1T4NA

Solution structure of rnt1p dsrbd
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
88
structure length
88
Chain Sequence
MDKLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ribonuclease III
publication title A new alpha-helical extension promotes RNA binding by the dsRBD of Rnt1p RNAse III
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 17
structure length 88
sequence length 88
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2004-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1t4nA00
1T4OA 5LMUE 1N32E 4DV5E 4JYAE 2F4VE 4JI1E 2JVAA 1QU6A 3T1HE 1FJGE 4GKJE 2UUCE 5BR8E 1HR0E 3T1YE 3C4BA 3C4TA 4DV4E 4B3RE 3P1XA 2UXCE 2LBSB 2ZM6E 1N36E 2B3TB 2UU9E 1XMOE 4X8WA 4KHPE 4M2ZA 2L2MA 2KHXA 4X65E 1YYWA 4DR6E 1T4NA 2VQFE 2LTSA 4LF5E 4X66E 4JI5E 2LRSA 5IWAE 3ADJA 1UILA 1J5EE 4DUZE 2LJHA 2N3GA 4JI3E 1EKZA 4LF7E 1DI2A 2L3CA 4JI0E 4DV1E 4DV7E 3HTXA 1UHZA 1YYOA 2EZ6A 1ZBTA 2DIXA 3ADLA 4B3ME 2YT4A 1X49A 4B3TE 2IHR1 1STUA 4GKKE 4NXME 4JI2E 2RS6A 2RSMA 4DV6E 2UXBE 2DB2A 4NXNE 2L2NA 4LF6E 4LFAE 2UXDE 4DR2E 1WHQA 3VYXA 4M30A 1GQEA 2HHHE 4YHHE 1RC7A 2L3JA 4DR1E 2JY9A 1IBLE 2L33A 1I94E 2UUAE 4DUYE 2B7VA 2VQEE 4DV3E 2B7TA 4DV2E 3ADIA 1N34E 1IBKE 1N33E 3ADGA 1HNWE 4JV5E 2MDRA 2E5LE 4DR3E 1PKPA 2LTRA 4LF4E 4WFTA 2NUEA 1T4LB 4JI4E 4K0KE 1XNRE 4LFBE 1X48A 1FKAE 2UUBE 2DMYA 4JI8E 1WHNA 4DKKA 2L2KB 2NUFA 4DR7E 4OOGC 1HNXE 4LF8E 4LFCE 5LMNE 4AQYE 2NA2A 2LUQA 1HNZE 3VYYA 4DR4E 2CPNA 1IBME 4X62E 4JI6E 1XMQE 4X64E 4LF9E 4OX9E 2NUGA 1J26A 4YY3E 3J7Yp 1YYKA 1RQ0A 1YZ9A 2RS7A 2LUPB 5CFFE 3OTOE 4DV0E 4B3SE 4DR5E 4WYQB 1X47A 2N3HA 4JI7E 2RTXA 1XNQE 3LLHA 1O0WA
chains in the Genus database with same CATH superfamily
3K6QA 2L92A 5IXMB 3T1HE 5A2QC 2UUCE 2B9DA 4DV4E 3BGHA 2V88A 2UXCE 2R1FA 3BBGA 2B3TB 3F6HA 3HQ1A 5DNYA 1A1HA 4M2ZA 2KHXA 2EPLX 4P78A 2LMZA 2EMIA 2EMKA 4LF5E 2LV2A 3IWCA 2V87A 4JI5E 2EM6A 1ZU1A 1EH6A 2EOHA 4Q28A 2EPMX 1J5EE 3RMPA 2MC6A 4F6MA 1DI2A 1YFHA 4JI0E 2A25A 3HXLA 4MLVA 2EQ1A 4WSPA 4NXME 4NHRA 1ZR9A 4TUGA 2L8TA 1JK2A 2EOMA 2EPNA 4O24A 2UXDE 4O4KA 2EN1A 4R2CA 4M30A 1GQEA 2EMCA 1A1JA 5AE3A 1A1FA 4DUYE 4BCAA 3JAMC 2EOJA 4F2JC 