4R2RA

Wilms tumor protein (wt1) zinc fingers in complex with carboxylated dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
88
Chain Sequence
SEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Wilms tumor protein, isoform 4/CRA_a
total genus 29
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4r2rA00
2EM9A 2VRDA 4R2PA 2CT1A 2ELZA 2EMXA 1ZAAC 5KL4A 4M9VC 1AAYA 2EJ4A 1YUJA 4F6NA 2EN2A 3MHHC 2LT7A 2YTEA 2CSHA 2E72A 2EMAA 1F2IG 2EMGA 2EOIA 2EOZA 2WBSA 2EMKA 2LO3A 1YSAC 1JK2A 2JPAA 1TF3A 2EOMA 2YU5A 2EOFA 3EPLA 5KL5A 2DGCA 2YTQA 2EM8A 2EPXA 2DMIA 1MEYC 1X3CA 1YUIA 1UBDC 2EOSA 2I13A 2YRHA 1JK1A 2EL5A 1DGCA 4GZNC 4R2DA 1ZR9A 2EQ0A 3EPKA 2EMYA 2EPAA 2LCEA 3UK3C 4F2JC 2EPCA 1A1JA 2MKDA 1RMDA 2RPCA 2YTDA 2WBUA 1X6FA 2EOOA 1A1FA 4X9JA 1UN6B 2YTNA 2D9HA 2YTGA 2EMBA 2BB8A 2YRMA 2EN1A 2EOYA 2EN7A 4FK5C 2EMZA 2EL4A 2EPRA 2EN4A 2R1FA 2PRTA 3EPHA 1BBOA 2EM2A 2ENCA 2EPZA 2LVHA 2LV2A 2DLQA 4R2RA 2EOQA 2NABA 1G2FC 2EL6A 2YU8A 2EE8A 2GLIA 2YTFA 2EM7A 2EOJA 2EORA 2EOHA 1G2DC 1BB8A 1X5WA 1Z1BA 1A1HA 4WSGA 2ENAA 2WBTA 2RSIA 2YTPA 1B69A 4R2CA 2EM0A 3EPJA 4IJDA 2EM5A 1X6EA 2EMLA 4R2QA 1NCSA 1WJPA 2JP9A 1A1IA 1TF6A 5KL7A 3VHTB 2EOEA 2EMWA 1P47A 2EMHA 2A25A 4R2EA 2YTIA 1A1LA 2GHFA 2DRPA 2YRKA 2EPPA 2M9AA 3M99B 4IS1C 4F6MA 5KL6A 2MDGA 2EM3A 2EMFA 2EN6A 5KL3A 2EPUA 2ELYA 2EQ3A 5KL2A 1X6HA 1LLMC 4R2AA 2EM6A 2ENHA 2EM4A 2HGHA 1A1GA 2YSOA 2ADRA 2YTOA 1A1KA 4R2SA 2EMCA 2EN8A 2EP3A 2YSPA 1KJKA 2WCC3 2EMIA 1ZU1A 2MKNA 2EN3A 1TN9A 3MHSC 2DLKA 2YTJA 2EOXA 2EQ1A 2CTDA 2J7JA
chains in the Genus database with same CATH superfamily
2VRDA 2L3JA 2CT1A 2ELZA 4I8OA 5KL4A 4M9VC 3F6GA 5LLQA 4DV1E 2EN2A 4NZVA 2LT7A 3RMPA 2YTEA 4MLVA 1F2IG 4DR2E 2EOZA 2WBSA 2BBGA 2H36X 3THOB 1JK2A 2JPAA 4LF6E 1QNTA 1TF3A 2EOMA 2M4IA 5A69A 1IBME 1N3GA 4YY3E 4GKJE 4DKKA 2YT4A 4F9CB 4BS9A 4LF8E 3THNA 4LF5E 2YWQA 4JI0E 1UBDC 2G7HA 4B3RE 1DQ3A 3EPKA 4ZYDA 2MKDA 2N3HA 2DIXA 5A6AA 2WBUA 4WYQB 2BB8A 2YRMA 4HEIA 2EOYA 