1T4NA

Solution structure of rnt1p dsrbd
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
88
structure length
88
Chain Sequence
MDKLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Ribonuclease III
publication title A new alpha-helical extension promotes RNA binding by the dsRBD of Rnt1p RNAse III
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 17
structure length 88
sequence length 88
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2004-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1t4nA00
5CFFE 1X47A 4X65E 4JI4E 2JY9A 4X66E 2EZ6A 2VQEE 1J26A 2DIXA 3T1HE 2LUQA 4KHPE 4X64E 1DI2A 2ZM6E 5IWAE 2LTRA 4YHHE 3T1YE 4JV5E 4DR5E 4DUZE 4M30A 5LMNE 4LFCE 4X8WA 4B3SE 4GKJE 2VQFE 1XMOE 3HTXA 2L2MA 4DKKA 2UXCE 3P1XA 3J7Yp 4JI8E 2UUCE 5BR8E 4JI7E 4YY3E 2RS7A 4NXME 4DR4E 4B3RE 4WFTA 1UHZA 1UILA 3LLHA 1IBKE 4DV3E 4DR3E 2UU9E 2LBSB 4LF8E 4GKKE 1IBME 2KHXA 2UUAE 1XNRE 4NXNE 4LFBE 4DV2E 2RTXA 4DR2E 2B7VA 2LTSA 2LRSA 1XNQE 4JI0E 1HNXE 4LF6E 2L3CA 1YYKA 2B7TA 2B3TB 2HHHE 4OOGC 2UUBE 4X62E 2LUPB 2L2KB 2NA2A 4DV4E 2LJHA 4LF7E 2F4VE 4DV5E 1N34E 1HR0E 4JYAE 3OTOE 2L3JA 1EKZA 2E5LE 1N33E 2N3GA 4JI3E 3ADLA 2CPNA 4DV1E 2DB2A 1FJGE 2DMYA 2NUFA 3ADJA 1O0WA 4DR6E 3VYYA 4DUYE 3ADGA 1HNZE 3C4TA 4JI2E 1FKAE 1STUA 1YYWA 2NUGA 2UXDE 4LFAE 1PKPA 4B3TE 2N3HA 1RC7A 2NUEA 4LF5E 1QU6A 1ZBTA 3ADIA 4AQYE 4DV0E 1T4OA 2L2NA 1I94E 4M2ZA 4OX9E 2L33A 3C4BA 1T4LB 1N32E 2JVAA 4K0KE 1T4NA 4B3ME 1X49A 4DV7E 1J5EE 4JI6E 2IHR1 1RQ0A 1X48A 1XMQE 4DV6E 1IBLE 4LF9E 2MDRA 4DR1E 1GQEA 4JI5E 1WHNA 4LF4E 1N36E 4DR7E 4JI1E 2RS6A 1WHQA 2RSMA 4WYQB 1YZ9A 2UXBE 2YT4A 5LMUE 1YYOA 1HNWE 3VYXA
chains in the Genus database with same CATH superfamily
2JR1A 2B9DA 5CFFE 2DLQA 2YTJA 2EQ3A 1UN6B 1G2DC 2VQEE 2WBSA 1BBOA 3T1HE 2LUQA 4R2DA 1A1KA 1A1JA 1ZR9A 5IWAE 2D9HA 2EPXA 4DR5E 1MGTA 2L6MA 2EMBA 4LFCE 2EOHA 4GKJE 2YTFA 2YSOA 5A6BD 2H36X 1XMOE 1ZAAC 2L2MA 1WJPA 2EOEA 4O43A 3VHTB 2EPLX 4WFTA 1AH5A 1X5WA 2YRMA 4WXDA 5A6KA 2LBSB 4GKKE 3VK6A 2UUAE 1PJSA 2M7QA 