1T4NA

Solution structure of rnt1p dsrbd
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
88
structure length
88
Chain Sequence
MDKLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ribonuclease III
publication title A new alpha-helical extension promotes RNA binding by the dsRBD of Rnt1p RNAse III
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 17
structure length 88
sequence length 88
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2004-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1t4nA00
1N34E 2HHHE 4DV5E 4JYAE 4YHHE 1HNZE 2JVAA 2L3JA 2L3CA 4LF4E 1UHZA 4LF9E 2L2KB 2JY9A 1HNXE 4JI0E 1GQEA 1X48A 4GKJE 2B7VA 1DI2A 1N32E 3LLHA 2LUQA 4LF7E 4K0KE 2RTXA 4DUZE 2CPNA 2UXBE 5IWAE 2RSMA 2LTSA 1N33E 4DV7E 4B3RE 4LFBE 2NUGA 4DV6E 1WHQA 4LFCE 4DR6E 3T1YE 4B3ME 5LMNE 1YYKA 1T4LB 3J7Yp 4DR3E 2VQFE 1IBME 3P1XA 4B3TE 2ZM6E 4JI8E 2UUCE 2NA2A 4M30A 4OOGC 1X47A 1XMOE 3VYYA 4AQYE 2B7TA 2KHXA 1IBKE 2LJHA 1FJGE 1IBLE 2MDRA 4LF6E 3ADIA 5LMUE 1UILA 4NXNE 4LFAE 5BR8E 1I94E 1PKPA 4DV3E 2UUBE 2L2MA 4WYQB 4DR5E 4X65E 4JI5E 1J26A 4OX9E 4X66E 2LBSB 4JI2E 3ADLA 2DMYA 2EZ6A 2N3HA 2B3TB 1RQ0A 4LF8E 1YYWA 1YYOA 4B3SE 2UXDE 4DR2E 4DR1E 1HNWE 2F4VE 1ZBTA 2DB2A 2N3GA 4DR4E 3VYXA 4WFTA 2L33A 1XNQE 4LF5E 1X49A 1RC7A 4JI3E 1WHNA 1HR0E 2IHR1 4GKKE 4KHPE 4X64E 4YY3E 4X8WA 1STUA 2VQEE 3HTXA 4DV4E 1FKAE 2L2NA 1XMQE 4DUYE 1J5EE 4JI7E 1T4OA 2E5LE 4NXME 1YZ9A 4JI1E 4DR7E 1N36E 2UU9E 4DV1E 3OTOE 2RS6A 3ADGA 3C4BA 3T1HE 3C4TA 2NUFA 4JV5E 2LRSA 4DV2E 5CFFE 2NUEA 2DIXA 4X62E 2YT4A 3ADJA 4DV0E 2UXCE 2RS7A 4JI6E 1T4NA 2UUAE 1QU6A 4DKKA 4JI4E 1XNRE 1O0WA 1EKZA 4M2ZA 2LUPB 2LTRA
chains in the Genus database with same CATH superfamily
1N34E 2EORA 4JYAE 4YHHE 2V89A 2H36X 4LF4E 1UHZA 1UBDC 4LF9E 4R2PA 2EP3A 2EOMA 1YSAC 1LLMC 1IQSA 4BC7A 2B9DA 3LLHA 3RMPA 1PJTA 2RTXA 1MGTA 2EL6A 1N33E 4R2CA 4WPYA 4DV6E 4LFCE 4F9AB 3H09A 2EMGA 1NEIA 2EOSA 2ZM6E 1X6EA 4JI8E 4M30A 4BBYA 4OOGC 2V83A 4AQYE 2MDGA 4ZYHA 2YTGA 1IBKE 3AV0A 2EPKX 2EPNA 4LF6E 1X6HA 2YZTA 4DMIA 3J7AG 1ZR9A 5KL5A 2YTDA 2K7IA 2YU5A 4DR5E 3VHTB 4X65E 2EQ1A 1JK1A 2EOXA 1YYOA 2EM7A 4B3SE 4DR2E 4DR1E 2UXDE 2L6MA 