4DUZE 1X49A 3HQ1A 2PRTA 2HC5A 5AASA 4JV5E 2HJJA 2EPZA 2LV2A 2V88A 4WXCA 1I94E 2EE8A 1WHNA 2EOJA 4F9BB 3OMLA 1T39A 2FTXB 2WBTA 4R2CA 2EM0A 1UILA 1L4SA 1WJPA 2JP9A 4LF4E 4M2ZA 1TF6A 5KL7A 2YPNA 4Q35B 4LF7E 4R2EA 2DB2A 3OTOE 2EPPA 1IQOA 4M0VA 2R76A 2MDGA 2V87A 2B3TB 4JI7E 3HTXA 4DV2E 3VK6A 2L2KB 1GQEA 1LLMC 4GKKE 1WXRA 5A6BD 4DR3E 2ODRC 2V89A 2EN8A 2EP3A 2JOBA 3JAMC 2LUQA 2EN3A 2ODRD 3H09A 5TSEA 2DLKA 1YUJA 2EQ1A 3L00A 4BCAA 2J7JA 4DR5E 2EM9A 1HNXE 4R8OA 4BMJA 2MDRA 4R2PA 4X65E 4DV3E 2Q8UA 3FIGA 3C4TA 3J7AG 2V8QB 4JYAE 2JOXA 4F6NA 2V86A 1FJGE 1XNRE 3MHHC 1MGTA 2CSHA 4WFTA 4B3TE 4RH8A 1DI2A 1YSAC 4L8NA 4Q28A 4JI2E 4AQYE 2UUCE 4J8ZA 2DGCA 1YYOA 2DMIA 2LRSA 1UHZA 2N8XA 4MLQA 1ZBTA 4X66E 2F4VE 2I13A 4WXDA 1DGCA 5AC5A 3ADJA 2ZM6E 1EKZA 3C6KA 2RS6A 2EPAA 2LCEA 2V83A 5IWAE 4F2JC 2LBSB 1J5EE 2JR1A 2NUFA 1PJQA 2RPCA 2YTDA 2EOOA 5F3WA 1RQ0A 4X9JA 1A1FA 2K4VA 2UUBE 2EMBA 1PJTA 2MC5A 2NUEA 2K7IA 4GEQB 2RSMA 2V85A 2R1FA 3EPHA 2LE2A 2GPIA 4NXNE 2LUPB 2UU9E 4F54A 2DLQA 4R2RA 4K0KE 2RQLA 2EOQA 1WRJA 2MC6A 1G2FC 2EL6A 2KONA 2EM7A 3AUZA 1IBKE 4LFCE 1SR9A 2ENAA 2YTPA 2FV4B 2RSIA 1N33E 1X6EA 2EMLA 4R2QA 1XMOE 4DUYE 1WHQA 5LMUE 1A1IA 3VHTB 3KZYA 2EOEA 2EMWA 2KHXA 1P47A 2EMHA 4HTGA 3EQ1A 3M99B 2M9AA 3C4BA 5AE3A 2EM3A 2EMFA 2EN6A 1SFEA 3ZOQB 2E5LE 3LMLA 3ADIA 5KL2A 1HNWE 3VYXA 4DV5E 2L33A 4R2AA 3DJWA 2EM4A 1A1GA 2YTOA 4BBYA 1KYQA 2B7TA 2EMIA 4JI5E 1TN9A 2NUGA 2JY9A 2VF1A 2JXPA 2JYAA 2CTDA 3BIDA 2EMXA 1ZAAC 4R03A 4JI1E 2L6MA 3F6HA 2E72A 2EMGA 2M1SA 2EWLA 5LMNE 2EMKA 5A6KA 4BHCA 2YU5A 4X64E 1FKAE 2HHHE 2EOFA 2UXDE 2FGGA 2YTQA 5T6JA 5BR8E 3ECRA 2EPXA 1MEYC 2L2NA 1QU6A 3J81C 2YRHA 2EL5A 1J26A 4GZNC 1XNQE 4O43A 1HR0E 3TQMA 4O5GA 2EPCA 1A1JA 2LJHA 1X6FA 3BBGA 1UN6B 2YTGA 4ZYEA 5DNYA 4FK5C 1YYKA 4DV7E 2L2MA 2EMZA 4JI3E 4ZYGA 4DV4E 4WX9A 1EH6A 1PDAA 4YHHE 1BBOA 4B3ME 2YZTA 2ENCA 2LVHA 4DR6E 1EH8A 2NABA 3BGHA 4P7DA 2GLIA 2YTFA 4DMIA 3VYYA 4B3SE 1G2DC 2B7VA 1Z1BA 3LLHA 1A1HA 4RHBB 4WSGA 3ADLA 