4R2RA

Wilms tumor protein (wt1) zinc fingers in complex with carboxylated dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
88
Chain Sequence
SEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Wilms tumor protein, isoform 4/CRA_a
publication title Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 29
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4r2rA00
2LO3A 2EM3A 2ADRA 4R2QA 2EPXA 2EPPA 3MHSC 1LLMC 2YRHA 2EM9A 1G2FC 1G2DC 2EMGA 2EOIA 2EPZA 4IS1C 2EP3A 2EL5A 4R2EA 2YSOA 1A1KA 2EQ3A 2EOOA 3EPLA 2EOHA 2WBSA 4F6NA 2YSPA 1P47A 2DGCA 2EM2A 2E72A 2MDGA 2EMXA 2YRKA 2EMAA 2LV2A 2DRPA 5KL2A 4F2JC 2EM5A 1TF6A 2EM0A 2EOXA 2VRDA 2PRTA 1A1GA 2EMWA 2EPRA 2EOYA 2DLQA 2WBTA 4R2PA 3EPHA 2JPAA 1YSAC 2YU8A 1UBDC 2ELYA 2EOJA 2YTPA 1ZR9A 2EM4A 2BB8A 2EM8A 2EMHA 1BBOA 2YRMA 1JK1A 3MHHC 1F2IG 2EPAA 2NABA 5KL3A 2EOFA 1NCSA 2EM7A 1WJPA 2YTQA 1ZU1A 2EN4A 2R1FA 5KL7A 2EN1A 5KL4A 1MEYC 2MKNA 4R2AA 2EL6A 3EPKA 2YTEA 2YTDA 2JP9A 2I13A 2CSHA 2EN7A 2LCEA 4M9VC 1A1IA 2ENHA 2EMKA 2LVHA 2YTNA 2CTDA 2EMBA 2LT7A 2EMCA 2EMFA 2YTFA 1X6EA 4FK5C 2EOMA 2HGHA 1B69A 1YUIA 2D9HA 2EOQA 2EPCA 2M9AA 2RSIA 2EMZA 1Z1BA 1JK2A 2EN3A 5KL5A 2WCC3 2CT1A 1DGCA 2EE8A 3UK3C 1X6FA 4WSGA 2YU5A 5KL6A 1A1FA 2A25A 2EN6A 2EMYA 2YTGA 4R2DA 1TN9A 4R2SA 1YUJA 1X5WA 4GZNC 2DMIA 2EOZA 4X9JA 1BB8A 3M99B 2DLKA 3VHTB 2ENAA 2YTIA 3EPJA 2YTOA 4R2RA 1A1LA 2EOEA 2EL4A 2WBUA 2EMLA 4IJDA 2MKDA 1AAYA 2EMIA 2J7JA 1A1HA 1TF3A 1KJKA 1X3CA 2EJ4A 2ENCA 1RMDA 2ELZA 1UN6B 1X6HA 2EOSA 2EN2A 2GHFA 1A1JA 1ZAAC 2GLIA 2YTJA 4F6MA 2EN8A 4R2CA 2EORA 2EPUA 2RPCA 2EM6A 2EQ1A 2EQ0A
chains in the Genus database with same CATH superfamily
1AH5A 2EPPA 1LLMC 1HR0E 2UUBE 2EOIA 1X49A 2EPZA 2DB2A 2EP3A 4R2EA 4AQYE 1FKAE 4DKKA 3EPLA 3H09A 2EPMX 2EM2A 2E72A 4F9AB 2YRKA 2G7HA 2KHXA 2RQLA 4F2JC 2EM5A 1PDAA 2LJUA 4J8ZA 3KZZA 1UHZA 2EOYA 4X66E 3VYXA 3EPHA 1YSAC 2LTSA 4HEIA 4ZYDA 2E1MA 1IQSA 2V89A 3OMLA 2JOBA 2UXDE 1HNZE 2JYAA 3AUZA 3VYYA 2EOFA 4GKJE 