4DV2E 2EOOA 2LE2A 1IBKE 2GHFA 2EOYA 2EPCA 3M99B 2YRKA 2E5LE 2EN8A 4DR3E 1A1IA 2EN4A 4KWYA 4LF4E 2ELYA 4WFTA 1PDAA 1T4LB 1XNRE 3IWBA 1FKAE 2DMYA 3ZOQB 4F6NA 4R2DA 2KONA 2L2KB 3J81C 2EL5A 1BB8A 3EPLA 1KYQA 1IQOA 3THOB 5T6JA 4BS9A 1HNZE 1T38A 4BC7A 4LF9E 4X64E 1TF6A 4HEIA 4X9JA 2YWQA 4Q35B 4TUIA 2EN2A 2YRMA 3FIGA 2ENAA 4P7DA 2JPAA 2LVHA 2YU8A 1X6EA 4JI7E 2RTXA 2EM8A 3LLHA 2WBTA 2F4VE 4RH8A 1WRJA 4BHBA 2EMHA 5A6AA 4R8OA 1A1LA 4WXDA 2EMWA 1B69A 3BIDA 2ZM6E 1KJKA 1N36E 2UU9E 1XMOE 1SFEA 2EMAA 2ELZA 4X8WA 4KHPE 4IS1C 5F3WA 4DR6E 3AV0A 2DMIA 2EMZA 4X66E 2EPKX 5TSEA 3KZYA 5IWAE 2KOUA 1QNTA 1MEYC 1SR9A 1UN6B 4R2AA 1DQ3A 2YTDA 2N3GA 4NZVA 1EKZA 2L3CA 4DV1E 4O5GA 1X3CA 1YYOA 4R2RA 2YTEA 2DIXA 2EOFA 2EOIA 2JXPA 2L6MA 1X49A 2YT4A 2IHR1 3KWRA 4F9CB 4B3TE 3C6MA 2JR1A 4ZYEA 4I8OA 2RSMA 2V83A 4DV6E 2EPXA 2MKNA 2L2NA 5LL6R 4DR2E 1BBOA 1WHQA 3VYXA 1A1KA 1WJPA 3EPKA 2BBGA 4J8ZA 2EL6A 2LO3A 5ADZA 2L3JA 4N4RB 2JY9A 1A1GA 2V86A 1IBLE 2L33A 2UUAE 2YTNA 2B7VA 4DV3E 2V8QB 3HPZA 4L5NC 2WBUA 1N34E 2K4VA 3ADGA 2YTJA 1HNWE 2EM7A 2LT7A 4JV5E 5KL3A 2K7IA 1PJQA 2F8BA 1PJSA 2EM3A 2LTRA 4HTGA 2NUEA 3THNA 3LMLA 4JI4E 2HC5A 2M1SA 1DGCA 2YU5A 5A6BA 1YUJA 2JOBA 2NABA 2NUFA 3DF6A 2V85A 2EE8A 1IQSA 4R2SA 4LFCE 5AE2A 2BB8A 2EMFA 5LMNE 4DR4E 3VYYA 2CPNA 1IBME 5FLXC 4JI6E 1XMQE 4OX9E 2NUGA 3MHSC 4LU9A 2DRPA 4YY3E 2GLIA 2YTFA 3UK3C 3OMLA 5KL5A 1EH7A 3ECRA 5LLQA 2FTXB 5A69A 2EOZA 2EL4A 2EOEA 2EN3A 4ZYHA 3HPSA 2J7JA 2FGGA 2EPRA 1XNQE 1L4SA 5LMUE 1N32E 2M4IA 4JI1E 1NCSA 3JU0A 4GKJE 4R2EA 1HR0E 4WPYA 4R2QA 3C4TA 5AC5A 2EPUA 1IMUA 2LBSB 1YUIA 2WBSA 2M9AA 2G7HA 2L2MA 3MSWA 1YYWA 3VK6A 4R2PA 2YPNA 2VQFE 2LRSA 1AAYA 3J7AG 3ADJA 5A6KA 5AE1A 2LJHA 4JI3E 2EMLA 3J80C 1YPNA 2EM5A 4LF7E 2DLQA 2EMBA 2EPZA 2EQ3A 2EOSA 4DV7E 3HTXA 2ADRA 1LLMC 3EQ1A 2RQLA 3ADLA 2YTGA 1ZAAC 4BHCA 4B3ME 3TQMA 2ENCA 1STUA 1MGTA 2EPAA 2RSIA 4GKKE 2EM4A 2DB2A 2I13A 2MDGA 2DGCA 3L00A 4LFAE 2YTIA 2N8XA 2CT1A 1X5WA 2LJUA 2EMYA 2EMGA 2CSHA 2HHHE 3F6GA 2LCEA 4YHHE 1RC7A 2EM0A 2YSOA 5A6JA 1I94E 4F54A 1GTKA 2B7TA 2EOXA 3ADIA 2PRTA 3KZZA 1WXRA 2E72A 5KL4A 4KZSA 5KL7A 3EPJA 2DLKA 3C6KA 2YTPA 2DSYA 2YZTA 2UUBE 1WHNA 2D9HA 4DR7E 