2JOXA 2J7JA 1ZBTA 1YUJA 4WFTA 2PRTA 2LV2A 2YTJA 4FK5C 4GZNC 2EOEA 2ELZA 2RSIA 4X8WA 3ECRA 3EPJA 2E72A 2R76A 2DLQA 1YZ9A 2E5LE 1EH6A 1RMDA 2EPOA 2V85A 3BF2A 4DV1E 2NABA 1X5WA 2RS6A 4F6NA 5KL7A 2JPAA 2EN6A 2JYAA 3T1HE 2EMLA 4LU9A 1QNTA 2WBUA 1IMUA 4DV2E 2G7HA 1P47A 5A6BD 2WCC3 1ZBQA 1G2FC 4DV0E 1N3GA 1T4NA 1QU6A 2R1FA 2YRMA 1F2IG 2EOHA 1GZ6A 2LVHA 3OMLA 2EQ3A 5KL3A 1KYQA 3EQ1A 3TQMA 4BCAA 1HNXE 2MC5A 1GQEA 1X48A 1NCSA 4R03A 4F54A 2ELYA 1YPNA 1X6FA 4F9CB 4WX9A 1N32E 2L92A 2CT1A 4K0KE 4DUZE 2UXBE 5IWAE 2Q8UA 2LTSA 4LTYA 4KZSA 2D9HA 4DV7E 1JK2A 2NUGA 3DJWA 4LFBE 2EJ4A 2VRDA 2EOOA 3T1YE 5A6BA 4B3ME 2EOYA 1DGCA 4N4RB 2JP9A 1X47A 2EOQA 3VYYA 5IXMB 3BGHA 5A6KA 1A1IA 2LT7A 1A1FA 3AUZA 2EOFA 2MKNA 4R2DA 1UILA 4M0VA 4NXNE 2KONA 3HPZA 4O43A 1I94E 2JOBA 1PKPA 2YRKA 5AE3A 4O24A 4JI5E 1J26A 4OX9E 4X66E 2LBSB 2EMZA 2V86A 2K4VA 2F8BA 2DMYA 2YTFA 2EZ6A 2RQLA 4BHCA 2EMWA 1RQ0A 4LF8E 2F4VE 4O5GA 5LLQA 2WBSA 4IS1C 4WXDA 2EMKA 4TUGA 1A1LA 3L00A 1AH5A 1X49A 4LF5E 2ODRC 3J80C 4JI3E 1WHNA 2EM6A 4GKKE 4KHPE 4TUIA 4X64E 2CSHA 4YY3E 1STUA 1A1GA 1A1JA 2EOZA 2L2NA 1XMQE 3C6KA 4DUYE 1J5EE 1AAYA 2EPXA 1FKAE 4DR7E 4ZYGA 2DSYA 2UU9E 3F6HA 2WZOA 1BBGA 2JWOA 2VF1A 2FGGA 4O4KA 1DQ3A 2NUFA 3IWCA 4R2EA 4JV5E 2GHFA 2YSOA 4WSPA 2ADRA 2LRSA 3MSWA 2DMIA 2EE8A 1G2DC 5CFFE 1TF6A 2NUEA 2GLIA 1SFEA 4ZYEA 3ADJA 1ZAAC 4IJDA 2EM3A 2UUAE 4JI4E 2CTDA 5FLXC 2ODRD 2HJJA 2YTEA 3KWRA 4M2ZA 2LUPB 4M9VC 4BS9A 2EPCA 3KZYA 1GTKA 2HHHE 2WBTA 5A69A 4DV5E 2EPLX 2L3JA 2L3CA 1PDAA 2V87A 3LMLA 2L8TA 2FV4B 4JI0E 2EM8A 2YTPA 4WXCA 2VE7C 3JTZA 3EPKA 4GKJE 2YTOA 4L8NA 2YPNA 2B7VA 2JXPA 2EPUA 5ADZA 5IV8B 1EH7A 1PJQA 2LUQA 3FIGA 4LF7E 3HQ1A 5AC5A 2EMIA 2JR1A 1WHQA 2M7QA 1BBOA 2EM2A 4DR6E 4ZYDA 4L5NC 1T4LB 3J7Yp 4DR3E 4Q35B 1IBME 2EL5A 4R2SA 3THOB 2UUCE 2DGCA 1XMOE 3DF6A 2EL4A 2B7TA 4NHRA 5T6JA 2EM4A 4HEIA 4R2QA 3THNA 1IBLE 2V8QB 1YUIA 2YTQA 2MDRA 3ADIA 4Q28A 3BIDA 3C6MA 3IWBA 3QG5C 4LFAE 1PJSA 1ZU1A 2EMYA 2EMXA 5BR8E 4X9JA 2EN3A 2UUBE 2L2MA 5LL6R 4WYQB 2V88A 2I13A 4JI2E 2N3HA 2B3TB 1HNWE 2ENAA 2N3GA 2L33A 1XNQE 2LMZA 4P78A 2MC6A 1RC7A 1HR0E 5AE2A 3HPSA 4MLVA 3J81C 1KJKA 3IWDA 5A6JA 3HTXA 2EPMX 4I8OA 3M99B 