2L6MA 5A2QC 4LF8E 5KL4A 1BBGA 2HHHE 2LBSB 2JP9A 4NXME 2L3JA 2CSHA 2EN7A 4M9VC 4KHPE 4DV3E 2CTDA 3J81C 4JI8E 1EKZA 1X6EA 4FK5C 3C6KA 4JI3E 1IMUA 4M0VA 2D9HA 2EN3A 2H36X 2FTXB 2YZTA 4YHHE 4ZYGA 5ADZA 5KL5A 1WHQA 3KWRA 2EE8A 4P7DA 2L8TA 4DV4E 2YU5A 1A1FA 4F54A 2YTGA 4M2ZA 3J7AG 4LF5E 3C6MA 4WSPA 1GQEA 4F9CB 2V83A 3T1HE 3M99B 5CFFE 3VHTB 2LMZA 3EPJA 1X48A 4WXDA 2YTOA 4NXNE 2WBUA 4IJDA 2MKDA 1AAYA 2V87A 3BGHA 2K7IA 5TSEA 2EJ4A 1IBLE 3HQ1A 2YTJA 3ADGA 3C4BA 4HTGA 4JI1E 2ODRD 2M4IA 2RSMA 4GKKE 2ADRA 3KZYA 2EPXA 2ODRC 3MHSC 1T38A 1G2DC 1SR9A 4IS1C 2EL5A 2YSOA 2DSYA 2JOXA 3QG5C 4M30A 2EQ3A 2CPNA 2EOOA 3T1YE 4R8OA 2WBSA 1P47A 2YSPA 2DGCA 1EH7A 2KONA 2KOUA 4JI0E 2EMAA 1RC7A 3BIDA 2YT4A 2B3TB 2JWOA 2EM0A 2LUPB 4TUGA 2PRTA 1A1GA 2LE2A 3MSWA 2DLQA 4R2PA 4Q35B 2YU8A 3EQ1A 4DUZE 1ZR9A 2EPLX 2E5LE 2EM4A 2DIXA 2FV4B 2EPKX 1F2IG 2EPAA 2NABA 4DV2E 1NCSA 5LMUE 3DF6A 5A6BD 4DR1E 1YZ9A 2L33A 2RS6A 3HXLA 4LF6E 2DMYA 3C4TA 1YYKA 5IV8B 2ENHA 5AE2A 2R76A 3P1XA 3JAMC 2EMBA 2V8QB 2LT7A 1L4SA 1GTKA 1ZBQA 4X64E 4R03A 2M9AA 1Z1BA 2EMZA 2WCC3 2EPNA 3J80C 2CT1A 1PJTA 1N34E 5LLQA 2K4VA 1T4OA 4DV1E 1EH8A 3UK3C 3IWCA 2L2KB 1O0WA 1ZBTA 5KL6A 1YYOA 4O4KA 2A25A 1YYWA 4JI2E 4DV7E 3DJWA 2EOZA 2DLKA 1XNQE 1J26A 2YTIA 2BBGA 5LMNE 4B3RE 4R2RA 4DV5E 1N33E 1XMOE 2NUEA 2EOEA 2JVAA 2EZ6A 2WZOA 3FIGA 4BHCA 4MLVA 2ENCA 1RMDA 2ELZA 5T6JA 2F4VE 2EN2A 2IHR1 4R2CA 4LF4E 2EORA 2EPUA 5DNYA 3ECRA 2YWQA 5A6KA 4X8WA 1YPNA 4LFAE 2LRSA 2MDRA 5LL6R 1DQ3A 1STUA 4F9BB 2EMGA 4O43A 4P78A 3BF2A 5AE3A 2EMXA 4NZVA 4BC9A 2NA2A 2LV2A 1UILA 1TF6A 2EWLA 2VRDA 4ZYEA 4RHBB 4DR5E 2EPRA 2L2MA 4OX9E 2JPAA 5F3WA 3IWBA 1UBDC 2YTPA 4JYAE 2JY9A 1X47A 4OOGC 2EM8A 2EMHA 1PKPA 2YRMA 2UU9E 3HPZA 4L5NC 5KL3A 2R1FA 5KL7A 2EN1A 1MEYC 2MKNA 4R2AA 3EPKA 3HPSA 4YY3E 2V85A 2YTEA 4NHRA 2YPNA 2YTDA 4DV6E 3ADIA 2LCEA 1PJSA 2LVHA 2YTNA 4WXCA 4B3ME 2EMCA 3THNA 2YTFA 1SFEA 1FJGE 2EOMA 2RS7A 1B69A 2EOQA 2MC6A 2L3CA 3THOB 2EPOA 2F8BA 3LLHA 1J5EE 2VF1A 1DGCA 2FGGA 4JI7E 