4BBYA 4OOGC 1HNXE 2R76A 4LF8E 3AUZA 4AQYE 2LUQA 2JP9A 3BF2A 5A6BD 2EQ0A 3J7Yp 2EN6A 2HGHA 1RQ0A 1YYKA 4M0VA 3JTZA 4F9AB 2RS7A 2LUPB 5CFFE 4LTYA 3OTOE 4B3SE 2YTOA 4F9BB 4WYQB 2WCC3 2N3HA 5KL2A 4DV0E 1T4OA 4MLQA 2RPCA 4DV5E 1YSAC 4JYAE 2JVAA 2H36X 1NEIA 1QU6A 1FJGE 2VRDA 5BR8E 3T1YE 3C4BA 4WXCA 3IWDA 4B3RE 3P1XA 1ZBQA 2MKDA 2EPOA 4X65E 1T4NA 2YSPA 5IV8B 2Q8UA 2LTSA 5AASA 2HJJA 1UILA 4DUZE 4RHBB 1AH5A 2EJ4A 2EPPA 2WZOA 5IT9C 4GEQB 2E1MA 1UHZA 2EZ6A 3VHTB 1ZBTA 1TF3A 2EOQA 2YRHA 4ZYGA 2JOXA 1PJTA 3QG5C 5KL6A 1X6HA 4JI2E 2ENHA 2RS6A 1UBDC 4M9VC 2UXBE 4NXNE 5AC4A 4LF6E 1EH8A 1T39A 2ODRC 4L8NA 4ZYDA 4DR1E 2CTDA 2VQEE 2GPIA 1TN9A 2VE7C 4FK5C 4WX9A 1N33E 2M7QA 2I9IA 2MDRA 2JYAA 2EORA 1GZ6A 1PKPA 2MC5A 3DJWA 1X6FA 4IJDA 4R03A 4K0KE 1G2FC 4LFBE 1X48A 1JK1A 2EMXA 4O43A 2EP3A 1BBGA 4JI8E 4DKKA 1Z1BA 4WSGA 1G2DC 4GZNC 2FV4B 4DMIA 2NA2A 4X62E 1RMDA 4BC9A 1J26A 1YZ9A 2V89A 1N3GA 2EM2A 2EN7A 2VF1A 4DR5E 2EWLA 1P47A 2JWOA 1X47A 2EM9A 3EPHA 2YTQA 3H09A 2ODRD 4BMJA 1F2IG 1O0WA 3MHHC
chains in the Genus database with same CATH topology
1T4OA 3K6QA 5LMUE 2M4IA 2L92A 4DV5E 1N32E 4JYAE 2F4VE 4JI1E 2JVAA 2H36X 1QU6A 3T1HE 1FJGE 3JU0A 5A2QC 4GKJE 2UUCE 5BR8E 1HR0E 2B9DA 4WPYA 3C4BA 3T1YE 3C4TA 4R8OA 4DV4E 3IWDA 4B3RE 2V88A 3P1XA 2UXCE 1ZBQA 2LBSB 2ZM6E 1N36E 2B3TB 3F6HA 1XMOE 2UU9E 4X8WA 4KHPE 3HQ1A 2G7HA 5DNYA 2L2MA 2KHXA 3MSWA 4X65E 5F3WA 1T4NA 4M2ZA 1YYWA 4DR6E 4P78A 2LMZA 3VK6A 2VQFE 2LTSA 3AV0A 4LF5E 3IWCA 4X66E 2V87A 5AASA 4JI5E 2LRSA 5IWAE 2KOUA 4Q28A 3J7AG 3ADJA 1SR9A 1DQ3A 1UILA 5AE1A 2LJHA 4DUZE 2N3GA 3RMPA 1J5EE 4JI3E 3J80C 2MC6A 1EKZA 2WZOA 4LF7E 1DI2A 2L3CA 5IT9C 4JI0E 4DV1E 4DV7E 3HTXA 4GEQB 2E1MA 3HXLA 1UHZA 1YYOA 2EZ6A 1ZBTA 2DIXA 3ADLA 4B3ME 2JOXA 2L6MA 2YT4A 1X49A 4F9CB 2IHR1 3KWRA 1STUA 4B3TE 4WSPA 4GKKE 2JR1A 4NXME 4JI2E 4I8OA 2RS6A 2RSMA 2V83A 4DV6E 4TUGA 2UXBE 2DB2A 4NXNE 2L2NA 2L8TA 4LF6E 5LL6R 4LFAE 2UXDE 2ODRC 4DR2E 1WHQA 3VYXA 4M30A 1GQEA 4L8NA 2HHHE 3F6GA 4J8ZA 4YHHE 5ADZA 1RC7A 2L3JA 4DR1E 2JY9A 5AE3A 2V86A 1IBLE 2L33A 1I94E 2UUAE 4DUYE 4F54A 2B7VA 4BCAA 3JAMC 2B7TA 2V8QB 2VQEE 4DV3E 3HPZA 4L5NC 4DV2E 3ADIA 2LE2A 1N34E 2VE7C 2K4VA 