4JI1E 1T39A 1N36E 4J8ZA 4R2AA 4RHBB 3JAMC 5A2QC 2EMBA 3OTOE 4F2JC 3UK3C 1T38A 1WRJA 2EN4A 2DIXA 2EMHA 2EPZA 1IQOA 2BBGA 2MKDA 3KZZA 2UXCE 2RS7A 4P7DA 1O0WA 2M4IA 3EPHA 2GPIA 2LTRA 2EOIA 1HNZE 2JVAA 4HTGA 2LO3A 2KOUA 2EN7A 2L2KB 2JY9A 2M9AA 2EN8A 2LCEA 1DI2A 2FTXB 2BB8A 4R2RA 1L4SA 3MHHC 2CPNA 2I9IA 2RSMA 4B3RE 5A6AA 2YSPA 4F6MA 5TSEA 5LMNE 1YYKA 2YTNA 2VQFE 4BHBA 3P1XA 4B3TE 5KL4A 1WXRA 2NA2A 1EH8A 1X3CA 2EQ0A 3VK6A 2YRHA 2EMAA 2KHXA 2LJHA 2EM5A 2A25A 1FJGE 2RPCA 4R8OA 2DLKA 5F3WA 5LMUE 3HXLA 4BMJA 5AC4A 5IT9C 2LJUA 3F6GA 4NZVA 4DV3E 2EPAA 2EMCA 2EN1A 5AE1A 3MHSC 4WSGA 2E1MA 1YFHA 2HGHA 4MLQA 3ADLA 2YU8A 1YYWA 4F9BB 4KWYA 2ENCA 5KL2A 2DB2A 4DR4E 1WJPA 3VYXA 5KL6A 1Z1BA 5AASA 2EWLA 4GEQB 2IHR1 2YTIA 1UN6B 4RH8A 1A1KA 1BB8A 2EN2A 3ZOQB 2EOJA 1TN9A 2ENHA 2EM0A 2LE2A 2VQEE 2DRPA 4DV4E 4NXME 3K6QA 1T4OA 4JI7E 2EPPA 2EPRA 4BC9A 1MEYC 5DNYA 3ADGA 3JU0A 3C4BA 1A1HA 2M1SA 2N8XA 3C4TA 2HC5A 2EM9A 2EMFA 3BBGA 2YT4A 4X62E 4JI6E 2YWQA 4DKKA 1XNRE 3EPLA 1EKZA 1B69A 1TF3A 1SR9A
chains in the Genus database with same CATH topology
1N34E 2HHHE 4DV5E 4JYAE 4YHHE 2V89A 3OMLA 1HNZE 2JVAA 2L3JA 2L3CA 2V87A 2H36X 2KOUA 3LMLA 2L8TA 4LF4E 1UHZA 2FV4B 4BCAA 4LF9E 2L2KB 2JY9A 1HNXE 4JI0E 2MC5A 1GQEA 1X48A 2VE7C 3JTZA 4R03A 4F54A 4GKJE 4L8NA 4BC7A 2B7VA 2B9DA 1DI2A 5ADZA 2FTXB 4F9CB 1N32E 3LLHA 2LUQA 2L92A 3FIGA 3RMPA 4LF7E 3HQ1A 4B3RE 2RTXA 4K0KE 4DUZE 2CPNA 2UXBE 5IWAE 2RSMA 2LTSA 1N33E 2JR1A 4KZSA 4LTYA 4DV7E 2NUGA 4WPYA 1WHQA 3DJWA 4DV6E 4F9AB 2M7QA 4LFCE 4DR6E 3H09A 3T1YE 4B3ME 4L5NC 5LMNE 1T4LB 3J7Yp 4DR3E 2VQFE 1IBME 1YYKA 3P1XA 4B3TE 2ZM6E 1WXRA 4JI8E 2UUCE 2NA2A 4M30A 4BBYA 4OOGC 1X47A 1XMOE 3DF6A 2V83A 3VK6A 3VYYA 4AQYE 2B7TA 5T6JA 2KHXA 1IBKE 2LJHA 3AV0A 1FJGE 1IBLE 2V8QB 2MDRA 4R8OA 4LF6E 3AUZA 3ADIA 4Q28A 5F3WA 2YZTA 5LMUE 4DMIA 3HXLA 1UILA 4M0VA 3IWBA 4BMJA 4LFAE 2KONA 4NXNE 3J7AG 3HPZA 5IT9C 3F6GA 5BR8E 1I94E 2JOBA 1PKPA 5AE3A 4DV3E 2UUBE 2L2MA 5LL6R 4WYQB 4DR5E 4X65E 4JI5E 1J26A 2V88A 4X66E 4OX9E 5AE1A 2LBSB 2V86A 2K4VA 2F8BA 4JI2E 2DMYA 2E1MA 3ADLA 2EZ6A 2N3HA 2B3TB 1RQ0A 4LF8E 1YYWA 1YYOA 4B3SE 2UXDE 4DR2E 4DR1E 4F9BB 1HNWE 2L6MA 2JOXA 2F4VE 