4TUIA 1X6FA 4WSGA 4I8OA 2EN6A 1TN9A 4R2DA 5A69A 3BBGA 1YUJA 4JI6E 3OTOE 4GZNC 4BS9A 1N32E 3TQMA 4X9JA 1BB8A 3LMLA 5A6AA 4DR6E 2VQFE 3HTXA 1A1LA 2B7VA 2V86A 4LFCE 1MGTA 4Q28A 3ZOQB 1DI2A 1T4NA 2J7JA 1TF3A 4BMJA 4O5GA 1RQ0A 2UUCE 1UN6B 1X6HA 2EOSA 2B7TA 1ZAAC 2LJHA 2N3HA 2GLIA 2EN8A 2L2NA 2RPCA 4X65E 4WX9A 2EM6A 4WPYA 5AC4A 2LO3A 2EM3A 3JTZA 4R2QA 3L00A 4DR4E 4DV0E 5A6BA 2YRHA 2EM9A 1G2FC 1A1KA 1HNXE 2EOHA 4F6NA 4KWYA 2MDGA 3K6QA 5A6JA 1XNRE 2N3GA 2DRPA 5KL2A 2ZM6E 1T4LB 2EOXA 4BCAA 3J7Yp 4RH8A 2EMWA 2GPIA 5FLXC 2VQEE 1XMQE 1GZ6A 2L92A 2WBTA 2ELYA 2EOJA 1BBOA 2BB8A 2UXBE 5IWAE 1JK1A 4DR3E 4LF7E 4ZYHA 1NEIA 3MHHC 2LUQA 4JI5E 2JXPA 1IQOA 2EM7A 2UXCE 1WJPA 2YTQA 1ZU1A 2EN4A 3RMPA 3ADLA 3F6HA 2VE7C 2EL6A 1QNTA 4MLQA 2UUAE 2I13A 1N36E 1I94E 3JU0A 4DR7E 1A1IA 1N3GA 2EMKA 5AASA 2MC5A 3VK6A 2EMFA 2N8XA 4WFTA 2NUGA 2B9DA 2HGHA 1YUIA 5IT9C 4JV5E 2EPCA 4B3SE 4K0KE 2RSIA 1KYQA 1WRJA 4BC7A 4BBYA 5IXMB 1JK2A 4N4RB 1HNWE 1WXRA 4DMIA 4DR2E 4LF9E 2HJJA 4LTYA 4B3TE 5BR8E 1IBME 2V88A 1QU6A 3F6GA 2M1SA 2EMYA 3AV0A 4R2SA 4L8NA 4GEQB 1EH6A 1X5WA 4O24A 2I9IA 2HC5A 2LTRA 2DMIA 4X62E 4LU9A 2ENAA 5AE1A 1T39A 2Q8UA 5AC5A 2EL4A 2EMLA 2EMIA 1A1HA 4DUYE 1IBKE 4JI4E 3ADJA 1KJKA 1PJQA 1X3CA 4LFBE 1A1JA 2NUFA 2GHFA 3IWDA 4BHBA 4F6MA 1WHNA 4KZSA 2JR1A 1YFHA 2M7QA 2EQ1A 2EQ0A 4WYQB 2RTXA
chains in the Genus database with same CATH topology
2LO3A 2EM3A 2ADRA 4R2QA 2EPXA 2EPPA 3MHSC 1LLMC 2YRHA 2EM9A 1G2FC 1G2DC 2EMGA 2EOIA 2EPZA 4IS1C 2EP3A 2EL5A 4R2EA 2YSOA 1A1KA 2EQ3A 2EOOA 3EPLA 2EOHA 2WBSA 4F6NA 2YSPA 1P47A 2DGCA 2EM2A 2E72A 2MDGA 2EMXA 2YRKA 2EMAA 2LV2A 2DRPA 5KL2A 4F2JC 2EM5A 1TF6A 2EM0A 2EOXA 2VRDA 2PRTA 1A1GA 2EMWA 2EPRA 2EOYA 2DLQA 2WBTA 4R2PA 3EPHA 2JPAA 1YSAC 2YU8A 1UBDC 2ELYA 2EOJA 2YTPA 1ZR9A 2EM4A 2BB8A 2EM8A 2EMHA 1BBOA 2YRMA 1JK1A 3MHHC 1F2IG 2EPAA 2NABA 5KL3A 2EOFA 1NCSA 2EM7A 1WJPA 2YTQA 1ZU1A 2EN4A 2R1FA 5KL7A 2EN1A 5KL4A 1MEYC 2MKNA 4R2AA 2EL6A 3EPKA 2YTEA 2YTDA 2JP9A 2I13A 2CSHA 