1T4NA

Solution structure of rnt1p dsrbd
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
88
structure length
88
Chain Sequence
MDKLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A new alpha-helical extension promotes RNA binding by the dsRBD of Rnt1p RNAse III
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords Ribonuclease III
total genus 17
structure length 88
sequence length 88
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2004-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1t4nA00
2LTSA 4X65E 2NA2A 1T4NA 2VQEE 4JYAE 1YYOA 2UUAE 2N3HA 2L2NA 4KHPE 1N33E 4DR3E 1X49A 1STUA 2N3GA 1HNZE 2UXDE 3ADGA 4DR2E 1PKPA 4B3RE 3C4BA 4OOGC 2KHXA 4DKKA 4DR6E 2RS7A 4LFBE 4LF8E 4LF9E 1J26A 2LTRA 4DV6E 3ADLA 2HHHE 3C4TA 2DB2A 1J5EE 2NUGA 4JV5E 1T4OA 1QU6A 4GKKE 3LLHA 2LUPB 2VQFE 2LJHA 4NXME 2DIXA 1GQEA 1WHQA 2L2KB 1IBKE 4JI1E 4JI2E 4DUZE 1UHZA 4M2ZA 4AQYE 3T1HE 4GKJE 2B7VA 2UXCE 1N36E 2IHR1 2LBSB 2L3CA 2B7TA 2JY9A 1YZ9A 2L33A 1XNRE 2ZM6E 4B3ME 1XMQE 4DV3E 4LF5E 4X8WA 2RTXA 4WYQB 1I94E 4DUYE 4NXNE 5LMNE 5CFFE 2RS6A 4DV4E 2EZ6A 2MDRA 4JI5E 3VYXA 4DV1E 2L3JA 2UUCE 3VYYA 2UUBE 4DR4E 2LUQA 3ADJA 2UU9E 2B3TB 1FKAE 1XNQE 4JI7E 4LFCE 3T1YE 1XMOE 1HNXE 4K0KE 1HR0E 1T4LB 1IBLE 4DR1E 5BR8E 1X48A 2UXBE 2DMYA 4DV0E 1X47A 1WHNA 1N32E 4OX9E 4LF4E 1FJGE 5IWAE 4X64E 1HNWE 4M30A 4DV2E 2E5LE 4B3TE 1ZBTA 3P1XA 1RC7A 4LF7E 1UILA 2L2MA 2NUFA 3J7Yp 1RQ0A 1DI2A 4YHHE 2CPNA 4DV5E 4YY3E 4JI0E 4LFAE 2YT4A 1EKZA 4JI4E 1YYKA 4DR5E 4WFTA 4DV7E 4B3SE 4JI3E 2F4VE 2LRSA 4LF6E 2NUEA 1IBME 1N34E 3OTOE 2JVAA 1YYWA 2RSMA 4JI6E 4DR7E 4X66E 3HTXA 4X62E 5LMUE 3ADIA 1O0WA 4JI8E
chains in the Genus database with same CATH superfamily
2YTQA 1EH7A 2NA2A 1T4NA 1YYOA 2N3HA 2EPKX 2EM8A 4DR3E 2HGHA 1RMDA 3KZZA 1AAYA 2FTXB 5AE3A 2EJ4A 2N3GA 4MLVA 4L8NA 2KOUA 2YTOA 2UXDE 1NCSA 2EL5A 4X9JA 5DNYA 3UK3C 2A25A 2YTJA 3C4BA 4OOGC 2KHXA 3BGHA 1SFEA 4DKKA 2J7JA 5AE1A 2GLIA 4DV6E 2ELZA 2I13A 4JV5E 3EPLA 2DMIA 2LUPB 2VQFE 3MSWA 2YRKA 4BS9A 2YTNA 2EOZA 1GQEA 1ZR9A 1A1JA 2YRHA 2G7HA 4R2AA 3DF6A 2ENHA 4AQYE 4ZYGA 5A6JA 1A1HA 2EOEA 3JAMC 1BBGA 5F3WA 2L33A 2D9HA 4ZYHA 1T38A 2M7QA 1XMQE 