1ZBTA 2DB2A 2N3GA 4DR4E 3VYXA 1YZ9A 4WFTA 2L33A 4TUGA 1XNQE 4LF5E 1X49A 2ODRC 2LMZA 4P78A 2MC6A 3J80C 1WHNA 5AASA 2EWLA 1RC7A 1HR0E 4JI3E 4GEQB 2IHR1 5AE2A 4GKKE 3HPSA 4KHPE 4TUIA 4X64E 3J81C 3ZOQB 3IWDA 4X8WA 4YY3E 1STUA 2LE2A 2VQEE 3HTXA 4DV4E 1FKAE 2L2NA 1XMQE 4I8OA 4DUYE 3K6QA 1T4OA 4JI7E 1J5EE 2E5LE 4JI1E 4NXME 4DR7E 1N36E 4J8ZA 2DSYA 2V85A 3JAMC 4BC9A 2UU9E 3F6HA 4DV1E 5A2QC 2WZOA 2RS6A 3OTOE 5DNYA 2JWOA 3ADGA 2VF1A 2FGGA 3JU0A 3C4BA 3T1HE 1DQ3A 4LU9A 2M1SA 3C4TA 2NUFA 3IWCA 4JV5E 4WSPA 2LRSA 3MSWA 4DV2E 5CFFE 2NUEA 4LFBE 2G7HA 2DIXA 4X62E 2YT4A 1ZBQA 3ADJA 4DV0E 2UXCE 2RS7A 4P7DA 1T4NA 4JI6E 2UUAE 1QU6A 4DKKA 4JI4E 1XNRE 5FLXC 1O0WA 2M4IA 2ODRD 3KWRA 1EKZA 4M2ZA 2LUPB 2LTRA 1GZ6A 4BS9A 1SR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N34 E;  2HHH E;  4DV5 E;  4JYA E;  4YHH E;  1HNZ E;  2JVA A;  2L3J A;  2L3C A;  4LF4 E;  1UHZ A;  4LF9 E;  2L2K B;  2JY9 A;  1HNX E;  4JI0 E;  1GQE A;  1X48 A;  4GKJ E;  2B7V A;  1DI2 A;  1N32 E;  3LLH A;  2LUQ A;  4LF7 E;  4K0K E;  2RTX A;  4DUZ E;  2CPN A;  2UXB E;  5IWA E;  2RSM A;  2LTS A;  1N33 E;  4DV7 E;  4B3R E;  4LFB E;  2NUG A;  4DV6 E;  1WHQ A;  4LFC E;  4DR6 E;  3T1Y E;  4B3M E;  5LMN E;  1YYK A;  1T4L B;  3J7Y p;  4DR3 E;  2VQF E;  1IBM E;  3P1X A;  4B3T E;  2ZM6 E;  4JI8 E;  2UUC E;  2NA2 A;  4M30 A;  4OOG C;  1X47 A;  1XMO E;  3VYY A;  4AQY E;  2B7T A;  2KHX A;  1IBK E;  2LJH A;  1FJG E;  1IBL E;  2MDR A;  4LF6 E;  3ADI A;  5LMU E;  1UIL A;  4NXN E;  4LFA E;  5BR8 E;  1I94 E;  1PKP A;  4DV3 E;  2UUB E;  2L2M A;  4WYQ B;  4DR5 E;  4X65 E;  4JI5 E;  1J26 A;  4OX9 E;  4X66 E;  2LBS B;  4JI2 E;  3ADL A;  2DMY A;  2EZ6 A;  2N3H A;  2B3T B;  1RQ0 A;  4LF8 E;  1YYW A;  1YYO A;  4B3S E;  2UXD E;  4DR2 E;  4DR1 E;  1HNW E;  2F4V E;  1ZBT A;  2DB2 A;  2N3G A;  4DR4 E;  3VYX A;  4WFT A;  2L33 A;  1XNQ E;  4LF5 E;  1X49 A;  1RC7 A;  4JI3 E;  1WHN A;  1HR0 E;  2IHR 1;  4GKK E;  4KHP E;  4X64 E;  4YY3 E;  4X8W A;  1STU A;  2VQE E;  3HTX A;  4DV4 E;  1FKA E;  2L2N A;  1XMQ E;  4DUY E;  1J5E E;  4JI7 E;  1T4O A;  2E5L E;  4NXM E;  1YZ9 A;  4JI1 E;  4DR7 E;  1N36 E;  2UU9 E;  4DV1 E;  3OTO E;  2RS6 A;  3ADG A;  3C4B A;  3T1H E;  3C4T A;  2NUF A;  4JV5 E;  2LRS A;  4DV2 E;  5CFF E;  2NUE A;  2DIX A;  4X62 E;  2YT4 A;  3ADJ A;  4DV0 E;  2UXC E;  2RS7 A;  4JI6 E;  1T4N A;  2UUA E;  1QU6 A;  4DKK A;  4JI4 E;  1XNR E;  1O0W A;  1EKZ A;  4M2Z A;  2LUP B;  2LTR A; 
