4R2RA

Wilms tumor protein (wt1) zinc fingers in complex with carboxylated dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
88
Chain Sequence
SEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein/dna
molecule keywords Wilms tumor protein, isoform 4/CRA_a
publication title Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4r2rA00
4IJDA 2EM9A 1UBDC 2BB8A 2YTJA 1A1HA 1UN6B 2EMCA 1A1JA 2EOHA 1NCSA 2RPCA 2WBSA 3EPHA 2M9AA 2EMIA 3EPJA 2EM2A 5KL5A 1DGCA 2VRDA 3MHHC 5KL7A 1B69A 2EQ3A 2EOZA 4M9VC 2EOJA 4R2SA 2PRTA 1TN9A 4X9JA 3MHSC 2EL4A 4R2AA 2EPUA 2EPRA 2ENAA 2JP9A 2YTIA 2EPAA 2EM4A 2LO3A 1Z1BA 2GHFA 2EMHA 5KL4A 1P47A 4FK5C 4GZNC 1JK1A 2R1FA 2EN4A 2YSOA 2ENCA 2EOXA 2ENHA 2YTDA 2EOIA 1G2FC 2LV2A 2ADRA 2NABA 1F2IG 2LT7A 5KL3A 4R2DA 2YTOA 1X6FA 5KL2A 2EN3A 1LLMC 2EOQA 2EMBA 2DLQA 2EOOA 4R2RA 2EORA 2DLKA 2MDGA 1AAYA 2YRMA 2EJ4A 1YUJA 2MKDA 1X6EA 2EMWA 2YTEA 1G2DC 1A1GA 2ELYA 4IS1C 2MKNA 2EMFA 3UK3C 1TF6A 4F6MA 2GLIA 2YU5A 3VHTB 2EP3A 2EMKA 2YRKA 2CTDA 2EL6A 2J7JA 2EOYA 1A1LA 1X5WA 2YSPA 1MEYC 1YSAC 2EQ1A 4R2EA 4R2QA 1JK2A 2EOSA 2EN2A 1ZAAC 4R2PA 2YTQA 2HGHA 1RMDA 2EMYA 3EPLA 2EMLA 2YU8A 2WBUA 4F6NA 2YTGA 2YTNA 2YTPA 2EOEA 2EPPA 2EM0A 2EPCA 2EN1A 2ELZA 2D9HA 2EPXA 2EPZA 1WJPA 2EOFA 1BB8A 1X3CA 1X6HA 2EM6A 2EN7A 2EMAA 2EM5A 1TF3A 1ZU1A 1A1KA 2EM7A 2WBTA 2EE8A 2EQ0A 2DMIA 3EPKA 4WSGA 2A25A 2DRPA 2I13A 2EM8A 2EMZA 1ZR9A 2CSHA 2LVHA 1KJKA 2LCEA 2DGCA 2RSIA 2CT1A 1YUIA 2EMGA 5KL6A 2EL5A 2E72A 3M99B 1A1IA 4R2CA 2EM3A 4F2JC 1A1FA 1BBOA 2EOMA 2YRHA 2EN8A 2YTFA 2EMXA 2WCC3 2EN6A 2JPAA
chains in the Genus database with same CATH superfamily
3IWDA 2EM9A 1UBDC 5LMNE 1WHQA 2WZOA 2M7QA 1FJGE 4MLQA 2M9AA 1RQ0A 3EPJA 2EM2A 3BF2A 5KL5A 3MHHC 5KL7A 2E1MA 1GZ6A 1HNWE 2EOZA 2EOJA 4DMIA 1ZBQA 3MHSC 1T38A 2JP9A 2YTIA 2EM4A 1SFEA 1Z1BA 2FV4B 3MSWA 2GHFA 3THNA 2EMHA 1UHZA 4LTYA 4JI5E 4FK5C 4DR7E 4JYAE 4DV4E 2YSOA 3QG5C 2EPOA 5IT9C 2EN3A 1IQOA 2EMBA 2EOOA 2EORA 2MDGA 2MC5A 1PJQA 1EKZA 4BC9A 2EMWA 1N32E 1X48A 5IXMB 3UK3C 4MLVA 4F6MA 2V83A 2YU5A 5AC4A 3VHTB 5BR8E 3ADIA 2V89A 2EP3A 2CTDA 1IBKE 1X5WA 1MEYC 1YSAC 3C4TA 1JK2A 2LMZA 2LJHA 2EN2A 1HR0E 4R2PA 2UUCE 1SR9A 4ZYEA 4DUZE 4O43A 2WBUA 4LFAE 4F6NA 4NXME 2YTGA 2YTNA 2EPPA 1YFHA 2EPCA 2BBGA 2B3TB 3OMLA 4R03A 2EOFA 2EM6A 1J26A 5IV8B 4JI4E 2EMAA 2EM5A 3HXLA 4DR2E 1FKAE 4O4KA 2EE8A 2EQ0A 4ZYGA 2LE2A 5F3WA 3ZOQB 4WSGA 1IQSA 5IWAE 2EM8A 1YPNA 2CSHA 2LVHA 4K0KE 2LCEA 2DGCA 1WRJA 2CT1A 2M1SA 4NHRA 1KYQA 2RS6A 1DI2A 2B7VA 3C6MA 2JOBA 1A1IA 4DV3E 4R2CA 4AQYE 2EOMA 2EN8A 3FIGA 1T4NA 3C6KA 4GKKE 2EN6A 2VF1A 1X47A 2F4VE 2BB8A 2YTJA 2EZ6A 1UN6B 2EOHA 3F6GA 1NCSA 2V85A 4ZYHA 1STUA 4LF6E 2HJJA 1B69A 4KZSA 2FTXB 3JU0A 1QU6A 5ADZA 2UUBE 2B7TA 2PRTA 1I94E 4X9JA 4DV5E 2L2MA 4R8OA 2EPRA 4NZVA 4I8OA 3BGHA 1PJTA 2LO3A 4BHBA 4B3RE 2DMYA 4Q28A 1MGTA 2LTSA 1JK1A 1QNTA 3DJWA 2ENHA 2EOIA 2ADRA 2NABA 1F2IG 2L2KB 1LLMC 2L6MA 2DLKA 3ECRA 1AAYA 2JXPA 3LMLA 1G2DC 2EPMX 1YZ9A 3LLHA 2EMKA 2V86A 2RTXA 1A1LA 2YSPA 2VE7C 4R2EA 2UXBE 3BBGA 4R2QA 1IBLE 2HGHA 1RMDA 4BBYA 4O24A 3THOB 2YU8A 5T6JA 2JYAA 2YTPA 2EM0A 4BHCA 5A69A 3L00A 2EN1A 4LF8E 2ELZA 3C4BA 1RC7A 2EPZA 4HEIA 1BB8A 2NUFA 1TF3A 5A6JA 5FLXC 2LRSA 4DR1E 2RSMA 3EPKA 4L8NA 2LUQA 2VQFE 2A25A 5A6BA 2H36X 1YYWA 4DR4E 4L5NC 1KJKA 3RMPA 4WSPA 4B3SE 2RSIA 3KZYA 2RS7A 4WXDA 2LTRA 3T1YE 5KL6A 2EL5A 4JI7E 2ODRC 1N36E 1YYKA 1ZBTA 4M30A 4JI0E 3J7Yp 3ADJA 2GPIA 4GKJE 2L8TA 1GQEA 2EMCA 4DKKA 3IWBA 2WBSA 4Q35B 3HPSA 2NA2A 4WX9A 3TQMA 1WXRA 2EMIA 1O0WA 2V8QB 4JI8E 2VRDA 2EQ3A 2UU9E 3AV0A 4M9VC 2JOXA 4R2SA 1AH5A 2EL4A 4R2AA 4BMJA 5LMUE 2ODRD 4P78A 2EPUA 4JI3E 2JWOA 2LJUA 2Q8UA 4JI1E 2N3HA 2MC6A 5KL4A 1PKPA 1P47A 3VK6A 4GZNC 2R1FA 2EN4A 4N4RB 5AE1A 2ENCA 2EOXA 1G2FC 4R2DA 3OTOE 2HHHE 2EWLA 1XMOE 4R2RA 2V87A 1YUJA 2YRMA 2EJ4A 1X6EA 1EH6A 2YTEA 2L3CA 2I9IA 2MKNA 4F9CB 4DV2E 2GLIA 2UUAE 2YT4A 2FGGA 4X66E 4LFBE 1PJSA 2J7JA 2EOYA 4F9BB 4P7DA 1IBME 4WXCA 5DNYA 2YTQA 4WPYA 2UXDE 5A2QC 3EPLA 4B3TE 2EMLA 