4LF5E 4X8WA 5LMNE 5KL5A 2EL6A 2RPCA 2MDRA 4JI5E 1SR9A 1WJPA 1ZU1A 2R76A 1UBDC 2UUBE 3ADJA 1JK2A 1UN6B 2EM5A 4BHBA 4BMJA 4K0KE 1XMOE 3JU0A 2N8XA 2EMYA 2EPZA 4I8OA 1X47A 4BBYA 1WHNA 2EM6A 2ADRA 4X64E 3IWBA 1TF6A 1ZBTA 2EN2A 3P1XA 1UILA 2LVHA 3MHSC 2EPPA 2NUFA 2EM9A 5IV8B 2CPNA 4DV5E 4JI0E 3J80C 3THOB 2DSYA 2MDGA 1X6FA 1PJQA 1YPNA 2DGCA 4WFTA 2YU8A 2BB8A 4JI3E 2CTDA 2NABA 2MKDA 5AC4A 1G2FC 2JXPA 4P7DA 1L4SA 5LMUE 3ADIA 2LMZA 4O24A 2NUGA 2EOQA 4ZYEA 2EM3A 5T6JA 2RQLA 5KL2A 3F6GA 3QG5C 4RH8A 2EP3A 1STUA 2EN8A 1YUJA 2RSIA 2DLQA 2EPAA 2VE7C 4R2DA 2LO3A 2EMZA 1EH8A 2JOBA 4F9BB 2JOXA 2E72A 2YTIA 2LTRA 1DGCA 2CT1A 2DB2A 4F6MA 4IS1C 3LLHA 2LE2A 3MHHC 3F6HA 1X6EA 1WHQA 4F54A 4JI1E 2JWOA 1PJTA 4FK5C 2EMAA 4DUZE 1LLMC 2UXCE 4GKJE 1N36E 2IHR1 4NZVA 2L3CA 2ODRD 2B7TA 2JY9A 2EOOA 5A69A 2EMBA 1XNRE 1Z1BA 2ZM6E 2EPCA 2WBUA 3HPSA 2EOMA 1NEIA 4DV3E 2M4IA 4WSPA 2RTXA 1IMUA 2YZTA 4DUYE 4NXNE 4F2JC 1PJSA 4KWYA 2PRTA 2EORA 1YSAC 3VYXA 2VF1A 4R2PA 4LU9A 4BCAA 2L3JA 2B9DA 4GZNC 1GZ6A 3VYYA 2YRMA 5KL6A 2LUQA 1X3CA 5IT9C 2UU9E 1FKAE 4R8OA 1T4LB 1IBLE 2EWLA 2DMYA 5KL4A 2EOHA 2K4VA 1ZAAC 5KL3A 2MC5A 1B69A 2GHFA 2YTPA 4M30A 2V85A 4Q28A 3HXLA 3HPZA 1DI2A 1BB8A 2EMKA 2L92A 5ADZA 1A1GA 2EPRA 2YT4A 1P47A 4F9AB 2DRPA 2WBTA 1YYKA 2E1MA 4WXCA 2H36X 2LRSA 3LMLA 1IBME 3VK6A 3DJWA 3OTOE 2YTGA 2EOFA 4DR7E 1TF3A 2GPIA 3BF2A 2YWQA 5A6KA 2KONA 2V83A 4GEQB 1A1LA 3ZOQB 5A6BD 2EL4A 2VQEE 1KYQA 3IWCA 2UUAE 4M9VC 2JR1A 1N33E 2R1FA 2EN6A 2EN3A 1X49A 2L8TA 1WXRA 3AV0A 2EPNA 1MGTA 2WBSA 2DLKA 1TN9A 4J8ZA 1BBOA 4LFBE 4LF9E 3ADLA 2V86A 2HHHE 3C4TA 4HEIA 1X6HA 4F9CB 4GKKE 4RHBB 3BIDA 5A6AA 2EN1A 2MC6A 2DIXA 4NHRA 2EN7A 2LJUA 1IBKE 2M9AA 2LCEA 4R2SA 4M2ZA 3T1HE 2B7VA 1N3GA 2EM0A 2F8BA 4N4RB 4R2EA 4WXDA 3VHTB 3L00A 2ODRC 1F2IG 1YUIA 1JK1A 3ECRA 5A2QC 4Q35B 2YSOA 1I94E 4WYQB 2EM2A 2WZOA 3K6QA 4TUGA 2EOXA 2RS6A 4DV4E 2EZ6A 2HC5A 4WX9A 2EM7A 2ENAA 4BHCA 5AASA 1T39A 2L6MA 2FGGA 4L5NC 4JI7E 2EMXA 3T1YE 2I9IA 1HR0E 5AE2A 4BC7A 5TSEA 2LV2A 2FV4B 1X48A 2K7IA 4LF4E 1HNWE 4DV2E 2E5LE 3M99B 3KWRA 3EPKA 3EQ1A 4IJDA 4LF7E 4R2RA 2EN4A 1A1IA 2CSHA 4BC9A 2EPOA 3J7Yp 1RQ0A 2V89A 2EMHA 4YY3E 1EKZA 4DR5E 