2RTXA 1B69A 4IJDA 5AE2A 3KWRA 2LTSA 3J7Yp 2EPNA 1NCSA 2EPOA 4LF9E 2IHR1 5FLXC 4LTYA 2A25A 5LL6R 2YTIA 3T1HE 2B9DA 4M30A 2I9IA 2YRKA 4IS1C 5IV8B 2EPUA 3ADGA 3JTZA 2F8BA 3P1XA 3J80C 2EM6A 4X8WA 2KOUA 3T1YE 3HPZA 1A1KA 4R2SA 3MSWA 1ZU1A 4L5NC 2LJUA 3BF2A 3HXLA 1IBLE 2EOXA 3K6QA 1YFHA 1YPNA 4BC7A 4LFAE 5A6BA 1AAYA 2EJ4A 4JI8E 1ZBQA 2DSYA 2EMAA 2EOIA 2LO3A 2JVAA 3IWBA 1GZ6A 1RC7A 2UXCE 3C6MA 5IXMB 3HPSA 2NA2A 1N32E 3EPLA 5KL5A 4NXME 1AH5A 2EM8A 3AV0A 1X47A 5A2QC 4LFBE 1T4NA 1X3CA 4WPYA 1YZ9A 4LU9A 1YUIA 5CFFE 4P78A 4DR7E 2JWOA 1EH7A 2EOSA 4DR4E 1JK1A 2RS7A 4DR1E 3KZZA 4R2DA 1ZR9A 2EQ0A 1GTKA 2EMYA 3UK3C 5IT9C 4F9AB 1PKPA 4X62E 1HNZE 1RMDA 2VE7C 4DV0E 4TUIA 2YTNA 2D9HA 1O0WA 4KHPE 4JI4E 2EN1A 2EN7A 2N3GA 2WZOA 2EL4A 4JI6E 4O24A 2EPRA 2EN4A 1T4LB 2EM2A 1N36E 2UUAE 2EPLX 2VQFE 5AC4A 2E1MA 3JU0A 1N34E 4N4RB 2YU8A 4NHRA 2VQEE 4O4KA 2EORA 2EOHA 4KWYA 2L92A 1BB8A 2EPMX 1X5WA 2CPNA 5A6JA 3IWDA 2DMYA 1IMUA 1X48A 3EPJA 2EM5A 4BC9A 4KZSA 1T4OA 2L8TA 2EPKX 4OOGC 1T38A 5ADZA 1STUA 1A1LA 2GHFA 2DRPA 1YYWA 4F6MA 5KL6A 3IWCA 5KL3A 2LTRA 2ELYA 1PJSA 1NEIA 2EQ3A 1X6HA 2EZ6A 4WSPA 4TUGA 2UXBE 2ENHA 5AE1A 2HGHA 2YSOA 1BBGA 2ADRA 2L3CA 3QG5C 4BHBA 4ZYHA 2EMCA 2YSPA 3DF6A 1KJKA 2WCC3 4DV6E 2M7QA 2MKNA 1XMQE 1IQSA 3MHSC 4OX9E 2LMZA 2YTJA
chains in the Genus database with same CATH topology
2EM9A 2VRDA 4R2PA 2CT1A 2ELZA 2EMXA 1ZAAC 5KL4A 4M9VC 1AAYA 2EJ4A 1YUJA 4F6NA 2EN2A 3MHHC 2LT7A 2YTEA 2CSHA 2E72A 2EMAA 1F2IG 2EMGA 2EOIA 2EOZA 2WBSA 2EMKA 2LO3A 1YSAC 1JK2A 2JPAA 1TF3A 2EOMA 2YU5A 2EOFA 3EPLA 5KL5A 2DGCA 2YTQA 2EM8A 2EPXA 2DMIA 1MEYC 1X3CA 1YUIA 1UBDC 2EOSA 2I13A 2YRHA 1JK1A 2EL5A 1DGCA 4GZNC 4R2DA 1ZR9A 2EQ0A 3EPKA 2EMYA 2EPAA 2LCEA 3UK3C 4F2JC 2EPCA 1A1JA 2MKDA 1RMDA 2RPCA 2YTDA 2WBUA 1X6FA 2EOOA 1A1FA 4X9JA 1UN6B 2YTNA 2D9HA 2YTGA 2EMBA 2BB8A 2YRMA 2EN1A 2EOYA 2EN7A 4FK5C 2EMZA 2EL4A 2EPRA 2EN4A 2R1FA 2PRTA 3EPHA 1BBOA 2EM2A 2ENCA 2EPZA 2LVHA 2LV2A 2DLQA 4R2RA 2EOQA 2NABA 1G2FC 