2EN7A 2LCEA 4M9VC 1A1IA 2ENHA 2EMKA 2LVHA 2YTNA 2CTDA 2EMBA 2LT7A 2EMCA 2EMFA 2YTFA 1X6EA 4FK5C 2EOMA 2HGHA 1B69A 1YUIA 2D9HA 2EOQA 2EPCA 2M9AA 2RSIA 2EMZA 1Z1BA 1JK2A 2EN3A 5KL5A 2WCC3 2CT1A 1DGCA 2EE8A 3UK3C 1X6FA 4WSGA 2YU5A 5KL6A 1A1FA 2A25A 2EN6A 2EMYA 2YTGA 4R2DA 1TN9A 4R2SA 1YUJA 1X5WA 4GZNC 2DMIA 2EOZA 4X9JA 1BB8A 3M99B 2DLKA 3VHTB 2ENAA 2YTIA 3EPJA 2YTOA 4R2RA 1A1LA 2EOEA 2EL4A 2WBUA 2EMLA 4IJDA 2MKDA 1AAYA 2EMIA 2J7JA 1A1HA 1TF3A 1KJKA 1X3CA 2EJ4A 2ENCA 1RMDA 2ELZA 1UN6B 1X6HA 2EOSA 2EN2A 2GHFA 1A1JA 1ZAAC 2GLIA 2YTJA 4F6MA 2EN8A 4R2CA 2EORA 2EPUA 2RPCA 2EM6A 2EQ1A 2EQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LO3 A;  2EM3 A;  2ADR A;  4R2Q A;  2EPX A;  2EPP A;  3MHS C;  1LLM C;  2YRH A;  2EM9 A;  1G2F C;  1G2D C;  2EMG A;  2EOI A;  2EPZ A;  4IS1 C;  2EP3 A;  2EL5 A;  4R2E A;  2YSO A;  1A1K A;  2EQ3 A;  2EOO A;  3EPL A;  2EOH A;  2WBS A;  4F6N A;  2YSP A;  1P47 A;  2DGC A;  2EM2 A;  2E72 A;  2MDG A;  2EMX A;  2YRK A;  2EMA A;  2LV2 A;  2DRP A;  5KL2 A;  4F2J C;  2EM5 A;  1TF6 A;  2EM0 A;  2EOX A;  2VRD A;  2PRT A;  1A1G A;  2EMW A;  2EPR A;  2EOY A;  2DLQ A;  2WBT A;  4R2P A;  3EPH A;  2JPA A;  1YSA C;  2YU8 A;  1UBD C;  2ELY A;  2EOJ A;  2YTP A;  1ZR9 A;  2EM4 A;  2BB8 A;  2EM8 A;  2EMH A;  1BBO A;  2YRM A;  1JK1 A;  3MHH C;  1F2I G;  2EPA A;  2NAB A;  5KL3 A;  2EOF A;  1NCS A;  2EM7 A;  1WJP A;  2YTQ A;  1ZU1 A;  2EN4 A;  2R1F A;  5KL7 A;  2EN1 A;  5KL4 A;  1MEY C;  2MKN A;  4R2A A;  2EL6 A;  3EPK A;  2YTE A;  2YTD A;  2JP9 A;  2I13 A;  2CSH A;  2EN7 A;  2LCE A;  4M9V C;  1A1I A;  2ENH A;  2EMK A;  2LVH A;  2YTN A;  2CTD A;  2EMB A;  2LT7 A;  2EMC A;  2EMF A;  2YTF A;  1X6E A;  4FK5 C;  2EOM A;  2HGH A;  1B69 A;  1YUI A;  2D9H A;  2EOQ A;  2EPC A;  2M9A A;  2RSI A;  2EMZ A;  1Z1B A;  1JK2 A;  2EN3 A;  5KL5 A;  2WCC 3;  2CT1 A;  1DGC A;  2EE8 A;  3UK3 C;  1X6F A;  4WSG A;  2YU5 A;  5KL6 A;  1A1F A;  2A25 A;  2EN6 A;  2EMY A;  2YTG A;  4R2D A;  