1G2DC 4B3SE 4LF6E 1PDAA 2NUEA 4HTGA 2JVAA 1YYWA 2EOSA 3BBGA 2RSMA 4JI6E 4X62E 2EM4A 3H09A 1KJKA 2EMGA 2LTSA 2BBGA 4X65E 1ZBQA 2WCC3 2EMWA 2EQ3A 4JYAE 2EPXA 2L2NA 4KHPE 5IXMB 2EMLA 4LTYA 1HNZE 5KL7A 3ADGA 2YTDA 4DR2E 2LT7A 1PKPA 4B3RE 3AUZA 4WSGA 4R03A 1IQOA 2EMCA 3FIGA 4DR6E 4R2QA 2RS7A 4LF8E 2EMFA 2V88A 1J26A 3KZYA 3IWDA 2Q8UA 4DMIA 1QNTA 1J5EE 1T4OA 1QU6A 3C6KA 2LJHA 2YTFA 4NXME 2ENCA 2EPUA 1DQ3A 2L2KB 2V8QB 4JI2E 1IQSA 1UHZA 4M0VA 3RMPA 5LL6R 2LBSB 2EOIA 2EOYA 1YZ9A 1WRJA 4B3ME 4KZSA 2JPAA 2YPNA 2YTEA 4F6NA 1A1FA 5CFFE 3EPHA 2V87A 4WPYA 2MKNA 3JTZA 2YU5A 3J81C 4DV1E 2UUCE 2EQ1A 2EE8A 4DR4E 2EMIA 1EH6A 1MEYC 3C6MA 2B3TB 2VRDA 1XNQE 3TQMA 1HNXE 4LFCE 2JYAA 3HQ1A 4DR1E 4MLQA 2JP9A 5BR8E 2UXBE 4DV0E 1N32E 2EPLX 4OX9E 4O43A 1FJGE 5IWAE 2ELYA 4B3TE 1A1KA 5FLXC 1RC7A 2L2MA 2HJJA 4ZYDA 2EQ0A 1AH5A 2M1SA 4O5GA 4YHHE 3THNA 4LFAE 1X5WA 4JI4E 4TUIA 4O4KA 2EOJA 4DV7E 3J7AG 2F4VE 1N34E 1GTKA 5LLQA 2EPMX 5AC5A 4R2CA 3OMLA 4X66E 3HTXA 1YFHA 4P78A 1O0WA 3EPJA 5A6BA 2YSPA 4JI8E
chains in the Genus database with same CATH topology
2LTSA 3ZOQB 4X65E 2NA2A 5T6JA 1ZBQA 1T4NA 2VQEE 4JYAE 3F6GA 1YYOA 3IWCA 2UUAE 2JR1A 2N3HA 2L2NA 4KHPE 1N33E 4DR3E 4LTYA 1X49A 2FTXB 5AE3A 1STUA 2L8TA 2N3GA 1HNZE 4L8NA 2KOUA 1WXRA 2UXDE 3ADGA 3AV0A 4P78A 5DNYA 4DR2E 2VE7C 1PKPA 4B3RE 3AUZA 3C4BA 4R03A 2KHXA 4J8ZA 4OOGC 2JOBA 3FIGA 4F9BB 4DKKA 4DR6E 2RS7A 4LFBE 2JOXA 4LF8E 2V88A 5AE1A 4LF9E 2LTRA 1J26A 4DV6E 3ADLA 2V86A 3IWDA 2HHHE 3C4TA 4DMIA 2DB2A 1J5EE 2NUGA 4JV5E 1T4OA 1QU6A 4F9CB 4GKKE 3LLHA 2LUPB 2VQFE 2LJHA 3MSWA 2LE2A 4BS9A 4NXME 2MC6A 2DIXA 3F6HA 1GQEA 1DQ3A 1WHQA 2L2KB 2V8QB 1IBKE 4F54A 4JI1E 4JI2E 2JWOA 4JI8E 4DUZE 1UHZA 4M0VA 2G7HA 3RMPA 3DF6A 4M2ZA 4AQYE 3T1HE 4GKJE 2B7VA 2UXCE 5LL6R 2IHR1 2LBSB 1N36E 3JAMC 2L3CA 2F8BA 2ODRD 2B7TA 2JY9A 5F3WA 1YZ9A 2L33A 2ODRC 1XNRE 2ZM6E 4B3ME 3HPSA 5A2QC 4KZSA 2M7QA 1XMQE 4DV3E 4LF5E 2M4IA 4WSPA 2RTXA 4WYQB 4X8WA 2YZTA 4DUYE 1I94E 4NXNE 5LMNE 2WZOA 5CFFE 3K6QA 4TUGA 2RS6A 4DV4E 2EZ6A 2MDRA 4JI5E 2VF1A 1SR9A 2V87A 4WPYA 3VYXA 4LU9A 3JTZA 4BCAA 3J81C 2L3JA 4DV1E 2B9DA 2UUCE 1GZ6A 3VYYA 2UUBE 4DR4E 2LUQA 3ADJA 2L6MA 5AASA 2FGGA 