4OOGC 4M2ZA 3HTXA 2EOEA 1NEIA 2L3JA 3J80C 1BBGA 2F8BA 1T39A 2K7IA 4JI2E 4J8ZA 4YHHE 1DQ3A 2L33A 3ADLA 1ZU1A 2B9DA 1XMQE 4LF4E 5TSEA 5LL6R 2DMIA 2M4IA 1X49A 3F6HA 3J81C 4ZYDA 4KHPE 1YYOA 2DRPA 2G7HA 2EMZA 1ZR9A 1YUIA 2EMGA 2NUEA 4DV6E 3M99B 2EM3A 4F2JC 4X62E 1J5EE 1L4SA 2YTFA 2EMXA 4GEQB 4LF5E 2JPAA 2LBSB 4IJDA 2EPLX 1A1HA 1A1JA 2RPCA 1HNZE 3EPHA 2LUPB 1N34E 5CFFE 2DSYA 5A6AA 2KOUA 2EPNA 2JVAA 1DGCA 4DV7E 3VYYA 4B3ME 1N3GA 2KHXA 5AE3A 1TN9A 1T4OA 2UXCE 4DV1E 2ENAA 2EPAA 2YPNA 3HPZA 3VYXA 4F54A 4TUIA 3K6QA 1HNXE 2JR1A 4DR6E 4LF7E 2CPNA 3T1HE 1UILA 1EH8A 1GTKA 3ADGA 2YTDA 2LV2A 3KWRA 4X8WA 2LT7A 5KL3A 2YTOA 1X6FA 4M0VA 5KL2A 5A6KA 2EOQA 4DR3E 2DLQA 2IHR1 2DB2A 5A6BD 4YY3E 2MKDA 4WYQB 1IMUA 4F9AB 4X65E 1A1GA 2ELYA 1PDAA 3JAMC 4IS1C 4LFCE 2EMFA 5AE2A 1TF6A 1EH7A 4BCAA 4DUYE 2YRKA 2EL6A 4BC7A 2KONA 4O5GA 2VQEE 2EQ1A 4RHBB 2MDRA 1N33E 2RQLA 2EOSA 1ZAAC 2NUGA 2EMYA 4JV5E 4TUGA 4LU9A 2E5LE 4RH8A 2N8XA 4LF9E 4KWYA 2DIXA 3DF6A 2YWQA 2D9HA 4NXNE 3JTZA 2EPXA 5AASA 2JY9A 1WJPA 3EQ1A 1XNQE 1X3CA 1X6HA 4JI6E 2EN7A 3AUZA 4HTGA 1A1KA 2EM7A 4BS9A 4X64E 2WBTA 2L2NA 3P1XA 2N3GA 1XNRE 2ZM6E 3KZZA 1T4LB 2K4VA 3HQ1A 4WFTA 2I13A 2HC5A 5AC5A 4DV0E 3IWCA 2V88A 2E72A 4DR5E 4OX9E 3J7AG 2L92A 2R76A 1A1FA 3BIDA 2YRHA 1BBOA 2EPKX 2WCC3 3H09A 5LLQA 2YZTA 1WHNA
chains in the Genus database with same CATH topology
4IJDA 2EM9A 1UBDC 2BB8A 2YTJA 1A1HA 1UN6B 2EMCA 1A1JA 2EOHA 1NCSA 2RPCA 2WBSA 3EPHA 2M9AA 2EMIA 3EPJA 2EM2A 5KL5A 1DGCA 2VRDA 3MHHC 5KL7A 1B69A 2EQ3A 2EOZA 4M9VC 2EOJA 4R2SA 2PRTA 1TN9A 4X9JA 3MHSC 2EL4A 4R2AA 2EPUA 2EPRA 2ENAA 2JP9A 2YTIA 2EPAA 2EM4A 2LO3A 1Z1BA 2GHFA 2EMHA 5KL4A 1P47A 4FK5C 4GZNC 1JK1A 2R1FA 2EN4A 2YSOA 2ENCA 2EOXA 2ENHA 2YTDA 2EOIA 1G2FC 2LV2A 2ADRA 2NABA 1F2IG 2LT7A 5KL3A 4R2DA 2YTOA 1X6FA 5KL2A 2EN3A 1LLMC 2EOQA 2EMBA 2DLQA 2EOOA 4R2RA 2EORA 2DLKA 2MDGA 1AAYA 2YRMA 2EJ4A 1YUJA 2MKDA 1X6EA 2EMWA 2YTEA 1G2DC 1A1GA 2ELYA 4IS1C 2MKNA 2EMFA 3UK3C 1TF6A 4F6MA 2GLIA 