1IBKE 1N33E 3ADGA 1HNWE 2M7QA 1WXRA 2MDRA 4JV5E 2E5LE 4DR3E 2F8BA 1GZ6A 4KZSA 1PKPA 2MC5A 3DJWA 2LTRA 4LF4E 4WFTA 4R03A 1T4LB 4JI4E 3LMLA 2NUEA 1XNRE 2M1SA 4K0KE 1X48A 4LFBE 2DSYA 3IWBA 2YZTA 2FGGA 1FKAE 2UUBE 2DMYA 1WHNA 4JI8E 2JOBA 3ZOQB 4DKKA 2KONA 2L2KB 2NUFA 3DF6A 4DR7E 3J81C 2FV4B 2V85A 4BBYA 4OOGC 1HNXE 4LF8E 4LFCE 5AE2A 5T6JA 4BS9A 4DMIA 3AUZA 2NA2A 2LUQA 4BMJA 5LMNE 3VYYA 2CPNA 4AQYE 1HNZE 4X62E 1IBME 4BC7A 5FLXC 1XMQE 4X64E 4JI6E 4LF9E 4OX9E 2NUGA 4LU9A 4BC9A 1J26A 4YY3E 3J7Yp 1YYKA 1RQ0A 4M0VA 2V89A 3JTZA 4F9AB 2RS7A 3OMLA 2LUPB 5CFFE 1YZ9A 4LTYA 2VF1A 3OTOE 4DV0E 4B3SE 2FTXB 4TUIA 4DR5E 2EWLA 3FIGA 4F9BB 2JWOA 4P7DA 4WYQB 1X47A 2N3HA 3HPSA 4DR4E 4JI7E 3H09A 2RTXA 2ODRD 1XNQE 3LLHA 1O0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T4O A;  5LMU E;  1N32 E;  4DV5 E;  4JYA E;  2F4V E;  4JI1 E;  2JVA A;  1QU6 A;  3T1H E;  1FJG E;  4GKJ E;  2UUC E;  5BR8 E;  1HR0 E;  3T1Y E;  3C4B A;  3C4T A;  4DV4 E;  4B3R E;  3P1X A;  2UXC E;  2LBS B;  2ZM6 E;  1N36 E;  2B3T B;  2UU9 E;  1XMO E;  4X8W A;  4KHP E;  4M2Z A;  2L2M A;  2KHX A;  4X65 E;  1YYW A;  4DR6 E;  1T4N A;  2VQF E;  2LTS A;  4LF5 E;  4X66 E;  4JI5 E;  2LRS A;  5IWA E;  3ADJ A;  1UIL A;  1J5E E;  4DUZ E;  2LJH A;  2N3G A;  4JI3 E;  1EKZ A;  4LF7 E;  1DI2 A;  2L3C A;  4JI0 E;  4DV1 E;  4DV7 E;  3HTX A;  1UHZ A;  1YYO A;  2EZ6 A;  1ZBT A;  2DIX A;  3ADL A;  4B3M E;  2YT4 A;  1X49 A;  4B3T E;  2IHR 1;  1STU A;  4GKK E;  4NXM E;  4JI2 E;  2RS6 A;  2RSM A;  4DV6 E;  2UXB E;  2DB2 A;  4NXN E;  2L2N A;  4LF6 E;  4LFA E;  2UXD E;  4DR2 E;  1WHQ A;  3VYX A;  4M30 A;  1GQE A;  2HHH E;  4YHH E;  1RC7 A;  2L3J A;  4DR1 E;  2JY9 A;  1IBL E;  2L33 A;  1I94 E;  2UUA E;  4DUY E;  2B7V A;  2VQE E;  4DV3 E;  2B7T A;  4DV2 E;  3ADI A;  1N34 E;  1IBK E;  1N33 E;  3ADG A;  1HNW E;  4JV5 E;  2MDR A;  2E5L E;  4DR3 E;  1PKP A;  2LTR A;  4LF4 E;  4WFT A;  2NUE A;  1T4L B;  4JI4 E;  4K0K E;  1XNR E;  4LFB E;  1X48 A;  1FKA E;  2UUB E;  2DMY A;  4JI8 E;  1WHN A;  4DKK A;  2L2K B;  2NUF A;  4DR7 E;  4OOG C;  1HNX E;  4LF8 E;  4LFC E;  5LMN E;  4AQY E;  2NA2 A;  2LUQ A;  1HNZ E;  3VYY A;  4DR4 E;  2CPN A;  1IBM E;  4X62 E;  4JI6 E;  1XMQ E;  4X64 E;  4LF9 E;  4OX9 E;  2NUG A;  1J26 A;  4YY3 E;  3J7Y p;  1YYK A;  1RQ0 A;  1YZ9 A;  2RS7 A;  2LUP B;  5CFF E;  3OTO E;  4DV0 E;  4B3S E;  4DR5 E;  4WYQ B;  1X47 A;  2N3H A;  4JI7 E;  2RTX A;  1XNQ E;  3LLH A;  1O0W A; 