5IT9C 2UU9E 2B3TB 4L5NC 1FKAE 4R8OA 4JI7E 4BMJA 1XNQE 4LFCE 3T1YE 3JU0A 1XMOE 1HNXE 4K0KE 3HQ1A 5AE2A 4BC7A 1T4LB 4DR1E 1IBLE 1HR0E 2FV4B 5BR8E 1X48A 2EWLA 2UXBE 2DMYA 2K4VA 4DV0E 4I8OA 2MC5A 1X47A 1WHNA 4BBYA 4OX9E 1N32E 4LF4E 1FJGE 5IWAE 4X64E 1HNWE 4M30A 3IWBA 2V85A 4DV2E 2E5LE 1ZBTA 3KWRA 3P1XA 5FLXC 4Q28A 1RC7A 4B3TE 4LF7E 1UILA 2L2MA 2NUFA 3HXLA 2M1SA 4BC9A 3J7Yp 3HPZA 1RQ0A 2V89A 1DI2A 4YHHE 2CPNA 2L92A 5ADZA 4YY3E 4DV5E 4JI0E 4LFAE 3J80C 2DSYA 2YT4A 1EKZA 4JI4E 4F9AB 4TUIA 1YYKA 4DR5E 2E1MA 4WFTA 4DV7E 2H36X 4B3SE 4JI3E 2LRSA 3J7AG 3LMLA 4LF6E 2NUEA 2F4VE 1IBME 1N34E 3VK6A 3DJWA 3OTOE 2JVAA 1YYWA 2RSMA 4JI6E 3OMLA 4DR7E 4X66E 3HTXA 4P7DA 4X62E 5LMUE 3ADIA 3H09A 2LMZA 1O0WA 2KONA 2V83A 4GEQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LTS A;  4X65 E;  2NA2 A;  1T4N A;  2VQE E;  4JYA E;  1YYO A;  2UUA E;  2N3H A;  2L2N A;  4KHP E;  1N33 E;  4DR3 E;  1X49 A;  1STU A;  2N3G A;  1HNZ E;  2UXD E;  3ADG A;  4DR2 E;  1PKP A;  4B3R E;  3C4B A;  4OOG C;  2KHX A;  4DKK A;  4DR6 E;  2RS7 A;  4LFB E;  4LF8 E;  4LF9 E;  1J26 A;  2LTR A;  4DV6 E;  3ADL A;  2HHH E;  3C4T A;  2DB2 A;  1J5E E;  2NUG A;  4JV5 E;  1T4O A;  1QU6 A;  4GKK E;  3LLH A;  2LUP B;  2VQF E;  2LJH A;  4NXM E;  2DIX A;  1GQE A;  1WHQ A;  2L2K B;  1IBK E;  4JI1 E;  4JI2 E;  4DUZ E;  1UHZ A;  4M2Z A;  4AQY E;  3T1H E;  4GKJ E;  2B7V A;  2UXC E;  1N36 E;  2IHR 1;  2LBS B;  2L3C A;  2B7T A;  2JY9 A;  1YZ9 A;  2L33 A;  1XNR E;  2ZM6 E;  4B3M E;  1XMQ E;  4DV3 E;  4LF5 E;  4X8W A;  2RTX A;  4WYQ B;  1I94 E;  4DUY E;  4NXN E;  5LMN E;  5CFF E;  2RS6 A;  4DV4 E;  2EZ6 A;  2MDR A;  4JI5 E;  3VYX A;  4DV1 E;  2L3J A;  2UUC E;  3VYY A;  2UUB E;  4DR4 E;  2LUQ A;  3ADJ A;  2UU9 E;  2B3T B;  1FKA E;  1XNQ E;  4JI7 E;  4LFC E;  3T1Y E;  1XMO E;  1HNX E;  4K0K E;  1HR0 E;  1T4L B;  1IBL E;  4DR1 E;  5BR8 E;  1X48 A;  2UXB E;  2DMY A;  4DV0 E;  1X47 A;  1WHN A;  1N32 E;  4OX9 E;  4LF4 E;  1FJG E;  5IWA E;  4X64 E;  1HNW E;  4M30 A;  4DV2 E;  2E5L E;  4B3T E;  1ZBT A;  3P1X A;  1RC7 A;  4LF7 E;  1UIL A;  2L2M A;  2NUF A;  3J7Y p;  1RQ0 A;  1DI2 A;  4YHH E;  2CPN A;  4DV5 E;  4YY3 E;  4JI0 E;  4LFA E;  2YT4 A;  1EKZ A;  4JI4 E;  1YYK A;  4DR5 E;  4WFT A;  4DV7 E;  4B3S E;  4JI3 E;  2F4V E;  2LRS A;  4LF6 E;  2NUE A;  1IBM E;  1N34 E;  3OTO E;  2JVA A;  1YYW A;  2RSM A;  4JI6 E;  4DR7 E;  4X66 E;  3HTX A;  4X62 E;  5LMU E;  3ADI A;  1O0W A;  4JI8 E; 