2EL6A 2YU8A 2EE8A 2GLIA 2YTFA 2EM7A 2EOJA 2EORA 2EOHA 1G2DC 1BB8A 1X5WA 1Z1BA 1A1HA 4WSGA 2ENAA 2WBTA 2RSIA 2YTPA 1B69A 4R2CA 2EM0A 3EPJA 4IJDA 2EM5A 1X6EA 2EMLA 4R2QA 1NCSA 1WJPA 2JP9A 1A1IA 1TF6A 5KL7A 3VHTB 2EOEA 2EMWA 1P47A 2EMHA 2A25A 4R2EA 2YTIA 1A1LA 2GHFA 2DRPA 2YRKA 2EPPA 2M9AA 3M99B 4IS1C 4F6MA 5KL6A 2MDGA 2EM3A 2EMFA 2EN6A 5KL3A 2EPUA 2ELYA 2EQ3A 5KL2A 1X6HA 1LLMC 4R2AA 2EM6A 2ENHA 2EM4A 2HGHA 1A1GA 2YSOA 2ADRA 2YTOA 1A1KA 4R2SA 2EMCA 2EN8A 2EP3A 2YSPA 1KJKA 2WCC3 2EMIA 1ZU1A 2MKNA 2EN3A 1TN9A 3MHSC 2DLKA 2YTJA 2EOXA 2EQ1A 2CTDA 2J7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EM9 A;  2VRD A;  4R2P A;  2CT1 A;  2ELZ A;  2EMX A;  1ZAA C;  5KL4 A;  4M9V C;  1AAY A;  2EJ4 A;  1YUJ A;  4F6N A;  2EN2 A;  3MHH C;  2LT7 A;  2YTE A;  2CSH A;  2E72 A;  2EMA A;  1F2I G;  2EMG A;  2EOI A;  2EOZ A;  2WBS A;  2EMK A;  2LO3 A;  1YSA C;  1JK2 A;  2JPA A;  1TF3 A;  2EOM A;  2YU5 A;  2EOF A;  3EPL A;  5KL5 A;  2DGC A;  2YTQ A;  2EM8 A;  2EPX A;  2DMI A;  1MEY C;  1X3C A;  1YUI A;  1UBD C;  2EOS A;  2I13 A;  2YRH A;  1JK1 A;  2EL5 A;  1DGC A;  4GZN C;  4R2D A;  1ZR9 A;  2EQ0 A;  3EPK A;  2EMY A;  2EPA A;  2LCE A;  3UK3 C;  4F2J C;  2EPC A;  1A1J A;  2MKD A;  1RMD A;  2RPC A;  2YTD A;  2WBU A;  1X6F A;  2EOO A;  1A1F A;  4X9J A;  1UN6 B;  2YTN A;  2D9H A;  2YTG A;  2EMB A;  2BB8 A;  2YRM A;  2EN1 A;  2EOY A;  2EN7 A;  4FK5 C;  2EMZ A;  2EL4 A;  2EPR A;  2EN4 A;  2R1F A;  2PRT A;  3EPH A;  1BBO A;  2EM2 A;  2ENC A;  2EPZ A;  2LVH A;  2LV2 A;  2DLQ A;  4R2R A;  2EOQ A;  2NAB A;  1G2F C;  2EL6 A;  2YU8 A;  2EE8 A;  2GLI A;  2YTF A;  2EM7 A;  2EOJ A;  2EOR A;  2EOH A;  1G2D C;  1BB8 A;  1X5W A;  1Z1B A;  1A1H A;  4WSG A;  2ENA A;  2WBT A;  2RSI A;  2YTP A;  1B69 A;  4R2C A;  2EM0 A;  3EPJ A;  4IJD A;  2EM5 A;  1X6E A;  2EML A;  4R2Q A;  1NCS A;  1WJP A;  2JP9 A;  1A1I A;  1TF6 A;  5KL7 A;  3VHT B;  2EOE A;  2EMW A;  1P47 A;  2EMH A;  2A25 A;  4R2E A;  2YTI A;  1A1L