2YU5A 3VHTB 2EP3A 2EMKA 2YRKA 2CTDA 2EL6A 2J7JA 2EOYA 1A1LA 1X5WA 2YSPA 1MEYC 1YSAC 2EQ1A 4R2EA 4R2QA 1JK2A 2EOSA 2EN2A 1ZAAC 4R2PA 2YTQA 2HGHA 1RMDA 2EMYA 3EPLA 2EMLA 2YU8A 2WBUA 4F6NA 2YTGA 2YTNA 2YTPA 2EOEA 2EPPA 2EM0A 2EPCA 2EN1A 2ELZA 2D9HA 2EPXA 2EPZA 1WJPA 2EOFA 1BB8A 1X3CA 1X6HA 2EM6A 2EN7A 2EMAA 2EM5A 1TF3A 1ZU1A 1A1KA 2EM7A 2WBTA 2EE8A 2EQ0A 2DMIA 3EPKA 4WSGA 2A25A 2DRPA 2I13A 2EM8A 2EMZA 1ZR9A 2CSHA 2LVHA 1KJKA 2LCEA 2DGCA 2RSIA 2CT1A 1YUIA 2EMGA 5KL6A 2EL5A 2E72A 3M99B 1A1IA 4R2CA 2EM3A 4F2JC 1A1FA 1BBOA 2EOMA 2YRHA 2EN8A 2YTFA 2EMXA 2WCC3 2EN6A 2JPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJD A;  2EM9 A;  1UBD C;  2BB8 A;  2YTJ A;  1A1H A;  1UN6 B;  2EMC A;  1A1J A;  2EOH A;  1NCS A;  2RPC A;  2WBS A;  3EPH A;  2M9A A;  2EMI A;  3EPJ A;  2EM2 A;  5KL5 A;  1DGC A;  2VRD A;  3MHH C;  5KL7 A;  1B69 A;  2EQ3 A;  2EOZ A;  4M9V C;  2EOJ A;  4R2S A;  2PRT A;  1TN9 A;  4X9J A;  3MHS C;  2EL4 A;  4R2A A;  2EPU A;  2EPR A;  2ENA A;  2JP9 A;  2YTI A;  2EPA A;  2EM4 A;  2LO3 A;  1Z1B A;  2GHF A;  2EMH A;  5KL4 A;  1P47 A;  4FK5 C;  4GZN C;  1JK1 A;  2R1F A;  2EN4 A;  2YSO A;  2ENC A;  2EOX A;  2ENH A;  2YTD A;  2EOI A;  1G2F C;  2LV2 A;  2ADR A;  2NAB A;  1F2I G;  2LT7 A;  5KL3 A;  4R2D A;  2YTO A;  1X6F A;  5KL2 A;  2EN3 A;  1LLM C;  2EOQ A;  2EMB A;  2DLQ A;  2EOO A;  4R2R A;  2EOR A;  2DLK A;  2MDG A;  1AAY A;  2YRM A;  2EJ4 A;  1YUJ A;  2MKD A;  1X6E A;  2EMW A;  2YTE A;  1G2D C;  1A1G A;  2ELY A;  4IS1 C;  2MKN A;  2EMF A;  3UK3 C;  1TF6 A;  4F6M A;  2GLI A;  2YU5 A;  3VHT B;  2EP3 A;  2EMK A;  2YRK A;  2CTD A;  2EL6 A;  2J7J A;  2EOY A;  1A1L A;  1X5W A;  2YSP A;  1MEY C;  1YSA C;  2EQ1 A;  4R2E A;  4R2Q A;  1JK2 A;  2EOS A;  2EN2 A;  1ZAA C;  4R2P A;  2YTQ A;  2HGH A;  1RMD A;  2EMY A;  3EPL A;  2EML A;  2YU8 A;  2WBU A;  4F6N A;  2YTG A;  2YTN A;  2YTP A;  2EOE A;  2EPP A;  2EM0 A;  2EPC A;  2EN1 A;  2ELZ A;  2D9H A;  2EPX A;  2EPZ A;  1WJP A;  