#chains in the Genus database with same CATH topology
 2YTQ A;  1EH7 A;  2NA2 A;  1T4N A;  1YYO A;  2N3H A;  2EPK X;  2EM8 A;  4DR3 E;  2HGH A;  1RMD A;  3KZZ A;  1AAY A;  2FTX B;  5AE3 A;  2EJ4 A;  2N3G A;  4MLV A;  4L8N A;  2KOU A;  2YTO A;  2UXD E;  1NCS A;  2EL5 A;  4X9J A;  5DNY A;  3UK3 C;  2A25 A;  2YTJ A;  3C4B A;  4OOG C;  2KHX A;  3BGH A;  1SFE A;  4DKK A;  2J7J A;  5AE1 A;  2GLI A;  4DV6 E;  2ELZ A;  2I13 A;  4JV5 E;  3EPL A;  2DMI A;  2LUP B;  2VQF E;  3MSW A;  2YRK A;  4BS9 A;  2YTN A;  2EOZ A;  1GQE A;  1ZR9 A;  1A1J A;  2YRH A;  2G7H A;  4R2A A;  3DF6 A;  2ENH A;  4AQY E;  4ZYG A;  5A6J A;  1A1H A;  2EOE A;  3JAM C;  1BBG A;  5F3W A;  2L33 A;  2D9H A;  4ZYH A;  1T38 A;  2M7Q A;  1XMQ E;  4LF5 E;  4X8W A;  5LMN E;  5KL5 A;  2EL6 A;  2RPC A;  2MDR A;  4JI5 E;  1SR9 A;  1WJP A;  1ZU1 A;  2R76 A;  1UBD C;  2UUB E;  3ADJ A;  1JK2 A;  1UN6 B;  2EM5 A;  4BHB A;  4BMJ A;  4K0K E;  1XMO E;  3JU0 A;  2N8X A;  2EMY A;  2EPZ A;  4I8O A;  1X47 A;  4BBY A;  1WHN A;  2EM6 A;  2ADR A;  4X64 E;  3IWB A;  1TF6 A;  1ZBT A;  2EN2 A;  3P1X A;  1UIL A;  2LVH A;  3MHS C;  2EPP A;  2NUF A;  2EM9 A;  5IV8 B;  2CPN A;  4DV5 E;  4JI0 E;  3J80 C;  3THO B;  2DSY A;  2MDG A;  1X6F A;  1PJQ A;  1YPN A;  2DGC A;  4WFT A;  2YU8 A;  2BB8 A;  4JI3 E;  2CTD A;  2NAB A;  2MKD A;  5AC4 A;  1G2F C;  2JXP A;  4P7D A;  1L4S A;  5LMU E;  3ADI A;  2LMZ A;  4O24 A;  2NUG A;  2EOQ A;  4ZYE A;  2EM3 A;  5T6J A;  2RQL A;  5KL2 A;  3F6G A;  3QG5 C;  4RH8 A;  2EP3 A;  1STU A;  2EN8 A;  1YUJ A;  2RSI A;  2DLQ A;  2EPA A;  2VE7 C;  4R2D A;  2LO3 A;  2EMZ A;  1EH8 A;  2JOB A;  4F9B B;  2JOX A;  2E72 A;  2YTI A;  2LTR A;  1DGC A;  2CT1 A;  2DB2 A;  4F6M A;  4IS1 C;  3LLH A;  2LE2 A;  3MHH C;  3F6H A;  1X6E A;  1WHQ A;  4F54 A;  4JI1 E;  2JWO A;  1PJT A;  4FK5 C;  2EMA A;  4DUZ E;  1LLM C;  2UXC E;  4GKJ E;  1N36 E;  2IHR 1;  4NZV A;  2L3C A;  2ODR D;  2B7T A;  2JY9 A;  2EOO A;  5A69 A;  2EMB A;  1XNR E;  1Z1B A;  2ZM6 E;  2EPC A;  2WBU A;  3HPS A;  2EOM A;  1NEI A;  4DV3 E;  2M4I A;  4WSP A;  2RTX A;  1IMU A;  2YZT A;  4DUY E;  4NXN E;  4F2J C;  1PJS A;  4KWY A;  2PRT A;  2EOR A;  1YSA C;  3VYX A;  2VF1 A;  4R2P A;  4LU9 A;  4BCA A;  2L3J A;  2B9D A;  4GZN C;  1GZ6 A;  3VYY A;  2YRM A;  5KL6 A;  2LUQ A;  1X3C A;  5IT9 C;  2UU9 E;  1FKA E;  4R8O A;  1T4L B;  1IBL E;  2EWL A;  2DMY A;  5KL4 A;  2EOH A;  2K4V A;  1ZAA C;  5KL3 A;  2MC5 A;  1B69 A;  2GHF A;  2YTP A;  4M30 A;  2V85 A;  4Q28 A;  3HXL A;  3HPZ A;  1DI2 A;  1BB8 A;  2EMK A;  2L92 A;  5ADZ A;  1A1G A;  2EPR A;  2YT4 A;  1P47 A;  4F9A B;  2DRP A;  2WBT A;  1YYK A;  2E1M A;  4WXC A;  2H36 X;  2LRS A;  3LML A;  1IBM E;  3VK6 A;  3DJW A;  3OTO E;  2YTG A;  2EOF A;  4DR7 E;  1TF3 A;  2GPI A;  3BF2 A;  2YWQ A;  5A6K A;  2KON A;  2V83 A;  4GEQ B;  1A1L A;  3ZOQ B;  5A6B D;  2EL4 A;  2VQE E;  1KYQ A;  3IWC A;  2UUA E;  4M9V C;  2JR1 A;  1N33 E;  2R1F A;  2EN6 A;  2EN3 A;  1X49 A;  2L8T A;  1WXR A;  3AV0 A;  2EPN A;  1MGT A;  2WBS A;  2DLK A;  1TN9 A;  4J8Z A;  1BBO A;  4LFB E;  4LF9 E;  3ADL A;  2V86 A;  2HHH E;  3C4T A;  4HEI A;  1X6H A;  4F9C B;  4GKK E;  4RHB B;  3BID A;  5A6A A;  2EN1 A;  2MC6 A;  2DIX A;  4NHR A;  2EN7 A;  2LJU A;  1IBK E;  2M9A A;  2LCE A;  4R2S A;  4M2Z A;  3T1H E;  2B7V A;  1N3G A;  2EM0 A;  2F8B A;  4N4R B;  4R2E A;  4WXD A;  3VHT B;  3L00 A;  2ODR C;  1F2I G;  1YUI A;  1JK1 A;  3ECR A;  5A2Q C;  4Q35 B;  2YSO A;  1I94 E;  4WYQ B;  2EM2 A;  2WZO A;  3K6Q A;  4TUG A;  2EOX A;  2RS6 A;  4DV4 E;  2EZ6 A;  2HC5 A;  4WX9 A;  2EM7 A;  2ENA A;  4BHC A;  5AAS A;  1T39 A;  2L6M A;  2FGG A;  4L5N C;  4JI7 E;  2EMX A;  3T1Y E;  2I9I A;  1HR0 E;  5AE2 A;  4BC7 A;  5TSE A;  2LV2 A;  2FV4 B;  1X48 A;  2K7I A;  4LF4 E;  1HNW E;  4DV2 E;  2E5L E;  3M99 B;  3KWR A;  3EPK A;  3EQ1 A;  4IJD A;  4LF7 E;  4R2R A;  2EN4 A;  1A1I A;  2CSH A;  4BC9 A;  2EPO A;  3J7Y p;  1RQ0 A;  2V89 A;  2EMH A;  4YY3 E;  1EKZ A;  4DR5 E;  1G2D C;  4B3S E;  4LF6 E;  1PDA A;  2NUE A;  4HTG A;  