A;  2GHF A;  2DRP A;  2YRK A;  2EPP A;  2M9A A;  3M99 B;  4IS1 C;  4F6M A;  5KL6 A;  2MDG A;  2EM3 A;  2EMF A;  2EN6 A;  5KL3 A;  2EPU A;  2ELY A;  2EQ3 A;  5KL2 A;  1X6H A;  1LLM C;  4R2A A;  2EM6 A;  2ENH A;  2EM4 A;  2HGH A;  1A1G A;  2YSO A;  2ADR A;  2YTO A;  1A1K A;  4R2S A;  2EMC A;  2EN8 A;  2EP3 A;  2YSP A;  1KJK A;  2WCC 3;  2EMI A;  1ZU1 A;  2MKN A;  2EN3 A;  1TN9 A;  3MHS C;  2DLK A;  2YTJ A;  2EOX A;  2EQ1 A;  2CTD A;  2J7J A; 
#chains in the Genus database with same CATH topology
 2VRD A;  2L3J A;  2CT1 A;  2ELZ A;  4I8O A;  5KL4 A;  4M9V C;  3F6G A;  5LLQ A;  4DV1 E;  2EN2 A;  4NZV A;  2LT7 A;  3RMP A;  2YTE A;  4MLV A;  1F2I G;  4DR2 E;  2EOZ A;  2WBS A;  2BBG A;  2H36 X;  3THO B;  1JK2 A;  2JPA A;  4LF6 E;  1QNT A;  1TF3 A;  2EOM A;  2M4I A;  5A69 A;  1IBM E;  1N3G A;  4YY3 E;  4GKJ E;  4DKK A;  2YT4 A;  4F9C B;  4BS9 A;  4LF8 E;  3THN A;  4LF5 E;  2YWQ A;  4JI0 E;  1UBD C;  2G7H A;  4B3R E;  1DQ3 A;  3EPK A;  4ZYD A;  2MKD A;  2N3H A;  2DIX A;  5A6A A;  2WBU A;  4WYQ B;  2BB8 A;  2YRM A;  4HEI A;  2EOY A;  4DUZ E;  1X49 A;  3HQ1 A;  2PRT A;  2HC5 A;  5AAS A;  4JV5 E;  2HJJ A;  2EPZ A;  2LV2 A;  2V88 A;  4WXC A;  1I94 E;  2EE8 A;  1WHN A;  2EOJ A;  4F9B B;  3OML A;  1T39 A;  2FTX B;  2WBT A;  4R2C A;  2EM0 A;  1UIL A;  1L4S A;  1WJP A;  2JP9 A;  4LF4 E;  4M2Z A;  1TF6 A;  5KL7 A;  2YPN A;  4Q35 B;  4LF7 E;  4R2E A;  2DB2 A;  3OTO E;  2EPP A;  1IQO A;  4M0V A;  2R76 A;  2MDG A;  2V87 A;  2B3T B;  4JI7 E;  3HTX A;  4DV2 E;  3VK6 A;  2L2K B;  1GQE A;  1LLM C;  4GKK E;  1WXR A;  5A6B D;  4DR3 E;  2ODR C;  2V89 A;  2EN8 A;  2EP3 A;  2JOB A;  3JAM C;  2LUQ A;  2EN3 A;  2ODR D;  3H09 A;  5TSE A;  2DLK A;  1YUJ A;  2EQ1 A;  3L00 A;  4BCA A;  2J7J A;  4DR5 E;  2EM9 A;  1HNX E;  4R8O A;  4BMJ A;  2MDR A;  4R2P A;  4X65 E;  4DV3 E;  2Q8U A;  3FIG A;  3C4T A;  3J7A G;  2V8Q B;  4JYA E;  2JOX A;  4F6N A;  2V86 A;  1FJG E;  1XNR E;  3MHH C;  1MGT A;  2CSH