#chains in the Genus database with same CATH topology
 3K6Q A;  2L92 A;  5IXM B;  3T1H E;  5A2Q C;  2UUC E;  2B9D A;  4DV4 E;  3BGH A;  2V88 A;  2UXC E;  2R1F A;  3BBG A;  2B3T B;  3F6H A;  3HQ1 A;  5DNY A;  1A1H A;  4M2Z A;  2KHX A;  2EPL X;  4P78 A;  2LMZ A;  2EMI A;  2EMK A;  4LF5 E;  2LV2 A;  3IWC A;  2V87 A;  4JI5 E;  2EM6 A;  1ZU1 A;  1EH6 A;  2EOH A;  4Q28 A;  2EPM X;  1J5E E;  3RMP A;  2MC6 A;  4F6M A;  1DI2 A;  1YFH A;  4JI0 E;  2A25 A;  3HXL A;  4MLV A;  2EQ1 A;  4WSP A;  4NXM E;  4NHR A;  1ZR9 A;  4TUG A;  2L8T A;  1JK2 A;  2EOM A;  2EPN A;  4O24 A;  2UXD E;  4O4K A;  2EN1 A;  4R2C A;  4M30 A;  1GQE A;  2EMC A;  1A1J A;  5AE3 A;  1A1F A;  4DUY E;  4BCA A;  3JAM C;  2EOJ A;  4F2J C;  4DV2 E;  2EOO A;  2LE2 A;  1IBK E;  2GHF A;  2EOY A;  2EPC A;  3M99 B;  2YRK A;  2E5L E;  2EN8 A;  4DR3 E;  1A1I A;  2EN4 A;  4KWY A;  4LF4 E;  2ELY A;  4WFT A;  1PDA A;  1T4L B;  1XNR E;  3IWB A;  1FKA E;  2DMY A;  3ZOQ B;  4F6N A;  4R2D A;  2KON A;  2L2K B;  3J81 C;  2EL5 A;  1BB8 A;  3EPL A;  1KYQ A;  1IQO A;  3THO B;  5T6J A;  4BS9 A;  1HNZ E;  1T38 A;  4BC7 A;  4LF9 E;  4X64 E;  1TF6 A;  4HEI A;  4X9J A;  2YWQ A;  4Q35 B;  4TUI A;  2EN2 A;  2YRM A;  3FIG A;  2ENA A;  4P7D A;  2JPA A;  2LVH A;  2YU8 A;  1X6E A;  4JI7 E;  2RTX A;  2EM8 A;  3LLH A;  2WBT A;  2F4V E;  4RH8 A;  1WRJ A;  4BHB A;  2EMH A;  5A6A A;  4R8O A;  1A1L A;  4WXD A;  2EMW A;  1B69 A;  3BID A;  2ZM6 E;  1KJK A;  1N36 E;  2UU9 E;  1XMO E;  1SFE A;  2EMA A;  2ELZ A;  4X8W A;  4KHP E;  4IS1 C;  5F3W A;  4DR6 E;  3AV0 A;  2DMI A;  2EMZ A;  4X66 E;  2EPK X;  5TSE A;  3KZY A;  5IWA E;  2KOU A;  1QNT A;  1MEY C;  1SR9 A;  1UN6 B;  4R2A A;  1DQ3 A;  2YTD A;  2N3G A;  4NZV A;  1EKZ A;  2L3C A;  4DV1 E;  4O5G A;  1X3C A;  1YYO A;  4R2R A;  2YTE A;  2DIX A;  2EOF A;  2EOI A;  2JXP A;  2L6M A;  1X49 A;  2YT4 A;  