1TN9 A;  4R2S A;  1YUJ A;  1X5W A;  4GZN C;  2DMI A;  2EOZ A;  4X9J A;  1BB8 A;  3M99 B;  2DLK A;  3VHT B;  2ENA A;  2YTI A;  3EPJ A;  2YTO A;  4R2R A;  1A1L A;  2EOE A;  2EL4 A;  2WBU A;  2EML A;  4IJD A;  2MKD A;  1AAY A;  2EMI A;  2J7J A;  1A1H A;  1TF3 A;  1KJK A;  1X3C A;  2EJ4 A;  2ENC A;  1RMD A;  2ELZ A;  1UN6 B;  1X6H A;  2EOS A;  2EN2 A;  2GHF A;  1A1J A;  1ZAA C;  2GLI A;  2YTJ A;  4F6M A;  2EN8 A;  4R2C A;  2EOR A;  2EPU A;  2RPC A;  2EM6 A;  2EQ1 A;  2EQ0 A; 
#chains in the Genus database with same CATH topology
 1AH5 A;  2EPP A;  1LLM C;  1HR0 E;  2UUB E;  2EOI A;  1X49 A;  2EPZ A;  2DB2 A;  2EP3 A;  4R2E A;  4AQY E;  1FKA E;  4DKK A;  3EPL A;  3H09 A;  2EPM X;  2EM2 A;  2E72 A;  4F9A B;  2YRK A;  2G7H A;  2KHX A;  2RQL A;  4F2J C;  2EM5 A;  1PDA A;  2LJU A;  4J8Z A;  3KZZ A;  1UHZ A;  2EOY A;  4X66 E;  3VYX A;  3EPH A;  1YSA C;  2LTS A;  4HEI A;  4ZYD A;  2E1M A;  1IQS A;  2V89 A;  3OML A;  2JOB A;  2UXD E;  1HNZ E;  2JYA A;  3AUZ A;  3VYY A;  2EOF A;  4GKJ E;  2L6M A;  5A2Q C;  4LF8 E;  5KL4 A;  1BBG A;  2HHH E;  2LBS B;  2JP9 A;  4NXM E;  2L3J A;  2CSH A;  2EN7 A;  4M9V C;  4KHP E;  4DV3 E;  2CTD A;  3J81 C;  4JI8 E;  1EKZ A;  1X6E A;  4FK5 C;  3C6K A;  4JI3 E;  1IMU A;  4M0V A;  2D9H A;  2EN3 A;  2H36 X;  2FTX B;  2YZT A;  4YHH E;  4ZYG A;  5ADZ A;  5KL5 A;  1WHQ A;  3KWR A;  2EE8 A;  4P7D A;  2L8T A;  4DV4 E;  2YU5 A;  1A1F A;  4F54 A;  2YTG A;  4M2Z A;  3J7A G;  4LF5 E;  3C6M A;  4WSP A;  1GQE A;  4F9C B;  2V83 A;  3T1H E;  3M99 B;  5CFF E;  3VHT B;  2LMZ A;  3EPJ A;  1X48 A;  4WXD A;  2YTO A;  4NXN E;  2WBU A;  4IJD A;  2MKD A;  1AAY A;  2V87 A;  3BGH A;  2K7I A;  5TSE A;  2EJ4 A;  1IBL E;  3HQ1 A;  2YTJ A;  3ADG A;  3C4B A;  4HTG A;  4JI1 E;  2ODR D;  2M4I A;  2RSM A;  4GKK E;  2ADR A;  3KZY A;  2EPX A;  2ODR C;  3MHS C;  1T38 A;  1G2D C;  1SR9 A;  4IS1 C;  2EL5 A;  2YSO A;  2DSY A;  2JOX A;  3QG5 C;  4M30 A;  2EQ3 A;  2CPN A;  2EOO A;  3T1Y E;  