2JVA A;  1YYW A;  2EOS A;  3BBG A;  2RSM A;  4JI6 E;  4X62 E;  2EM4 A;  3H09 A;  1KJK A;  2EMG A;  2LTS A;  2BBG A;  4X65 E;  1ZBQ A;  2WCC 3;  2EMW A;  2EQ3 A;  4JYA E;  2EPX A;  2L2N A;  4KHP E;  5IXM B;  2EML A;  4LTY A;  1HNZ E;  5KL7 A;  3ADG A;  2YTD A;  4DR2 E;  2LT7 A;  1PKP A;  4B3R E;  3AUZ A;  4WSG A;  4R03 A;  1IQO A;  2EMC A;  3FIG A;  4DR6 E;  4R2Q A;  2RS7 A;  4LF8 E;  2EMF A;  2V88 A;  1J26 A;  3KZY A;  3IWD A;  2Q8U A;  4DMI A;  1QNT A;  1J5E E;  1T4O A;  1QU6 A;  3C6K A;  2LJH A;  2YTF A;  4NXM E;  2ENC A;  2EPU A;  1DQ3 A;  2L2K B;  2V8Q B;  4JI2 E;  1IQS A;  1UHZ A;  4M0V A;  3RMP A;  5LL6 R;  2LBS B;  2EOI A;  2EOY A;  1YZ9 A;  1WRJ A;  4B3M E;  4KZS A;  2JPA A;  2YPN A;  2YTE A;  4F6N A;  1A1F A;  5CFF E;  3EPH A;  2V87 A;  4WPY A;  2MKN A;  3JTZ A;  2YU5 A;  3J81 C;  4DV1 E;  2UUC E;  2EQ1 A;  2EE8 A;  4DR4 E;  2EMI A;  1EH6 A;  1MEY C;  3C6M A;  2B3T B;  2VRD A;  1XNQ E;  3TQM A;  1HNX E;  4LFC E;  2JYA A;  3HQ1 A;  4DR1 E;  4MLQ A;  2JP9 A;  5BR8 E;  2UXB E;  4DV0 E;  1N32 E;  2EPL X;  4OX9 E;  4O43 A;  1FJG E;  5IWA E;  2ELY A;  4B3T E;  1A1K A;  5FLX C;  1RC7 A;  2L2M A;  2HJJ A;  4ZYD A;  2EQ0 A;  1AH5 A;  2M1S A;  4O5G A;  4YHH E;  3THN A;  4LFA E;  1X5W A;  4JI4 E;  4TUI A;  4O4K A;  2EOJ A;  4DV7 E;  3J7A G;  2F4V E;  1N34 E;  1GTK A;  5LLQ A;  2EPM X;  5AC5 A;  4R2C A;  3OML A;  4X66 E;  3HTX A;  1YFH A;  4P78 A;  1O0W A;  3EPJ A;  5A6B A;  2YSP A;  4JI8 E; 
#chains in the Genus database with same CATH homology
 2LTS A;  3ZOQ B;  4X65 E;  2NA2 A;  5T6J A;  1ZBQ A;  1T4N A;  2VQE E;  4JYA E;  3F6G A;  1YYO A;  3IWC A;  2UUA E;  2JR1 A;  2N3H A;  2L2N A;  4KHP E;  1N33 E;  4DR3 E;  4LTY A;  1X49 A;  2FTX B;  5AE3 A;  1STU A;  2L8T A;  2N3G A;  1HNZ E;  4L8N A;  2KOU A;  1WXR A;  2UXD E;  3ADG A;  3AV0 A;  4P78 A;  5DNY A;  4DR2 E;  2VE7 C;  1PKP A;  4B3R E;  3AUZ A;  3C4B A;  4R03 A;  2KHX A;  4J8Z A;  4OOG C;  2JOB A;  3FIG A;  4F9B B;  4DKK A;  4DR6 E;  2RS7 A;  4LFB E;  2JOX A;  4LF8 E;  2V88 A;  5AE1 A;  4LF9 E;  2LTR A;  1J26 A;  4DV6 E;  3ADL A;  2V86 A;  3IWD A;  2HHH E;  3C4T A;  4DMI A;  2DB2 A;  