2EOF A;  1BB8 A;  1X3C A;  1X6H A;  2EM6 A;  2EN7 A;  2EMA A;  2EM5 A;  1TF3 A;  1ZU1 A;  1A1K A;  2EM7 A;  2WBT A;  2EE8 A;  2EQ0 A;  2DMI A;  3EPK A;  4WSG A;  2A25 A;  2DRP A;  2I13 A;  2EM8 A;  2EMZ A;  1ZR9 A;  2CSH A;  2LVH A;  1KJK A;  2LCE A;  2DGC A;  2RSI A;  2CT1 A;  1YUI A;  2EMG A;  5KL6 A;  2EL5 A;  2E72 A;  3M99 B;  1A1I A;  4R2C A;  2EM3 A;  4F2J C;  1A1F A;  1BBO A;  2EOM A;  2YRH A;  2EN8 A;  2YTF A;  2EMX A;  2WCC 3;  2EN6 A;  2JPA A; 
#chains in the Genus database with same CATH topology
 3IWD A;  2EM9 A;  1UBD C;  5LMN E;  1WHQ A;  2WZO A;  2M7Q A;  1FJG E;  4MLQ A;  2M9A A;  1RQ0 A;  3EPJ A;  2EM2 A;  3BF2 A;  5KL5 A;  3MHH C;  5KL7 A;  2E1M A;  1GZ6 A;  1HNW E;  2EOZ A;  2EOJ A;  4DMI A;  1ZBQ A;  3MHS C;  1T38 A;  2JP9 A;  2YTI A;  2EM4 A;  1SFE A;  1Z1B A;  2FV4 B;  3MSW A;  2GHF A;  3THN A;  2EMH A;  1UHZ A;  4LTY A;  4JI5 E;  4FK5 C;  4DR7 E;  4JYA E;  4DV4 E;  2YSO A;  3QG5 C;  2EPO A;  5IT9 C;  2EN3 A;  1IQO A;  2EMB A;  2EOO A;  2EOR A;  2MDG A;  2MC5 A;  1PJQ A;  1EKZ A;  4BC9 A;  2EMW A;  1N32 E;  1X48 A;  5IXM B;  3UK3 C;  4MLV A;  4F6M A;  2V83 A;  2YU5 A;  5AC4 A;  3VHT B;  5BR8 E;  3ADI A;  2V89 A;  2EP3 A;  2CTD A;  1IBK E;  1X5W A;  1MEY C;  1YSA C;  3C4T A;  1JK2 A;  2LMZ A;  2LJH A;  2EN2 A;  1HR0 E;  4R2P A;  2UUC E;  1SR9 A;  4ZYE A;  4DUZ E;  4O43 A;  2WBU A;  4LFA E;  4F6N A;  4NXM E;  2YTG A;  2YTN A;  2EPP A;  1YFH A;  2EPC A;  2BBG A;  2B3T B;  3OML A;  4R03 A;  2EOF A;  2EM6 A;  1J26 A;  5IV8 B;  4JI4 E;  2EMA A;  2EM5 A;  3HXL A;  4DR2 E;  1FKA E;  4O4K A;  2EE8 A;  2EQ0 A;  4ZYG A;  2LE2 A;  5F3W A;  3ZOQ B;  4WSG A;  1IQS A;  5IWA E;  2EM8 A;  1YPN A;  2CSH A;  2LVH A;  4K0K E;  2LCE A;  2DGC A;  1WRJ A;  2CT1 A;  2M1S A;  4NHR A;  1KYQ A;  2RS6 A;  1DI2 A;  2B7V A;  3C6M A;  2JOB A;  1A1I A;  4DV3 E;  4R2C A;  4AQY E;  2EOM A;  2EN8 A;  3FIG A;  1T4N A;  3C6K A;  4GKK E;  2EN6 A;  2VF1 A;  1X47 A;  2F4V E;  2BB8 