A;  1YFH A;  4X64 E;  3J80 C;  1GTK A;  2YRK A;  4KZS A;  3THN A;  4O24 A;  2NAB A;  5LL6 R;  2WBU A;  1SR9 A;  4B3R E;  3UK3 C;  2VQE E;  2LE2 A;  2FTX B;  4HTG A;  2DB2 A;  1UHZ A;  4DUZ E;  2FV4 B;  3HXL A;  2YSP A;  2CPN A;  4DV2 E;  2LTR A;  1ZBT A;  5FLX C;  2VQF E;  2EMG A;  2PRT A;  2ODR D;  2RSM A;  4K0K E;  4KHP E;  2LTS A;  3JU0 A;  4ZYE A;  4R2D A;  2EN2 A;  2EMA A;  1UIL A;  4N4R B;  3C6M A;  1BBG A;  2JOX A;  2EM3 A;  2V83 A;  4LF7 E;  4MLV A;  2EQ1 A;  1FJG E;  2EJ4 A;  4LF4 E;  2EPA A;  2V89 A;  4X62 E;  2LUQ A;  2YU5 A;  1N3G A;  2CTD A;  4KWY A;  4R8O A;  3C6K A;  1TF6 A;  2EM5 A;  3LLH A;  4R2R A;  4FK5 C;  2KHX A;  3J81 C;  2B9D A;  2YT4 A;  3H09 A;  3LML A;  2EWL A;  4B3S E;  2UU9 E;  4BMJ A;  1PKP A;  4R2A A;  2DIX A;  3T1H E;  4X65 E;  4F9B B;  1N32 E;  3TQM A;  4DR3 E;  2DSY A;  2L8T A;  2EPP A;  4LFB E;  2ENA A;  2EMW A;  4BC7 A;  2HC5 A;  4DR1 E;  5CFF E;  3C4B A;  4OOG C;  4DUY E;  2WBS A;  2EOS A;  5AE1 A;  4ZYH A;  2EOJ A;  2EM4 A;  5IWA E;  2HGH A;  2EPK X;  4F54 A;  5DNY A;  2F4V E;  2LJU A;  1RC7 A;  1XMO E;  3KZZ A;  1DQ3 A;  3EPJ A;  1EKZ A;  3IWC A;  1EH7 A;  2EML A;  1AH5 A;  2L33 A;  2M9A A;  2EN8 A;  3P1X A;  1WHN A;  4NZV A;  2JR1 A;  2MC6 A;  2CSH A;  1YPN A;  1PJQ A;  1HR0 E;  2ZM6 E;  3ADL A;  2JP9 A;  1TF3 A;  1KYQ A;  3ADI A;  1A1K A;  3QG5 C;  2EOY A;  4R2P A;  1O0W A;  2FGG A;  4DKK A;  3OTO E;  1HNZ E;  2YSO A;  2JXP A;  2UUB E;  1RMD A;  4WSG A;  4LF6 E;  3VYY A;  4MLQ A;  3VYX A;  4JI3 E;  4OX9 E;  2EN3 A;  3KZY A;  1YYO A;  4JI5 E;  2DLK A;  2EMH A;  1ZR9 A;  2YU8 A;  1DGC A;  2RQL A;  2R76 A;  1PJT A;  4O4K A;  1X6F A;  1A1H A;  2LBS B;  2DMY A;  4M2Z A;  2EQ3 A;  2ENC A;  4F6M A;  4B3T E;  2EQ0 A;  2L3J A;  1T38 A;  3RMP A;  2L92 A;  2L2K B;  5IV8 B;  1X5W A;  2MC5 A;  2VRD A;  1X3C A;  4LF9 E;  2B3T B;  4TUI A;  4X9J A;  3IWB A;  4DV4 E;  4AQY E;  3HPS A;  4DV3 E;  2UXC E;  1P47 A;  2M1S A;  2JY9 A;  5IXM B;  5KL7 A;  2EL4 A;  2EPL X;  1GZ6 A;  2D9H A;  2RS7 A;  1BBO A;  2EMI A;  2YTP A;  2LVH A;  5AE3 A;  4I8O A;  2EMX A;  5A6A A;  2YPN A;  2RPC A;  3ADG A;  4JI6 E;  4WSP A;  3ADJ A;  5KL6 A;  2NUF A;  4WX9 A;  5LMN E;  4R2C A;  4DV6 E;  1A1L A;  2ELZ A;  4P7D A;  