1J5E E;  2NUG A;  4JV5 E;  1T4O A;  1QU6 A;  4F9C B;  4GKK E;  3LLH A;  2LUP B;  2VQF E;  2LJH A;  3MSW A;  2LE2 A;  4BS9 A;  4NXM E;  2MC6 A;  2DIX A;  3F6H A;  1GQE A;  1DQ3 A;  1WHQ A;  2L2K B;  2V8Q B;  1IBK E;  4F54 A;  4JI1 E;  4JI2 E;  2JWO A;  4JI8 E;  4DUZ E;  1UHZ A;  4M0V A;  2G7H A;  3RMP A;  3DF6 A;  4M2Z A;  4AQY E;  3T1H E;  4GKJ E;  2B7V A;  2UXC E;  5LL6 R;  2IHR 1;  2LBS B;  1N36 E;  3JAM C;  2L3C A;  2F8B A;  2ODR D;  2B7T A;  2JY9 A;  5F3W A;  1YZ9 A;  2L33 A;  2ODR C;  1XNR E;  2ZM6 E;  4B3M E;  3HPS A;  5A2Q C;  4KZS A;  2M7Q A;  1XMQ E;  4DV3 E;  4LF5 E;  2M4I A;  4WSP A;  2RTX A;  4WYQ B;  4X8W A;  2YZT A;  4DUY E;  1I94 E;  4NXN E;  5LMN E;  2WZO A;  5CFF E;  3K6Q A;  4TUG A;  2RS6 A;  4DV4 E;  2EZ6 A;  2MDR A;  4JI5 E;  2VF1 A;  1SR9 A;  2V87 A;  4WPY A;  3VYX A;  4LU9 A;  3JTZ A;  4BCA A;  3J81 C;  2L3J A;  4DV1 E;  2B9D A;  2UUC E;  1GZ6 A;  3VYY A;  2UUB E;  4DR4 E;  2LUQ A;  3ADJ A;  2L6M A;  5AAS A;  2FGG A;  5IT9 C;  2UU9 E;  2B3T B;  4L5N C;  1FKA E;  4R8O A;  4JI7 E;  4BMJ A;  1XNQ E;  4LFC E;  3T1Y E;  3JU0 A;  1XMO E;  1HNX E;  4K0K E;  3HQ1 A;  5AE2 A;  4BC7 A;  1T4L B;  4DR1 E;  1IBL E;  1HR0 E;  2FV4 B;  5BR8 E;  1X48 A;  2EWL A;  2UXB E;  2DMY A;  2K4V A;  4DV0 E;  4I8O A;  2MC5 A;  1X47 A;  1WHN A;  4BBY A;  4OX9 E;  1N32 E;  4LF4 E;  1FJG E;  5IWA E;  4X64 E;  1HNW E;  4M30 A;  3IWB A;  2V85 A;  4DV2 E;  2E5L E;  1ZBT A;  3KWR A;  3P1X A;  5FLX C;  4Q28 A;  1RC7 A;  4B3T E;  4LF7 E;  1UIL A;  2L2M A;  2NUF A;  3HXL A;  2M1S A;  4BC9 A;  3J7Y p;  3HPZ A;  1RQ0 A;  2V89 A;  1DI2 A;  4YHH E;  2CPN A;  2L92 A;  5ADZ A;  4YY3 E;  4DV5 E;  4JI0 E;  4LFA E;  3J80 C;  2DSY A;  2YT4 A;  1EKZ A;  4JI4 E;  4F9A B;  4TUI A;  1YYK A;  4DR5 E;  2E1M A;  4WFT A;  4DV7 E;  2H36 X;  4B3S E;  4JI3 E;  2LRS A;  3J7A G;  3LML A;  4LF6 E;  2NUE A;  2F4V E;  1IBM E;  1N34 E;  3VK6 A;  3DJW A;  3OTO E;  2JVA A;  1YYW A;  2RSM A;  4JI6 E;  3OML A;  4DR7 E;  4X66 E;  3HTX A;  4P7D A;  4X62 E;  5LMU E;  3ADI A;  3H09 A;  2LMZ A;  1O0W A;  2KON A;  2V83 A;  4GEQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...