4F2JC 4DV2E 4IS1C 2EMLA 1QNTA 1JK2A 2EPCA 3LMLA 5IV8B 1SFEA 2N8XA 1HNXE 1IQOA 5AE3A 3BGHA 2B7TA 2EN4A 3HPSA 4P7DA 2UUBE 4RHBB 4DV4E 2LJHA 4LF7E 3IWDA 2EOSA 2VRDA 1HR0E 3EPJA 2E5LE 4F6MA 3ADLA 4R2PA 4NHRA 2EPUA 1X6EA 4MLVA 4DR6E 2M1SA 4DUYE 3C4TA 2JPAA 3C6MA 2YU5A 4LFAE 2YTDA 1A1FA 4B3TE 2HGHA 3TQMA 2LE2A 4ZYDA 1IQSA 4DV0E 2L2NA 4M2ZA 4KZSA 3EPKA 4M9VC 4J8ZA 2E72A 1LLMC 2EOZA 4ZYHA 2EOFA 2GPIA 2ENHA 2M9AA 4LF9E 3KWRA 4DR1E 4RH8A 2EP3A 2ODRD 2EL6A 1WHNA 4LF4E 2ELYA 4O4KA 2EPZA 2RS6A 4NZVA 2EWLA 2KOUA 2LJUA 3VYXA 1WRJA 2J7JA 4DMIA 3AUZA 1YUJA 4BS9A 2JOBA 2YTOA 1J26A 2DIXA 4BMJA 3ECRA 4F9AB 1DI2A 3EPLA 1N3GA 5IT9C 1A1LA 3JTZA 3T1YE 4JV5E 2EMWA 1RMDA 1PDAA 4M30A 5AE2A 3J80C 2EM0A 5A2QC 2UXCE 2F8BA 4ZYEA 4JI8E 4JI7E 2RS7A 1YFHA 4NXME 4B3RE 1UHZA 1BBGA 2EMAA 3LLHA 2CSHA 3MSWA 2EM8A 2FGGA 4DV3E 4DR3E 4F9BB 2UU9E 1A1GA 4LF8E 1IBME 2KHXA 4NXNE 4LFBE 1X6FA 4DR2E 4R2SA 2L3CA 1YYKA 2E1MA 4OOGC 2EN8A 2EM3A 4HTGA 2LVHA 2NA2A 1GZ6A 2EQ0A 2YSPA 2LT7A 2F4VE 2R1FA 5AASA 4DV5E 4JYAE 2EN3A 2RSIA 1N33E 4JI3E 2CPNA 1YUIA 2DMYA 2NUFA 3ADJA 2I9IA 2EE8A 3OMLA 2YTGA 4L8NA 4MLQA 2MC6A 3M99B 2L92A 2YZTA 1FKAE 2V83A 2YRKA 2EL4A 2V88A 3K6QA 1ZU1A 2YTPA 1PKPA 2ENCA 2EORA 2CTDA 1ZBTA 3ADIA 4BBYA 1T4OA 1I94E 3F6GA 3C4BA 5IXMB 1T4NA 2EM4A 4B3ME 4O5GA 4JI6E 2IHR1 5LLQA 3HPZA 2HJJA 2K7IA 2VF1A 2MC5A 1GQEA 2EPPA 5ADZA 2EMFA 2EMYA 1P47A 4FK5C 2PRTA 4WXCA 2RSMA 2EPNA 3EPHA 2RPCA 2Q8UA 2DGCA 2MKDA 1EH7A 1KYQA 3H09A 1X47A 2EM9A 5KL4A 4ZYGA 2EOMA 5A6AA 5AC4A 2JY9A 5T6JA 4BCAA 4X66E 2EPMX 2EOIA 1YSAC 4KHPE 4R2CA 2WCC3 5KL3A 2EPOA 2KONA 2YRHA 5LMNE 4X8WA 3J81C 2JWOA 4KWYA 4O24A 4WSGA 3HTXA 2K4VA 2EMKA 3P1XA 4Q35B 1PJTA 3KZZA 3UK3C 1ZBQA 4YY3E 4DR4E 4Q28A 2EMHA 2V8QB 5KL6A 3QG5C 5F3WA 3L00A 1AAYA 4P78A 2GHFA 2LMZA 1F2IG 2EN6A 4GEQB 2V87A 1XNRE 2FV4B 4WX9A 2RTXA 4R2QA 2ADRA 2B7VA 2LTSA 1WXRA 1XNQE 5LL6R 2B3TB 2EOXA 2HHHE 2ODRC 4X62E 2L2KB 2LUPB 2EN2A 2YTNA 1L4SA 5KL5A 2V86A 2WBTA 2YTIA 3OTOE 1JK1A 1EKZA 5A6JA 2R76A 4WSPA 3KZYA 1A1IA 2JYAA 4L5NC 3ADGA 3DJWA 