2IHR 1;  3KWR A;  4F9C B;  4B3T E;  3C6M A;  2JR1 A;  4ZYE A;  4I8O A;  2RSM A;  2V83 A;  4DV6 E;  2EPX A;  2MKN A;  2L2N A;  5LL6 R;  4DR2 E;  1BBO A;  1WHQ A;  3VYX A;  1A1K A;  1WJP A;  3EPK A;  2BBG A;  4J8Z A;  2EL6 A;  2LO3 A;  5ADZ A;  2L3J A;  4N4R B;  2JY9 A;  1A1G A;  2V86 A;  1IBL E;  2L33 A;  2UUA E;  2YTN A;  2B7V A;  4DV3 E;  2V8Q B;  3HPZ A;  4L5N C;  2WBU A;  1N34 E;  2K4V A;  3ADG A;  2YTJ A;  1HNW E;  2EM7 A;  2LT7 A;  4JV5 E;  5KL3 A;  2K7I A;  1PJQ A;  2F8B A;  1PJS A;  2EM3 A;  2LTR A;  4HTG A;  2NUE A;  3THN A;  3LML A;  4JI4 E;  2HC5 A;  2M1S A;  1DGC A;  2YU5 A;  5A6B A;  1YUJ A;  2JOB A;  2NAB A;  2NUF A;  3DF6 A;  2V85 A;  2EE8 A;  1IQS A;  4R2S A;  4LFC E;  5AE2 A;  2BB8 A;  2EMF A;  5LMN E;  4DR4 E;  3VYY A;  2CPN A;  1IBM E;  5FLX C;  4JI6 E;  1XMQ E;  4OX9 E;  2NUG A;  3MHS C;  4LU9 A;  2DRP A;  4YY3 E;  2GLI A;  2YTF A;  3UK3 C;  3OML A;  5KL5 A;  1EH7 A;  3ECR A;  5LLQ A;  2FTX B;  5A69 A;  2EOZ A;  2EL4 A;  2EOE A;  2EN3 A;  4ZYH A;  3HPS A;  2J7J A;  2FGG A;  2EPR A;  1XNQ E;  1L4S A;  5LMU E;  1N32 E;  2M4I A;  4JI1 E;  1NCS A;  3JU0 A;  4GKJ E;  4R2E A;  1HR0 E;  4WPY A;  4R2Q A;  3C4T A;  5AC5 A;  2EPU A;  1IMU A;  2LBS B;  1YUI A;  2WBS A;  2M9A A;  2G7H A;  2L2M A;  3MSW A;  1YYW A;  3VK6 A;  4R2P A;  2YPN A;  2VQF E;  2LRS A;  1AAY A;  3J7A G;  3ADJ A;  5A6K A;  5AE1 A;  2LJH A;  4JI3 E;  2EML A;  3J80 C;  1YPN A;  2EM5 A;  4LF7 E;  2DLQ A;  2EMB A;  2EPZ A;  2EQ3 A;  2EOS A;  4DV7 E;  3HTX A;  2ADR A;  1LLM C;  3EQ1 A;  2RQL A;  3ADL A;  2YTG A;  1ZAA C;  4BHC A;  4B3M E;  3TQM A;  2ENC A;  1STU A;  1MGT A;  2EPA A;  2RSI A;  4GKK E;  2EM4 A;  2DB2 A;  2I13 A;  2MDG A;  2DGC A;  3L00 A;  4LFA E;  2YTI A;  2N8X A;  2CT1 A;  1X5W A;  2LJU A;  2EMY A;  2EMG A;  2CSH A;  2HHH E;  3F6G A;  2LCE A;  4YHH E;  1RC7 A;  2EM0 A;  2YSO A;  5A6J A;  1I94 E;  4F54 A;  1GTK A;  2B7T A;  2EOX A;  3ADI A;  2PRT A;  3KZZ A;  1WXR A;  2E72 A;  5KL4 A;  4KZS A;  5KL7 A;  3EPJ A;  2DLK A;  3C6K A;  2YTP A;  2DSY A;  2YZT A;  2UUB E;  1WHN A;  2D9H A;  4DR7 E;  4BBY A;  4OOG C;  1HNX E;  2R76 A;  4LF8 E;  3AUZ A;  