A;  2YTJ A;  2EZ6 A;  1UN6 B;  2EOH A;  3F6G A;  1NCS A;  2V85 A;  4ZYH A;  1STU A;  4LF6 E;  2HJJ A;  1B69 A;  4KZS A;  2FTX B;  3JU0 A;  1QU6 A;  5ADZ A;  2UUB E;  2B7T A;  2PRT A;  1I94 E;  4X9J A;  4DV5 E;  2L2M A;  4R8O A;  2EPR A;  4NZV A;  4I8O A;  3BGH A;  1PJT A;  2LO3 A;  4BHB A;  4B3R E;  2DMY A;  4Q28 A;  1MGT A;  2LTS A;  1JK1 A;  1QNT A;  3DJW A;  2ENH A;  2EOI A;  2ADR A;  2NAB A;  1F2I G;  2L2K B;  1LLM C;  2L6M A;  2DLK A;  3ECR A;  1AAY A;  2JXP A;  3LML A;  1G2D C;  2EPM X;  1YZ9 A;  3LLH A;  2EMK A;  2V86 A;  2RTX A;  1A1L A;  2YSP A;  2VE7 C;  4R2E A;  2UXB E;  3BBG A;  4R2Q A;  1IBL E;  2HGH A;  1RMD A;  4BBY A;  4O24 A;  3THO B;  2YU8 A;  5T6J A;  2JYA A;  2YTP A;  2EM0 A;  4BHC A;  5A69 A;  3L00 A;  2EN1 A;  4LF8 E;  2ELZ A;  3C4B A;  1RC7 A;  2EPZ A;  4HEI A;  1BB8 A;  2NUF A;  1TF3 A;  5A6J A;  5FLX C;  2LRS A;  4DR1 E;  2RSM A;  3EPK A;  4L8N A;  2LUQ A;  2VQF E;  2A25 A;  5A6B A;  2H36 X;  1YYW A;  4DR4 E;  4L5N C;  1KJK A;  3RMP A;  4WSP A;  4B3S E;  2RSI A;  3KZY A;  2RS7 A;  4WXD A;  2LTR A;  3T1Y E;  5KL6 A;  2EL5 A;  4JI7 E;  2ODR C;  1N36 E;  1YYK A;  1ZBT A;  4M30 A;  4JI0 E;  3J7Y p;  3ADJ A;  2GPI A;  4GKJ E;  2L8T A;  1GQE A;  2EMC A;  4DKK A;  3IWB A;  2WBS A;  4Q35 B;  3HPS A;  2NA2 A;  4WX9 A;  3TQM A;  1WXR A;  2EMI A;  1O0W A;  2V8Q B;  4JI8 E;  2VRD A;  2EQ3 A;  2UU9 E;  3AV0 A;  4M9V C;  2JOX A;  4R2S A;  1AH5 A;  2EL4 A;  4R2A A;  4BMJ A;  5LMU E;  2ODR D;  4P78 A;  2EPU A;  4JI3 E;  2JWO A;  2LJU A;  2Q8U A;  4JI1 E;  2N3H A;  2MC6 A;  5KL4 A;  1PKP A;  1P47 A;  3VK6 A;  4GZN C;  2R1F A;  2EN4 A;  4N4R B;  5AE1 A;  2ENC A;  2EOX A;  1G2F C;  4R2D A;  3OTO E;  2HHH E;  2EWL A;  1XMO E;  4R2R A;  2V87 A;  1YUJ A;  2YRM A;  2EJ4 A;  1X6E A;  1EH6 A;  2YTE A;  2L3C A;  2I9I A;  2MKN A;  4F9C B;  4DV2 E;  2GLI A;  2UUA E;  2YT4 A;  2FGG A;  4X66 E;  4LFB E;  1PJS A;  2J7J A;  2EOY A;  4F9B B;  4P7D A;  1IBM E;  4WXC A;  