A;  4WFT A;  4B3T E;  4RH8 A;  1DI2 A;  1YSA C;  4L8N A;  4Q28 A;  4JI2 E;  4AQY E;  2UUC E;  4J8Z A;  2DGC A;  1YYO A;  2DMI A;  2LRS A;  1UHZ A;  2N8X A;  4MLQ A;  1ZBT A;  4X66 E;  2F4V E;  2I13 A;  4WXD A;  1DGC A;  5AC5 A;  3ADJ A;  2ZM6 E;  1EKZ A;  3C6K A;  2RS6 A;  2EPA A;  2LCE A;  2V83 A;  5IWA E;  4F2J C;  2LBS B;  1J5E E;  2JR1 A;  2NUF A;  1PJQ A;  2RPC A;  2YTD A;  2EOO A;  5F3W A;  1RQ0 A;  4X9J A;  1A1F A;  2K4V A;  2UUB E;  2EMB A;  1PJT A;  2MC5 A;  2NUE A;  2K7I A;  4GEQ B;  2RSM A;  2V85 A;  2R1F A;  3EPH A;  2LE2 A;  2GPI A;  4NXN E;  2LUP B;  2UU9 E;  4F54 A;  2DLQ A;  4R2R A;  4K0K E;  2RQL A;  2EOQ A;  1WRJ A;  2MC6 A;  1G2F C;  2EL6 A;  2KON A;  2EM7 A;  3AUZ A;  1IBK E;  4LFC E;  1SR9 A;  2ENA A;  2YTP A;  2FV4 B;  2RSI A;  1N33 E;  1X6E A;  2EML A;  4R2Q A;  1XMO E;  4DUY E;  1WHQ A;  5LMU E;  1A1I A;  3VHT B;  3KZY A;  2EOE A;  2EMW A;  2KHX A;  1P47 A;  2EMH A;  4HTG A;  3EQ1 A;  3M99 B;  2M9A A;  3C4B A;  5AE3 A;  2EM3 A;  2EMF A;  2EN6 A;  1SFE A;  3ZOQ B;  2E5L E;  3LML A;  3ADI A;  5KL2 A;  1HNW E;  3VYX A;  4DV5 E;  2L33 A;  4R2A A;  3DJW A;  2EM4 A;  1A1G A;  2YTO A;  4BBY A;  1KYQ A;  2B7T A;  2EMI A;  4JI5 E;  1TN9 A;  2NUG A;  2JY9 A;  2VF1 A;  2JXP A;  2JYA A;  2CTD A;  3BID A;  2EMX A;  1ZAA C;  4R03 A;  4JI1 E;  2L6M A;  3F6H A;  2E72 A;  2EMG A;  2M1S A;  2EWL A;  5LMN E;  2EMK A;  5A6K A;  4BHC A;  2YU5 A;  4X64 E;  1FKA E;  2HHH E;  2EOF A;  2UXD E;  2FGG A;  2YTQ A;  5T6J A;  5BR8 E;  3ECR A;  2EPX A;  1MEY C;  2L2N A;  1QU6 A;  3J81 C;  2YRH A;  2EL5 A;  1J26 A;  4GZN C;  1XNQ E;  4O43 A;  1HR0 E;  3TQM A;  4O5G A;  2EPC A;  1A1J A;  2LJH A;  1X6F A;  3BBG A;  1UN6 B;  2YTG A;  4ZYE A;  5DNY A;  4FK5 C;  1YYK A;  4DV7 E;  2L2M A;  2EMZ A;  4JI3 E;  4ZYG A;  4DV4 E;  4WX9 A;  1EH6 A;  1PDA A;  4YHH E;  1BBO A;  4B3M E;  2YZT A;  2ENC A;  2LVH A;  4DR6 E;  1EH8 A;  2NAB A;  3BGH A;  4P7D A;  2GLI A;  2YTF A;  4DMI