4AQY E;  2LUQ A;  2JP9 A;  3BF2 A;  5A6B D;  2EQ0 A;  3J7Y p;  2EN6 A;  2HGH A;  1RQ0 A;  1YYK A;  4M0V A;  3JTZ A;  4F9A B;  2RS7 A;  2LUP B;  5CFF E;  4LTY A;  3OTO E;  4B3S E;  2YTO A;  4F9B B;  4WYQ B;  2WCC 3;  2N3H A;  5KL2 A;  4DV0 E;  1T4O A;  4MLQ A;  2RPC A;  4DV5 E;  1YSA C;  4JYA E;  2JVA A;  2H36 X;  1NEI A;  1QU6 A;  1FJG E;  2VRD A;  5BR8 E;  3T1Y E;  3C4B A;  4WXC A;  3IWD A;  4B3R E;  3P1X A;  1ZBQ A;  2MKD A;  2EPO A;  4X65 E;  1T4N A;  2YSP A;  5IV8 B;  2Q8U A;  2LTS A;  5AAS A;  2HJJ A;  1UIL A;  4DUZ E;  4RHB B;  1AH5 A;  2EJ4 A;  2EPP A;  2WZO A;  5IT9 C;  4GEQ B;  2E1M A;  1UHZ A;  2EZ6 A;  3VHT B;  1ZBT A;  1TF3 A;  2EOQ A;  2YRH A;  4ZYG A;  2JOX A;  1PJT A;  3QG5 C;  5KL6 A;  1X6H A;  4JI2 E;  2ENH A;  2RS6 A;  1UBD C;  4M9V C;  2UXB E;  4NXN E;  5AC4 A;  4LF6 E;  1EH8 A;  1T39 A;  2ODR C;  4L8N A;  4ZYD A;  4DR1 E;  2CTD A;  2VQE E;  2GPI A;  1TN9 A;  2VE7 C;  4FK5 C;  4WX9 A;  1N33 E;  2M7Q A;  2I9I A;  2MDR A;  2JYA A;  2EOR A;  1GZ6 A;  1PKP A;  2MC5 A;  3DJW A;  1X6F A;  4IJD A;  4R03 A;  4K0K E;  1G2F C;  4LFB E;  1X48 A;  1JK1 A;  2EMX A;  4O43 A;  2EP3 A;  1BBG A;  4JI8 E;  4DKK A;  1Z1B A;  4WSG A;  1G2D C;  4GZN C;  2FV4 B;  4DMI A;  2NA2 A;  4X62 E;  1RMD A;  4BC9 A;  1J26 A;  1YZ9 A;  2V89 A;  1N3G A;  2EM2 A;  2EN7 A;  2VF1 A;  4DR5 E;  2EWL A;  1P47 A;  2JWO A;  1X47 A;  2EM9 A;  3EPH A;  2YTQ A;  3H09 A;  2ODR D;  4BMJ A;  1F2I G;  1O0W A;  3MHH C; 
#chains in the Genus database with same CATH homology
 1T4O A;  3K6Q A;  5LMU E;  2M4I A;  2L92 A;  4DV5 E;  1N32 E;  4JYA E;  2F4V E;  4JI1 E;  2JVA A;  2H36 X;  1QU6 A;  3T1H E;  1FJG E;  3JU0 A;  5A2Q C;  4GKJ E;  2UUC E;  5BR8 E;  1HR0 E;  2B9D A;  4WPY A;  3C4B A;  3T1Y E;  3C4T A;  4R8O A;  4DV4 E;  3IWD A;  4B3R E;  2V88 A;  3P1X A;  2UXC E;  1ZBQ A;  2LBS B;  2ZM6 E;  1N36 E;  2B3T B;  3F6H A;  1XMO E;  2UU9 E;  4X8W A;  4KHP E;  3HQ1 A;  2G7H A;  5DNY A;  2L2M A;  2KHX A;  3MSW A;  4X65 E;  5F3W A;  1T4N A;  4M2Z A;  1YYW A;  4DR6 E;  4P78 A;  2LMZ A;  3VK6 A;  2VQF E;  2LTS A;  3AV0 A;  4LF5 E;  3IWC A;  4X66 E;  2V87 A;  5AAS A;  4JI5 