5DNY A;  2YTQ A;  4WPY A;  2UXD E;  5A2Q C;  3EPL A;  4B3T E;  2EML A;  4OOG C;  4M2Z A;  3HTX A;  2EOE A;  1NEI A;  2L3J A;  3J80 C;  1BBG A;  2F8B A;  1T39 A;  2K7I A;  4JI2 E;  4J8Z A;  4YHH E;  1DQ3 A;  2L33 A;  3ADL A;  1ZU1 A;  2B9D A;  1XMQ E;  4LF4 E;  5TSE A;  5LL6 R;  2DMI A;  2M4I A;  1X49 A;  3F6H A;  3J81 C;  4ZYD A;  4KHP E;  1YYO A;  2DRP A;  2G7H A;  2EMZ A;  1ZR9 A;  1YUI A;  2EMG A;  2NUE A;  4DV6 E;  3M99 B;  2EM3 A;  4F2J C;  4X62 E;  1J5E E;  1L4S A;  2YTF A;  2EMX A;  4GEQ B;  4LF5 E;  2JPA A;  2LBS B;  4IJD A;  2EPL X;  1A1H A;  1A1J A;  2RPC A;  1HNZ E;  3EPH A;  2LUP B;  1N34 E;  5CFF E;  2DSY A;  5A6A A;  2KOU A;  2EPN A;  2JVA A;  1DGC A;  4DV7 E;  3VYY A;  4B3M E;  1N3G A;  2KHX A;  5AE3 A;  1TN9 A;  1T4O A;  2UXC E;  4DV1 E;  2ENA A;  2EPA A;  2YPN A;  3HPZ A;  3VYX A;  4F54 A;  4TUI A;  3K6Q A;  1HNX E;  2JR1 A;  4DR6 E;  4LF7 E;  2CPN A;  3T1H E;  1UIL A;  1EH8 A;  1GTK A;  3ADG A;  2YTD A;  2LV2 A;  3KWR A;  4X8W A;  2LT7 A;  5KL3 A;  2YTO A;  1X6F A;  4M0V A;  5KL2 A;  5A6K A;  2EOQ A;  4DR3 E;  2DLQ A;  2IHR 1;  2DB2 A;  5A6B D;  4YY3 E;  2MKD A;  4WYQ B;  1IMU A;  4F9A B;  4X65 E;  1A1G A;  2ELY A;  1PDA A;  3JAM C;  4IS1 C;  4LFC E;  2EMF A;  5AE2 A;  1TF6 A;  1EH7 A;  4BCA A;  4DUY E;  2YRK A;  2EL6 A;  4BC7 A;  2KON A;  4O5G A;  2VQE E;  2EQ1 A;  4RHB B;  2MDR A;  1N33 E;  2RQL A;  2EOS A;  1ZAA C;  2NUG A;  2EMY A;  4JV5 E;  4TUG A;  4LU9 A;  2E5L E;  4RH8 A;  2N8X A;  4LF9 E;  4KWY A;  2DIX A;  3DF6 A;  2YWQ A;  2D9H A;  4NXN E;  3JTZ A;  2EPX A;  5AAS A;  2JY9 A;  1WJP A;  3EQ1 A;  1XNQ E;  1X3C A;  1X6H A;  4JI6 E;  2EN7 A;  3AUZ A;  4HTG A;  1A1K A;  2EM7 A;  4BS9 A;  4X64 E;  2WBT A;  2L2N A;  3P1X A;  2N3G A;  1XNR E;  2ZM6 E;  3KZZ A;  1T4L B;  2K4V A;  3HQ1 A;  4WFT A;  2I13 A;  2HC5 A;  5AC5 A;  4DV0 E;  3IWC A;  2V88 A;  2E72 A;  4DR5 E;  4OX9 E;  3J7A G;  2L92 A;  2R76 A;  1A1F A;  3BID A;  2YRH A;  1BBO A;  2EPK X;  2WCC 3;  3H09 A;  5LLQ A;  2YZT A;  1WHN A; 