2WZO A;  1PDA A;  4BHB A;  3J7A G;  2LO3 A;  4LU9 A;  2RSI A;  1HNX E;  2EN4 A;  1MEY C;  4DMI A;  4GKJ E;  2UXD E;  3BGH A;  1A1F A;  2EPM X;  2EOZ A;  3DF6 A;  2B7T A;  3HQ1 A;  4DV7 E;  1YUJ A;  4RH8 A;  2EMC A;  4WPY A;  3HTX A;  2YRH A;  3ZOQ B;  4F9A B;  4M0V A;  4BCA A;  2EOR A;  3BID A;  2YTD A;  2EPX A;  1WXR A;  2ENH A;  3IWD A;  1T4L B;  4GEQ B;  1J5E E;  2YWQ A;  2EN1 A;  4R2E A;  3VHT B;  1N33 E;  2EOX A;  1YYK A;  4JI1 E;  3JAM C;  1EH6 A;  4DV0 E;  2LJH A;  4IS1 C;  5LLQ A;  2LMZ A;  1KJK A;  4R2S A;  2EOE A;  3AV0 A;  1TN9 A;  2F8B A;  4DR2 E;  1Z1B A;  5A6J A;  4WXD A;  2JWO A;  4DR4 E;  4GKK E;  2EOF A;  4M9V C;  1FKA E;  1IBM E;  2N3G A;  2EPN A;  2EN6 A;  3MHS C;  2N8X A;  1SFE A;  2B7V A;  4LF5 E;  2Q8U A;  4J8Z A;  2I13 A;  4JI2 E;  2EM6 A;  2YRM A;  5ADZ A;  1J26 A;  4F2J C;  3T1Y E;  1PJS A;  3HPZ A;  4DR7 E;  2MKD A;  3K6Q A;  2V87 A;  2EL6 A;  4DR5 E;  2R1F A;  2YTG A;  3JTZ A;  2RS6 A;  2GHF A;  4X66 E;  3VK6 A;  1A1G A;  1ZBQ A;  2EMF A;  1UBD C;  2V88 A;  2M4I A;  4YHH E;  2K4V A;  4O5G A;  4F9C B;  1BB8 A;  1X48 A;  4JI4 E;  3C4T A;  1I94 E;  3F6G A;  4WXC A;  1DI2 A;  1QU6 A;  1JK1 A;  2A25 A;  3AUZ A;  2DLQ A;  3EPH A;  2YTE A;  2EMK A;  2EM0 A;  2EMZ A;  3DJW A;  1RQ0 A;  5A6K A;  1IBK E;  1ZAA C;  2E1M A;  2EOH A;  1A1J A;  2LV2 A;  1A1I A;  2MKN A;  5F3W A;  4LFC E;  2LUP B;  2HHH E;  5AE2 A;  1XNQ E;  4ZYG A;  1NCS A;  3EQ1 A;  4L5N C;  5T6J A;  2L3C A;  2EOQ A;  1G2D C;  2NA2 A;  4LF8 E;  5AC4 A;  3BF2 A;  2DMI A;  2GLI A;  4HEI A;  2E5L E;  1LLM C;  5KL5 A;  2VF1 A;  1IQO A;  1WJP A;  1N36 E;  4JI7 E;  1N34 E;  2MDG A;  4IJD A;  2K7I A;  1YSA C;  3ECR A;  4WYQ B;  1X47 A;  2MDR A;  2YTI A;  2EN7 A;  1X6E A;  1AAY A;  4TUG A;  2YZT A;  2KON A;  4P78 A;  4DR6 E;  4Q28 A;  2I9I A;  2L2N A;  1T4N A;  2EOO A;  2YTF A;  2ODR C;  2EL5 A;  2KOU A;  2LCE A;  1UN6 B;  5AC5 A;  1EH8 A;  2UUA E;  1QNT A;  4L8N A;  2NUG A;  2EPR A;  2EMB A;  3L00 A;  4DV1 E;  2EOM A;  4X8W A;  1WRJ A;  3FIG A;  4YY3 E;  3EPL A;  5A69 A;  2NUE A;  2JVA A;  4LFA E;  4JI8 E;  1IQS A;  1B69 A;  4NXM E;  2YTN A;  1IBL E;  2VE7 C;  2M7Q A;  2L2M A;  5KL4 A;  2ELY A;  1NEI A;  5A2Q C;  4R2Q A;  2UUC E;  2RTX A;  2YTO A;  5TSE A;  2L6M A;  3MHH C;  2ADR A;  2CT1 A;  2IHR 1;  4B3M E;  2EM8 A;  1T39 A;  1JK2 A;  2V86 A;  5KL2 A;  3BBG A;  4BHC A;  4NXN E;  2N3H A;  1IMU A;  1X6H A;  4M30 A;  1MGT A;  3MSW A;  2JOB A;  2EOI A;  4ZYD A;  2V85 A;  2HJJ A;  2GPI A;  1YUI A;  1WHQ A;  2EE8 A;  3KWR A;  2LT7 A;  5KL3 A;  2EPC A; 