E;  2LRS A;  5IWA E;  2KOU A;  4Q28 A;  3J7A G;  3ADJ A;  1SR9 A;  1DQ3 A;  1UIL A;  5AE1 A;  2LJH A;  4DUZ E;  2N3G A;  3RMP A;  1J5E E;  4JI3 E;  3J80 C;  2MC6 A;  1EKZ A;  2WZO A;  4LF7 E;  1DI2 A;  2L3C A;  5IT9 C;  4JI0 E;  4DV1 E;  4DV7 E;  3HTX A;  4GEQ B;  2E1M A;  3HXL A;  1UHZ A;  1YYO A;  2EZ6 A;  1ZBT A;  2DIX A;  3ADL A;  4B3M E;  2JOX A;  2L6M A;  2YT4 A;  1X49 A;  4F9C B;  2IHR 1;  3KWR A;  1STU A;  4B3T E;  4WSP A;  4GKK E;  2JR1 A;  4NXM E;  4JI2 E;  4I8O A;  2RS6 A;  2RSM A;  2V83 A;  4DV6 E;  4TUG A;  2UXB E;  2DB2 A;  4NXN E;  2L2N A;  2L8T A;  4LF6 E;  5LL6 R;  4LFA E;  2UXD E;  2ODR C;  4DR2 E;  1WHQ A;  3VYX A;  4M30 A;  1GQE A;  4L8N A;  2HHH E;  3F6G A;  4J8Z A;  4YHH E;  5ADZ A;  1RC7 A;  2L3J A;  4DR1 E;  2JY9 A;  5AE3 A;  2V86 A;  1IBL E;  2L33 A;  1I94 E;  2UUA E;  4DUY E;  4F54 A;  2B7V A;  4BCA A;  3JAM C;  2B7T A;  2V8Q B;  2VQE E;  4DV3 E;  3HPZ A;  4L5N C;  4DV2 E;  3ADI A;  2LE2 A;  1N34 E;  2VE7 C;  2K4V A;  1IBK E;  1N33 E;  3ADG A;  1HNW E;  2M7Q A;  1WXR A;  2MDR A;  4JV5 E;  2E5L E;  4DR3 E;  2F8B A;  1GZ6 A;  4KZS A;  1PKP A;  2MC5 A;  3DJW A;  2LTR A;  4LF4 E;  4WFT A;  4R03 A;  1T4L B;  4JI4 E;  3LML A;  2NUE A;  1XNR E;  2M1S A;  4K0K E;  1X48 A;  4LFB E;  2DSY A;  3IWB A;  2YZT A;  2FGG A;  1FKA E;  2UUB E;  2DMY A;  1WHN A;  4JI8 E;  2JOB A;  3ZOQ B;  4DKK A;  2KON A;  2L2K B;  2NUF A;  3DF6 A;  4DR7 E;  3J81 C;  2FV4 B;  2V85 A;  4BBY A;  4OOG C;  1HNX E;  4LF8 E;  4LFC E;  5AE2 A;  5T6J A;  4BS9 A;  4DMI A;  3AUZ A;  2NA2 A;  2LUQ A;  4BMJ A;  5LMN E;  3VYY A;  2CPN A;  4AQY E;  1HNZ E;  4X62 E;  1IBM E;  4BC7 A;  5FLX C;  1XMQ E;  4X64 E;  4JI6 E;  4LF9 E;  4OX9 E;  2NUG A;  4LU9 A;  4BC9 A;  1J26 A;  4YY3 E;  3J7Y p;  1YYK A;  1RQ0 A;  4M0V A;  2V89 A;  3JTZ A;  4F9A B;  2RS7 A;  3OML A;  2LUP B;  5CFF E;  1YZ9 A;  4LTY A;  2VF1 A;  3OTO E;  4DV0 E;  4B3S E;  2FTX B;  4TUI A;  4DR5 E;  2EWL A;  3FIG A;  4F9B B;  2JWO A;  4P7D A;  4WYQ B;  1X47 A;  2N3H A;  3HPS A;  4DR4 E;  4JI7 E;  3H09 A;  2RTX A;  2ODR D;  1XNQ E;  3LLH A;  1O0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...