4R8O A;  2WBS A;  1P47 A;  2YSP A;  2DGC A;  1EH7 A;  2KON A;  2KOU A;  4JI0 E;  2EMA A;  1RC7 A;  3BID A;  2YT4 A;  2B3T B;  2JWO A;  2EM0 A;  2LUP B;  4TUG A;  2PRT A;  1A1G A;  2LE2 A;  3MSW A;  2DLQ A;  4R2P A;  4Q35 B;  2YU8 A;  3EQ1 A;  4DUZ E;  1ZR9 A;  2EPL X;  2E5L E;  2EM4 A;  2DIX A;  2FV4 B;  2EPK X;  1F2I G;  2EPA A;  2NAB A;  4DV2 E;  1NCS A;  5LMU E;  3DF6 A;  5A6B D;  4DR1 E;  1YZ9 A;  2L33 A;  2RS6 A;  3HXL A;  4LF6 E;  2DMY A;  3C4T A;  1YYK A;  5IV8 B;  2ENH A;  5AE2 A;  2R76 A;  3P1X A;  3JAM C;  2EMB A;  2V8Q B;  2LT7 A;  1L4S A;  1GTK A;  1ZBQ A;  4X64 E;  4R03 A;  2M9A A;  1Z1B A;  2EMZ A;  2WCC 3;  2EPN A;  3J80 C;  2CT1 A;  1PJT A;  1N34 E;  5LLQ A;  2K4V A;  1T4O A;  4DV1 E;  1EH8 A;  3UK3 C;  3IWC A;  2L2K B;  1O0W A;  1ZBT A;  5KL6 A;  1YYO A;  4O4K A;  2A25 A;  1YYW A;  4JI2 E;  4DV7 E;  3DJW A;  2EOZ A;  2DLK A;  1XNQ E;  1J26 A;  2YTI A;  2BBG A;  5LMN E;  4B3R E;  4R2R A;  4DV5 E;  1N33 E;  1XMO E;  2NUE A;  2EOE A;  2JVA A;  2EZ6 A;  2WZO A;  3FIG A;  4BHC A;  4MLV A;  2ENC A;  1RMD A;  2ELZ A;  5T6J A;  2F4V E;  2EN2 A;  2IHR 1;  4R2C A;  4LF4 E;  2EOR A;  2EPU A;  5DNY A;  3ECR A;  2YWQ A;  5A6K A;  4X8W A;  1YPN A;  4LFA E;  2LRS A;  2MDR A;  5LL6 R;  1DQ3 A;  1STU A;  4F9B B;  2EMG A;  4O43 A;  4P78 A;  3BF2 A;  5AE3 A;  2EMX A;  4NZV A;  4BC9 A;  2NA2 A;  2LV2 A;  1UIL A;  1TF6 A;  2EWL A;  2VRD A;  4ZYE A;  4RHB B;  4DR5 E;  2EPR A;  2L2M A;  4OX9 E;  2JPA A;  5F3W A;  3IWB A;  1UBD C;  2YTP A;  4JYA E;  2JY9 A;  1X47 A;  4OOG C;  2EM8 A;  2EMH A;  1PKP A;  2YRM A;  2UU9 E;  3HPZ A;  4L5N C;  5KL3 A;  2R1F A;  5KL7 A;  2EN1 A;  1MEY C;  2MKN A;  4R2A A;  3EPK A;  3HPS A;  4YY3 E;  2V85 A;  2YTE A;  4NHR A;  2YPN A;  2YTD A;  4DV6 E;  3ADI A;  2LCE A;  1PJS A;  2LVH A;  2YTN A;  4WXC A;  4B3M E;  2EMC A;  3THN A;  2YTF A;  1SFE A;  1FJG E;  2EOM A;  2RS7 A;  1B69 A;  2EOQ A;  2MC6 A;  2L3C A;  3THO B;  2EPO A;  2F8B A;  3LLH A;  