A;  3VYY A;  4B3S E;  1G2D C;  2B7V A;  1Z1B A;  3LLH A;  1A1H A;  4RHB B;  4WSG A;  3ADL A;  2RTX A;  1B69 A;  4IJD A;  5AE2 A;  3KWR A;  2LTS A;  3J7Y p;  2EPN A;  1NCS A;  2EPO A;  4LF9 E;  2IHR 1;  5FLX C;  4LTY A;  2A25 A;  5LL6 R;  2YTI A;  3T1H E;  2B9D A;  4M30 A;  2I9I A;  2YRK A;  4IS1 C;  5IV8 B;  2EPU A;  3ADG A;  3JTZ A;  2F8B A;  3P1X A;  3J80 C;  2EM6 A;  4X8W A;  2KOU A;  3T1Y E;  3HPZ A;  1A1K A;  4R2S A;  3MSW A;  1ZU1 A;  4L5N C;  2LJU A;  3BF2 A;  3HXL A;  1IBL E;  2EOX A;  3K6Q A;  1YFH A;  1YPN A;  4BC7 A;  4LFA E;  5A6B A;  1AAY A;  2EJ4 A;  4JI8 E;  1ZBQ A;  2DSY A;  2EMA A;  2EOI A;  2LO3 A;  2JVA A;  3IWB A;  1GZ6 A;  1RC7 A;  2UXC E;  3C6M A;  5IXM B;  3HPS A;  2NA2 A;  1N32 E;  3EPL A;  5KL5 A;  4NXM E;  1AH5 A;  2EM8 A;  3AV0 A;  1X47 A;  5A2Q C;  4LFB E;  1T4N A;  1X3C A;  4WPY A;  1YZ9 A;  4LU9 A;  1YUI A;  5CFF E;  4P78 A;  4DR7 E;  2JWO A;  1EH7 A;  2EOS A;  4DR4 E;  1JK1 A;  2RS7 A;  4DR1 E;  3KZZ A;  4R2D A;  1ZR9 A;  2EQ0 A;  1GTK A;  2EMY A;  3UK3 C;  5IT9 C;  4F9A B;  1PKP A;  4X62 E;  1HNZ E;  1RMD A;  2VE7 C;  4DV0 E;  4TUI A;  2YTN A;  2D9H A;  1O0W A;  4KHP E;  4JI4 E;  2EN1 A;  2EN7 A;  2N3G A;  2WZO A;  2EL4 A;  4JI6 E;  4O24 A;  2EPR A;  2EN4 A;  1T4L B;  2EM2 A;  1N36 E;  2UUA E;  2EPL X;  2VQF E;  5AC4 A;  2E1M A;  3JU0 A;  1N34 E;  4N4R B;  2YU8 A;  4NHR A;  2VQE E;  4O4K A;  2EOR A;  2EOH A;  4KWY A;  2L92 A;  1BB8 A;  2EPM X;  1X5W A;  2CPN A;  5A6J A;  3IWD A;  2DMY A;  1IMU A;  1X48 A;  3EPJ A;  2EM5 A;  4BC9 A;  4KZS A;  1T4O A;  2L8T A;  2EPK X;  4OOG C;  1T38 A;  5ADZ A;  1STU A;  1A1L A;  2GHF A;  2DRP A;  1YYW A;  4F6M A;  5KL6 A;  3IWC A;  5KL3 A;  2LTR A;  2ELY A;  1PJS A;  1NEI A;  2EQ3 A;  1X6H A;  2EZ6 A;  4WSP A;  4TUG A;  2UXB E;  2ENH A;  5AE1 A;  2HGH A;  2YSO A;  1BBG A;  2ADR A;  2L3C A;  3QG5 C;  4BHB A;  4ZYH A;  2EMC A;  2YSP A;  3DF6 A;  1KJK A;  2WCC 3;  4DV6 E;  2M7Q A;  2MKN A;  1XMQ E;  1IQS A;  3MHS C;  4OX9 E;  2LMZ A;  2YTJ A; 