#chains in the Genus database with same CATH topology
 1N34 E;  2EOR A;  4JYA E;  4YHH E;  2V89 A;  2H36 X;  4LF4 E;  1UHZ A;  1UBD C;  4LF9 E;  4R2P A;  2EP3 A;  2EOM A;  1YSA C;  1LLM C;  1IQS A;  4BC7 A;  2B9D A;  3LLH A;  3RMP A;  1PJT A;  2RTX A;  1MGT A;  2EL6 A;  1N33 E;  4R2C A;  4WPY A;  4DV6 E;  4LFC E;  4F9A B;  3H09 A;  2EMG A;  1NEI A;  2EOS A;  2ZM6 E;  1X6E A;  4JI8 E;  4M30 A;  4BBY A;  4OOG C;  2V83 A;  4AQY E;  2MDG A;  4ZYH A;  2YTG A;  1IBK E;  3AV0 A;  2EPK X;  2EPN A;  4LF6 E;  1X6H A;  2YZT A;  4DMI A;  3J7A G;  1ZR9 A;  5KL5 A;  2YTD A;  2K7I A;  2YU5 A;  4DR5 E;  3VHT B;  4X65 E;  2EQ1 A;  1JK1 A;  2EOX A;  1YYO A;  2EM7 A;  4B3S E;  4DR2 E;  4DR1 E;  2UXD E;  2L6M A;  2JOX A;  2J7J A;  1ZBT A;  1YUJ A;  4WFT A;  2PRT A;  2LV2 A;  2YTJ A;  4FK5 C;  4GZN C;  2EOE A;  2ELZ A;  2RSI A;  4X8W A;  3ECR A;  3EPJ A;  2E72 A;  2R76 A;  2DLQ A;  1YZ9 A;  2E5L E;  1EH6 A;  1RMD A;  2EPO A;  2V85 A;  3BF2 A;  4DV1 E;  2NAB A;  1X5W A;  2RS6 A;  4F6N A;  5KL7 A;  2JPA A;  2EN6 A;  2JYA A;  3T1H E;  2EML A;  4LU9 A;  1QNT A;  2WBU A;  1IMU A;  4DV2 E;  2G7H A;  1P47 A;  5A6B D;  2WCC 3;  1ZBQ A;  1G2F C;  4DV0 E;  1N3G A;  1T4N A;  1QU6 A;  2R1F A;  2YRM A;  1F2I G;  2EOH A;  1GZ6 A;  2LVH A;  3OML A;  2EQ3 A;  5KL3 A;  1KYQ A;  3EQ1 A;  3TQM A;  4BCA A;  1HNX E;  2MC5 A;  1GQE A;  1X48 A;  1NCS A;  4R03 A;  4F54 A;  2ELY A;  1YPN A;  1X6F A;  4F9C B;  4WX9 A;  1N32 E;  2L92 A;  2CT1 A;  4K0K E;  4DUZ E;  2UXB E;  5IWA E;  2Q8U A;  2LTS A;  4LTY A;  4KZS A;  2D9H A;  4DV7 E;  1JK2 A;  2NUG A;  3DJW A;  4LFB E;  2EJ4 A;  2VRD A;  2EOO A;  3T1Y E;  5A6B A;  4B3M E;  2EOY A;  1DGC A;  4N4R B;  2JP9 A;  1X47 A;  2EOQ A;  3VYY A;  5IXM B;  3BGH A;  5A6K A;  1A1I A;  2LT7 A;  1A1F A;  3AUZ A;  2EOF A;  2MKN A;  4R2D A;  1UIL A;  4M0V A;  4NXN E;  2KON A;  