#chains in the Genus database with same CATH homology
 2EMZ A;  2EMY A;  3M99 B;  2DGC A;  2EP3 A;  2EPP A;  2RPC A;  3EPK A;  5KL6 A;  2E72 A;  2ENA A;  2EMW A;  1ZAA C;  2YTE A;  4R2C A;  1A1L A;  2ELZ A;  2EOH A;  1A1J A;  2LV2 A;  2WBS A;  1A1I A;  2EOS A;  2MKN A;  2EOJ A;  2EM4 A;  2LO3 A;  2HGH A;  1F2I G;  2RSI A;  2EM2 A;  2EN4 A;  2EM9 A;  1MEY C;  1NCS A;  2DRP A;  1A1F A;  2EOQ A;  1G2D C;  2EOZ A;  1YUJ A;  3EPJ A;  2DMI A;  2GLI A;  2EMC A;  2EML A;  1LLM C;  2YRH A;  5KL5 A;  2M9A A;  2EN8 A;  1WJP A;  2EOR A;  1G2F C;  2MDG A;  2EM7 A;  2EPU A;  2EPZ A;  2YTJ A;  2YTD A;  2CSH A;  2WBT A;  2EPX A;  4IJD A;  1YSA C;  2ENH A;  2BB8 A;  2YTI A;  2EN1 A;  1X6E A;  2EN7 A;  4R2E A;  3VHT B;  1AAY A;  2JPA A;  2EPC A;  2EOX A;  1TF3 A;  2JP9 A;  1A1K A;  2EOY A;  2YTP A;  4R2P A;  2WCC 3;  4IS1 C;  4GZN C;  2EOO A;  2YTF A;  1KJK A;  4F6N A;  2EL5 A;  2YTQ A;  2EOE A;  4R2S A;  2LCE A;  2YSO A;  1UN6 B;  2J7J A;  1TN9 A;  1ZU1 A;  1RMD A;  4WSG A;  1Z1B A;  2YRK A;  2EPR A;  2EOF A;  2NAB A;  2EMB A;  4M9V C;  2WBU A;  2EN3 A;  2EOM A;  3EPL A;  3UK3 C;  2EN6 A;  3MHS C;  2DLK A;  2EMH A;  1ZR9 A;  2YU8 A;  1DGC A;  1B69 A;  2I13 A;  2YTN A;  2YSP A;  1X6F A;  2EM6 A;  2YRM A;  2EMG A;  2PRT A;  1A1H A;  4F2J C;  5KL4 A;  2ELY A;  2ENC A;  2EQ3 A;  4R2Q A;  4F6M A;  2MKD A;  2EQ0 A;  2YTO A;  4R2D A;  2EN2 A;  2EMA A;  3MHH C;  2EL6 A;  2EM3 A;  2R1F A;  2EQ1 A;  2ADR A;  2EJ4 A;  2CT1 A;  2YTG A;  2EPA A;  2EM8 A;  1X5W A;  2VRD A;  1X3C A;  1JK2 A;  2GHF A;  2YU5 A;  4X9J A;  1A1G A;  2CTD A;  2EMF A;  5KL2 A;  1UBD C;  1TF6 A;  2EM5 A;  1X6H A;  4R2R A;  4FK5 C;  1P47 A;  2EOI A;  5KL7 A;  1BB8 A;  2EL4 A;  4R2A A;  1YUI A;  2EE8 A;  2D9H A;  1BBO A;  1JK1 A;  2LT7 A;  2A25 A;  5KL3 A;  2EMI A;  2DLQ A;  2LVH A;  3EPH A;  2EMK A;  2EMX A;  2EM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...