#chains in the Genus database with same CATH homology
 2EM9 A;  2VRD A;  4R2P A;  2CT1 A;  2ELZ A;  2EMX A;  1ZAA C;  5KL4 A;  4M9V C;  1AAY A;  2EJ4 A;  1YUJ A;  4F6N A;  2EN2 A;  3MHH C;  2LT7 A;  2YTE A;  2CSH A;  2E72 A;  2EMA A;  1F2I G;  2EMG A;  2EOI A;  2EOZ A;  2WBS A;  2EMK A;  2LO3 A;  1YSA C;  1JK2 A;  2JPA A;  1TF3 A;  2EOM A;  2YU5 A;  2EOF A;  3EPL A;  5KL5 A;  2DGC A;  2YTQ A;  2EM8 A;  2EPX A;  2DMI A;  1MEY C;  1X3C A;  1YUI A;  1UBD C;  2EOS A;  2I13 A;  2YRH A;  1JK1 A;  2EL5 A;  1DGC A;  4GZN C;  4R2D A;  1ZR9 A;  2EQ0 A;  3EPK A;  2EMY A;  2EPA A;  2LCE A;  3UK3 C;  4F2J C;  2EPC A;  1A1J A;  2MKD A;  1RMD A;  2RPC A;  2YTD A;  2WBU A;  1X6F A;  2EOO A;  1A1F A;  4X9J A;  1UN6 B;  2YTN A;  2D9H A;  2YTG A;  2EMB A;  2BB8 A;  2YRM A;  2EN1 A;  2EOY A;  2EN7 A;  4FK5 C;  2EMZ A;  2EL4 A;  2EPR A;  2EN4 A;  2R1F A;  2PRT A;  3EPH A;  1BBO A;  2EM2 A;  2ENC A;  2EPZ A;  2LVH A;  2LV2 A;  2DLQ A;  4R2R A;  2EOQ A;  2NAB A;  1G2F C;  2EL6 A;  2YU8 A;  2EE8 A;  2GLI A;  2YTF A;  2EM7 A;  2EOJ A;  2EOR A;  2EOH A;  1G2D C;  1BB8 A;  1X5W A;  1Z1B A;  1A1H A;  4WSG A;  2ENA A;  2WBT A;  2RSI A;  2YTP A;  1B69 A;  4R2C A;  2EM0 A;  3EPJ A;  4IJD A;  2EM5 A;  1X6E A;  2EML A;  4R2Q A;  1NCS A;  1WJP A;  2JP9 A;  1A1I A;  1TF6 A;  5KL7 A;  3VHT B;  2EOE A;  2EMW A;  1P47 A;  2EMH A;  2A25 A;  4R2E A;  2YTI A;  1A1L A;  2GHF A;  2DRP A;  2YRK A;  2EPP A;  2M9A A;  3M99 B;  4IS1 C;  4F6M A;  5KL6 A;  2MDG A;  2EM3 A;  2EMF A;  2EN6 A;  5KL3 A;  2EPU A;  2ELY A;  2EQ3 A;  5KL2 A;  1X6H A;  1LLM C;  4R2A A;  2EM6 A;  2ENH A;  2EM4 A;  2HGH A;  1A1G A;  2YSO A;  2ADR A;  2YTO A;  1A1K A;  4R2S A;  2EMC A;  2EN8 A;  2EP3 A;  2YSP A;  1KJK A;  2WCC 3;  2EMI A;  1ZU1 A;  2MKN A;  2EN3 A;  1TN9 A;  3MHS C;  2DLK A;  2YTJ A;  2EOX A;  2EQ1 A;  2CTD A;  2J7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...