3HPZ A;  4O43 A;  1I94 E;  2JOB A;  1PKP A;  2YRK A;  5AE3 A;  4O24 A;  4JI5 E;  1J26 A;  4OX9 E;  4X66 E;  2LBS B;  2EMZ A;  2V86 A;  2K4V A;  2F8B A;  2DMY A;  2YTF A;  2EZ6 A;  2RQL A;  4BHC A;  2EMW A;  1RQ0 A;  4LF8 E;  2F4V E;  4O5G A;  5LLQ A;  2WBS A;  4IS1 C;  4WXD A;  2EMK A;  4TUG A;  1A1L A;  3L00 A;  1AH5 A;  1X49 A;  4LF5 E;  2ODR C;  3J80 C;  4JI3 E;  1WHN A;  2EM6 A;  4GKK E;  4KHP E;  4TUI A;  4X64 E;  2CSH A;  4YY3 E;  1STU A;  1A1G A;  1A1J A;  2EOZ A;  2L2N A;  1XMQ E;  3C6K A;  4DUY E;  1J5E E;  1AAY A;  2EPX A;  1FKA E;  4DR7 E;  4ZYG A;  2DSY A;  2UU9 E;  3F6H A;  2WZO A;  1BBG A;  2JWO A;  2VF1 A;  2FGG A;  4O4K A;  1DQ3 A;  2NUF A;  3IWC A;  4R2E A;  4JV5 E;  2GHF A;  2YSO A;  4WSP A;  2ADR A;  2LRS A;  3MSW A;  2DMI A;  2EE8 A;  1G2D C;  5CFF E;  1TF6 A;  2NUE A;  2GLI A;  1SFE A;  4ZYE A;  3ADJ A;  1ZAA C;  4IJD A;  2EM3 A;  2UUA E;  4JI4 E;  2CTD A;  5FLX C;  2ODR D;  2HJJ A;  2YTE A;  3KWR A;  4M2Z A;  2LUP B;  4M9V C;  4BS9 A;  2EPC A;  3KZY A;  1GTK A;  2HHH E;  2WBT A;  5A69 A;  4DV5 E;  2EPL X;  2L3J A;  2L3C A;  1PDA A;  2V87 A;  3LML A;  2L8T A;  2FV4 B;  4JI0 E;  2EM8 A;  2YTP A;  4WXC A;  2VE7 C;  3JTZ A;  3EPK A;  4GKJ E;  2YTO A;  4L8N A;  2YPN A;  2B7V A;  2JXP A;  2EPU A;  5ADZ A;  5IV8 B;  1EH7 A;  1PJQ A;  2LUQ A;  3FIG A;  4LF7 E;  3HQ1 A;  5AC5 A;  2EMI A;  2JR1 A;  1WHQ A;  2M7Q A;  1BBO A;  2EM2 A;  4DR6 E;  4ZYD A;  4L5N C;  1T4L B;  3J7Y p;  4DR3 E;  4Q35 B;  1IBM E;  2EL5 A;  4R2S A;  3THO B;  2UUC E;  2DGC A;  1XMO E;  3DF6 A;  2EL4 A;  2B7T A;  4NHR A;  5T6J A;  2EM4 A;  4HEI A;  4R2Q A;  3THN A;  1IBL E;  2V8Q B;  1YUI A;  2YTQ A;  2MDR A;  3ADI A;  4Q28 A;  3BID A;  3C6M A;  3IWB A;  3QG5 C;  4LFA E;  1PJS A;  1ZU1 A;  2EMY A;  2EMX A;  5BR8 E;  4X9J A;  2EN3 A;  2UUB E;  2L2M A;  5LL6 R;  4WYQ B;  2V88 A;  2I13 A;  4JI2 E;  2N3H A;  2B3T B;  1HNW E;  2ENA A;  2N3G A;  2L33 A;  1XNQ E;  2LMZ A;  4P78 A;  2MC6 A;  1RC7 A;  1HR0 E;  5AE2 A;  3HPS A;  4MLV A;  3J81 C;  1KJK A;  3IWD A;  5A6J A;  3HTX A;  2EPM X;  4I8O A;  3M99 B;  4JI1 E;  1T39 A;  1N36 E;  4J8Z A;  4R2A A;  4RHB B;  