#chains in the Genus database with same CATH homology
 4IJD A;  2EM9 A;  1UBD C;  2BB8 A;  2YTJ A;  1A1H A;  1UN6 B;  2EMC A;  1A1J A;  2EOH A;  1NCS A;  2RPC A;  2WBS A;  3EPH A;  2M9A A;  2EMI A;  3EPJ A;  2EM2 A;  5KL5 A;  1DGC A;  2VRD A;  3MHH C;  5KL7 A;  1B69 A;  2EQ3 A;  2EOZ A;  4M9V C;  2EOJ A;  4R2S A;  2PRT A;  1TN9 A;  4X9J A;  3MHS C;  2EL4 A;  4R2A A;  2EPU A;  2EPR A;  2ENA A;  2JP9 A;  2YTI A;  2EPA A;  2EM4 A;  2LO3 A;  1Z1B A;  2GHF A;  2EMH A;  5KL4 A;  1P47 A;  4FK5 C;  4GZN C;  1JK1 A;  2R1F A;  2EN4 A;  2YSO A;  2ENC A;  2EOX A;  2ENH A;  2YTD A;  2EOI A;  1G2F C;  2LV2 A;  2ADR A;  2NAB A;  1F2I G;  2LT7 A;  5KL3 A;  4R2D A;  2YTO A;  1X6F A;  5KL2 A;  2EN3 A;  1LLM C;  2EOQ A;  2EMB A;  2DLQ A;  2EOO A;  4R2R A;  2EOR A;  2DLK A;  2MDG A;  1AAY A;  2YRM A;  2EJ4 A;  1YUJ A;  2MKD A;  1X6E A;  2EMW A;  2YTE A;  1G2D C;  1A1G A;  2ELY A;  4IS1 C;  2MKN A;  2EMF A;  3UK3 C;  1TF6 A;  4F6M A;  2GLI A;  2YU5 A;  3VHT B;  2EP3 A;  2EMK A;  2YRK A;  2CTD A;  2EL6 A;  2J7J A;  2EOY A;  1A1L A;  1X5W A;  2YSP A;  1MEY C;  1YSA C;  2EQ1 A;  4R2E A;  4R2Q A;  1JK2 A;  2EOS A;  2EN2 A;  1ZAA C;  4R2P A;  2YTQ A;  2HGH A;  1RMD A;  2EMY A;  3EPL A;  2EML A;  2YU8 A;  2WBU A;  4F6N A;  2YTG A;  2YTN A;  2YTP A;  2EOE A;  2EPP A;  2EM0 A;  2EPC A;  2EN1 A;  2ELZ A;  2D9H A;  2EPX A;  2EPZ A;  1WJP A;  2EOF A;  1BB8 A;  1X3C A;  1X6H A;  2EM6 A;  2EN7 A;  2EMA A;  2EM5 A;  1TF3 A;  1ZU1 A;  1A1K A;  2EM7 A;  2WBT A;  2EE8 A;  2EQ0 A;  2DMI A;  3EPK A;  4WSG A;  2A25 A;  2DRP A;  2I13 A;  2EM8 A;  2EMZ A;  1ZR9 A;  2CSH A;  2LVH A;  1KJK A;  2LCE A;  2DGC A;  2RSI A;  2CT1 A;  1YUI A;  2EMG A;  5KL6 A;  2EL5 A;  2E72 A;  3M99 B;  1A1I A;  4R2C A;  2EM3 A;  4F2J C;  1A1F A;  1BBO A;  2EOM A;  2YRH A;  2EN8 A;  2YTF A;  2EMX A;  2WCC 3;  2EN6 A;  2JPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...