1J5E E;  2VF1 A;  1DGC A;  2FGG A;  4JI7 E;  4TUI A;  1X6F A;  4WSG A;  4I8O A;  2EN6 A;  1TN9 A;  4R2D A;  5A69 A;  3BBG A;  1YUJ A;  4JI6 E;  3OTO E;  4GZN C;  4BS9 A;  1N32 E;  3TQM A;  4X9J A;  1BB8 A;  3LML A;  5A6A A;  4DR6 E;  2VQF E;  3HTX A;  1A1L A;  2B7V A;  2V86 A;  4LFC E;  1MGT A;  4Q28 A;  3ZOQ B;  1DI2 A;  1T4N A;  2J7J A;  1TF3 A;  4BMJ A;  4O5G A;  1RQ0 A;  2UUC E;  1UN6 B;  1X6H A;  2EOS A;  2B7T A;  1ZAA C;  2LJH A;  2N3H A;  2GLI A;  2EN8 A;  2L2N A;  2RPC A;  4X65 E;  4WX9 A;  2EM6 A;  4WPY A;  5AC4 A;  2LO3 A;  2EM3 A;  3JTZ A;  4R2Q A;  3L00 A;  4DR4 E;  4DV0 E;  5A6B A;  2YRH A;  2EM9 A;  1G2F C;  1A1K A;  1HNX E;  2EOH A;  4F6N A;  4KWY A;  2MDG A;  3K6Q A;  5A6J A;  1XNR E;  2N3G A;  2DRP A;  5KL2 A;  2ZM6 E;  1T4L B;  2EOX A;  4BCA A;  3J7Y p;  4RH8 A;  2EMW A;  2GPI A;  5FLX C;  2VQE E;  1XMQ E;  1GZ6 A;  2L92 A;  2WBT A;  2ELY A;  2EOJ A;  1BBO A;  2BB8 A;  2UXB E;  5IWA E;  1JK1 A;  4DR3 E;  4LF7 E;  4ZYH A;  1NEI A;  3MHH C;  2LUQ A;  4JI5 E;  2JXP A;  1IQO A;  2EM7 A;  2UXC E;  1WJP A;  2YTQ A;  1ZU1 A;  2EN4 A;  3RMP A;  3ADL A;  3F6H A;  2VE7 C;  2EL6 A;  1QNT A;  4MLQ A;  2UUA E;  2I13 A;  1N36 E;  1I94 E;  3JU0 A;  4DR7 E;  1A1I A;  1N3G A;  2EMK A;  5AAS A;  2MC5 A;  3VK6 A;  2EMF A;  2N8X A;  4WFT A;  2NUG A;  2B9D A;  2HGH A;  1YUI A;  5IT9 C;  4JV5 E;  2EPC A;  4B3S E;  4K0K E;  2RSI A;  1KYQ A;  1WRJ A;  4BC7 A;  4BBY A;  5IXM B;  1JK2 A;  4N4R B;  1HNW E;  1WXR A;  4DMI A;  4DR2 E;  4LF9 E;  2HJJ A;  4LTY A;  4B3T E;  5BR8 E;  1IBM E;  2V88 A;  1QU6 A;  3F6G A;  2M1S A;  2EMY A;  3AV0 A;  4R2S A;  4L8N A;  4GEQ B;  1EH6 A;  1X5W A;  4O24 A;  2I9I A;  2HC5 A;  2LTR A;  2DMI A;  4X62 E;  4LU9 A;  2ENA A;  5AE1 A;  1T39 A;  2Q8U A;  5AC5 A;  2EL4 A;  2EML A;  2EMI A;  1A1H A;  4DUY E;  1IBK E;  4JI4 E;  3ADJ A;  1KJK A;  1PJQ A;  1X3C A;  4LFB E;  1A1J A;  2NUF A;  2GHF A;  3IWD A;  4BHB A;  4F6M A;  1WHN A;  4KZS A;  2JR1 A;  1YFH A;  2M7Q A;  2EQ1 A;  2EQ0 A;  4WYQ B;  2RTX A; 