3JAM C;  5A2Q C;  2EMB A;  3OTO E;  4F2J C;  3UK3 C;  1T38 A;  1WRJ A;  2EN4 A;  2DIX A;  2EMH A;  2EPZ A;  1IQO A;  2BBG A;  2MKD A;  3KZZ A;  2UXC E;  2RS7 A;  4P7D A;  1O0W A;  2M4I A;  3EPH A;  2GPI A;  2LTR A;  2EOI A;  1HNZ E;  2JVA A;  4HTG A;  2LO3 A;  2KOU A;  2EN7 A;  2L2K B;  2JY9 A;  2M9A A;  2EN8 A;  2LCE A;  1DI2 A;  2FTX B;  2BB8 A;  4R2R A;  1L4S A;  3MHH C;  2CPN A;  2I9I A;  2RSM A;  4B3R E;  5A6A A;  2YSP A;  4F6M A;  5TSE A;  5LMN E;  1YYK A;  2YTN A;  2VQF E;  4BHB A;  3P1X A;  4B3T E;  5KL4 A;  1WXR A;  2NA2 A;  1EH8 A;  1X3C A;  2EQ0 A;  3VK6 A;  2YRH A;  2EMA A;  2KHX A;  2LJH A;  2EM5 A;  2A25 A;  1FJG E;  2RPC A;  4R8O A;  2DLK A;  5F3W A;  5LMU E;  3HXL A;  4BMJ A;  5AC4 A;  5IT9 C;  2LJU A;  3F6G A;  4NZV A;  4DV3 E;  2EPA A;  2EMC A;  2EN1 A;  5AE1 A;  3MHS C;  4WSG A;  2E1M A;  1YFH A;  2HGH A;  4MLQ A;  3ADL A;  2YU8 A;  1YYW A;  4F9B B;  4KWY A;  2ENC A;  5KL2 A;  2DB2 A;  4DR4 E;  1WJP A;  3VYX A;  5KL6 A;  1Z1B A;  5AAS A;  2EWL A;  4GEQ B;  2IHR 1;  2YTI A;  1UN6 B;  4RH8 A;  1A1K A;  1BB8 A;  2EN2 A;  3ZOQ B;  2EOJ A;  1TN9 A;  2ENH A;  2EM0 A;  2LE2 A;  2VQE E;  2DRP A;  4DV4 E;  4NXM E;  3K6Q A;  1T4O A;  4JI7 E;  2EPP A;  2EPR A;  4BC9 A;  1MEY C;  5DNY A;  3ADG A;  3JU0 A;  3C4B A;  1A1H A;  2M1S A;  2N8X A;  3C4T A;  2HC5 A;  2EM9 A;  2EMF A;  3BBG A;  2YT4 A;  4X62 E;  4JI6 E;  2YWQ A;  4DKK A;  1XNR E;  3EPL A;  1EKZ A;  1B69 A;  1TF3 A;  1SR9 A; 
#chains in the Genus database with same CATH homology
 1N34 E;  2HHH E;  4DV5 E;  4JYA E;  4YHH E;  2V89 A;  3OML A;  1HNZ E;  2JVA A;  2L3J A;  2L3C A;  2V87 A;  2H36 X;  2KOU A;  3LML A;  2L8T A;  4LF4 E;  1UHZ A;  2FV4 B;  4BCA A;  4LF9 E;  2L2K B;  2JY9 A;  1HNX E;  4JI0 E;  2MC5 A;  1GQE A;  1X48 A;  2VE7 C;  3JTZ A;  4R03 A;  4F54 A;  4GKJ E;  4L8N A;  4BC7 A;  2B7V A;  2B9D A;  1DI2 A;  5ADZ A;  2FTX B;  4F9C B;  1N32 E;  3LLH A;  2LUQ A;  2L92 A;  3FIG A;  3RMP A;  4LF7 E;  3HQ1 A;  4B3R E;  2RTX A;  4K0K E;  4DUZ E;  2CPN A;  2UXB E;  5IWA E;  2RSM A;  2LTS A;  1N33 E;  2JR1 A;  4KZS A;  4LTY A;  4DV7 E;  2NUG A;  4WPY A;  1WHQ A;  3DJW A;  4DV6 E;  4F9A B;  2M7Q A;  4LFC E;  4DR6 E;  3H09 A;  3T1Y E;  4B3M E;  4L5N C;  5LMN E;  1T4L B;  3J7Y p;  4DR3 E;  2VQF E;  1IBM E;  1YYK A;  3P1X A;  4B3T E;  2ZM6 E;  1WXR A;  4JI8 E;  2UUC E;  2NA2 A;  4M30 A;  4BBY A;  4OOG C;  1X47 A;  1XMO E;  3DF6 A;  2V83 A;  3VK6 A;  3VYY A;  4AQY E;  2B7T A;  5T6J A;  2KHX A;  1IBK E;  2LJH A;  3AV0 A;  1FJG E;  1IBL E;  2V8Q B;  2MDR A;  4R8O A;  4LF6 E;  3AUZ A;  3ADI A;  4Q28 A;  5F3W A;  2YZT A;  5LMU E;  4DMI A;  3HXL A;  1UIL A;  4M0V A;  3IWB A;  4BMJ A;  4LFA E;  2KON A;  4NXN E;  3J7A G;  3HPZ A;  5IT9 C;  3F6G A;  5BR8 E;  1I94 E;  2JOB A;  1PKP A;  5AE3 A;  4DV3 E;  2UUB E;  2L2M A;  5LL6 R;  4WYQ B;  4DR5 E;  4X65 E;  4JI5 E;  1J26 A;  2V88 A;  4X66 E;  4OX9 E;  5AE1 A;  2LBS B;  2V86 A;  2K4V A;  2F8B A;  4JI2 E;  2DMY A;  2E1M A;  3ADL A;  2EZ6 A;  2N3H A;  2B3T B;  1RQ0 A;  4LF8 E;  1YYW A;  1YYO A;  4B3S E;  2UXD E;  4DR2 E;  4DR1 E;  4F9B B;  1HNW E;  2L6M A;  2JOX A;  2F4V E;  1ZBT A;  2DB2 A;  2N3G A;  4DR4 E;  3VYX A;  1YZ9 A;  4WFT A;  2L33 A;  4TUG A;  1XNQ E;  4LF5 E;  1X49 A;  2ODR C;  2LMZ A;  4P78 A;  2MC6 A;  3J80 C;  1WHN A;  5AAS A;  2EWL A;  1RC7 A;  1HR0 E;  4JI3 E;  4GEQ B;  2IHR 1;  5AE2 A;  4GKK E;  3HPS A;  4KHP E;  4TUI A;  4X64 E;  3J81 C;  3ZOQ B;  3IWD A;  4X8W A;  4YY3 E;  1STU A;  2LE2 A;  2VQE E;  3HTX A;  4DV4 E;  1FKA E;  2L2N A;  1XMQ E;  4I8O A;  4DUY E;  3K6Q A;  1T4O A;  4JI7 E;  1J5E E;  2E5L E;  4JI1 E;  4NXM E;  4DR7 E;  1N36 E;  4J8Z A;  2DSY A;  2V85 A;  3JAM C;  4BC9 A;  2UU9 E;  3F6H A;  4DV1 E;  5A2Q C;  2WZO A;  2RS6 A;  3OTO E;  5DNY A;  2JWO A;  3ADG A;  2VF1 A;  2FGG A;  3JU0 A;  3C4B A;  3T1H E;  1DQ3 A;  4LU9 A;  2M1S A;  3C4T A;  2NUF A;  3IWC A;  4JV5 E;  4WSP A;  2LRS A;  3MSW A;  4DV2 E;  5CFF E;  2NUE A;  4LFB E;  2G7H A;  2DIX A;  4X62 E;  2YT4 A;  1ZBQ A;  3ADJ A;  4DV0 E;  2UXC E;  2RS7 A;  4P7D A;  1T4N A;  4JI6 E;  2UUA E;  1QU6 A;  4DKK A;  4JI4 E;  1XNR E;  5FLX C;  1O0W A;  2M4I A;  2ODR D;  3KWR A;  1EKZ A;  4M2Z A;  2LUP B;  2LTR A;  1GZ6 A;  4BS9 A;  1SR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...