#chains in the Genus database with same CATH homology
 2LO3 A;  2EM3 A;  2ADR A;  4R2Q A;  2EPX A;  2EPP A;  3MHS C;  1LLM C;  2YRH A;  2EM9 A;  1G2F C;  1G2D C;  2EMG A;  2EOI A;  2EPZ A;  4IS1 C;  2EP3 A;  2EL5 A;  4R2E A;  2YSO A;  1A1K A;  2EQ3 A;  2EOO A;  3EPL A;  2EOH A;  2WBS A;  4F6N A;  2YSP A;  1P47 A;  2DGC A;  2EM2 A;  2E72 A;  2MDG A;  2EMX A;  2YRK A;  2EMA A;  2LV2 A;  2DRP A;  5KL2 A;  4F2J C;  2EM5 A;  1TF6 A;  2EM0 A;  2EOX A;  2VRD A;  2PRT A;  1A1G A;  2EMW A;  2EPR A;  2EOY A;  2DLQ A;  2WBT A;  4R2P A;  3EPH A;  2JPA A;  1YSA C;  2YU8 A;  1UBD C;  2ELY A;  2EOJ A;  2YTP A;  1ZR9 A;  2EM4 A;  2BB8 A;  2EM8 A;  2EMH A;  1BBO A;  2YRM A;  1JK1 A;  3MHH C;  1F2I G;  2EPA A;  2NAB A;  5KL3 A;  2EOF A;  1NCS A;  2EM7 A;  1WJP A;  2YTQ A;  1ZU1 A;  2EN4 A;  2R1F A;  5KL7 A;  2EN1 A;  5KL4 A;  1MEY C;  2MKN A;  4R2A A;  2EL6 A;  3EPK A;  2YTE A;  2YTD A;  2JP9 A;  2I13 A;  2CSH A;  2EN7 A;  2LCE A;  4M9V C;  1A1I A;  2ENH A;  2EMK A;  2LVH A;  2YTN A;  2CTD A;  2EMB A;  2LT7 A;  2EMC A;  2EMF A;  2YTF A;  1X6E A;  4FK5 C;  2EOM A;  2HGH A;  1B69 A;  1YUI A;  2D9H A;  2EOQ A;  2EPC A;  2M9A A;  2RSI A;  2EMZ A;  1Z1B A;  1JK2 A;  2EN3 A;  5KL5 A;  2WCC 3;  2CT1 A;  1DGC A;  2EE8 A;  3UK3 C;  1X6F A;  4WSG A;  2YU5 A;  5KL6 A;  1A1F A;  2A25 A;  2EN6 A;  2EMY A;  2YTG A;  4R2D A;  1TN9 A;  4R2S A;  1YUJ A;  1X5W A;  4GZN C;  2DMI A;  2EOZ A;  4X9J A;  1BB8 A;  3M99 B;  2DLK A;  3VHT B;  2ENA A;  2YTI A;  3EPJ A;  2YTO A;  4R2R A;  1A1L A;  2EOE A;  2EL4 A;  2WBU A;  2EML A;  4IJD A;  2MKD A;  1AAY A;  2EMI A;  2J7J A;  1A1H A;  1TF3 A;  1KJK A;  1X3C A;  2EJ4 A;  2ENC A;  1RMD A;  2ELZ A;  1UN6 B;  1X6H A;  2EOS A;  2EN2 A;  2GHF A;  1A1J A;  1ZAA C;  2GLI A;  2YTJ A;  4F6M A;  2EN8 A;  4R2C A;  2EOR A;  2EPU A;  2RPC A;  2EM6 A;  2EQ1 A;  2EQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...