4JI2E 2UXDE 1STUA 2DLKA 2EPKX 4HEIA 4I8OA 5FLXC 2EM6A 2EOQA 4LF5E 3HQ1A 1X3CA 2JP9A 1IMUA 3FIGA 3JU0A 2L33A 1T4LB 4X9JA 2JVAA 4BHBA 1TF3A 2VE7C 2YTQA 1X49A 4DV7E 1J5EE 1G2FC 1RQ0A 4M0VA 2BBGA 3MHSC 1IBLE 1T39A 4R03A 2YTEA 2MDGA 4JI5E 1B69A 3BIDA 3J7AG 2RQLA 4JI1E 1PJQA 4WYQB 2UXBE 2YT4A 2V89A 1YYOA 1HNWE 2WBUA 5TSEA 2A25A 2JOXA 2YPNA 4X65E 4TUIA 4JI4E 4BHCA 2EZ6A 3C6KA 2LO3A 4R2RA 4LU9A 1YPNA 4N4RB 1DQ3A 4F6NA 4X64E 2EMZA 1KJKA 2ZM6E 2EOYA 2EMGA 2LTRA 4YHHE 2YWQA 4F9CB 1NCSA 2YU8A 4DUZE 3HXLA 2EL5A 4B3SE 1DGCA 2EM5A 4WPYA 2VQFE 2FTXB 1Z1BA 4DKKA 1SR9A 3J7Yp 2DMIA 2UUCE 5BR8E 3EQ1A 4BC7A 1NEIA 1UILA 3BBGA 3AV0A 1IBKE 3F6HA 2LV2A 2ENAA 2MKNA 2I13A 2EMCA 2EPRA 3MHHC 2EN7A 1GTKA 1EH6A 2LRSA 4JI0E 3ZOQB 4LF6E 2V85A 1X6HA 5AE1A 5DNYA 1MEYC 2EOJA 2ELZA 1T38A 2WZOA 2EJ4A 4F54A 4GZNC 2JXPA 5A6BA 1N34E 2EN1A 3DF6A 1TF6A 2L3JA 2M4IA 1BB8A 2EM2A 2EQ1A 2LCEA 2N3GA 4DV1E 2DB2A 1FJGE 2CT1A 1O0WA 3VYYA 1HNZE 2L8TA 1YYWA 2NUGA 1TN9A 2EMIA 1EH8A 2N3HA 1RC7A 4R8OA 2NUEA 1QU6A 4IJDA 4AQYE 2EM7A 5AC5A 3THOB 4LTYA 2EPAA 2NABA 4OX9E 2GLIA 1N32E 4R2EA 5KL7A 4BC9A 2HC5A 3JAMC 2EOOA 4K0KE 3BF2A 1X48A 2DSYA 5KL2A 1XMQE 4TUGA 4DV6E 2MDRA 3IWBA 2EMXA 3IWCA 5A69A 4R2AA 1N36E 1UBDC 4DR7E 3RMPA 1A1HA 2G7HA 2DRPA 3THNA 2BB8A 1WHQA 1YZ9A 5LMUE
chains in the Genus database with same CATH topology
2JR1A 2B9DA 5CFFE 3H09A 1X47A 2JOXA 4DMIA 3AUZA 4X65E 4TUIA 4JI4E 4BS9A 2JY9A 2JOBA 5T6JA 4BCAA 4X66E 2EZ6A 2VQEE 1J26A 2DIXA 4LU9A 4BMJA 3T1HE 2LUQA 1DQ3A 4KHPE 4F9AB 4X64E 1DI2A 2ZM6E 5IWAE 2LTRA 5IT9C 2KONA 3JTZA 4YHHE 3T1YE 4JV5E 4F9CB 4DR5E 2L6MA 4DUZE 4M30A 3HXLA 5LMNE 4LFCE 4X8WA 4B3SE 5AE2A 3J81C 2JWOA 4WPYA 4GKJE 2VQFE 2FTXB 3J80C 2H36X 1XMOE 2K4VA 3HTXA 5A2QC 2L2MA 4DKKA 2UXCE 3P1XA 1SR9A 2F8BA 3J7Yp 4JI8E 2UUCE 5BR8E 4JI7E 1ZBQA 4YY3E 2RS7A 4NXME 4DR4E 4BC7A 4Q28A 4B3RE 4WFTA 1UHZA 2V8QB 1UILA 3AV0A 3LLHA 3F6HA 1IBKE 3MSWA 5F3WA 2FGGA 4P78A 2LMZA 4DV3E 4F9BB 4DR3E 4GEQB 2LBSB 2UU9E 4LF8E 2V87A 1IBME 4GKKE 2KHXA 3VK6A 2UUAE 2FV4B 4NXNE 1XNRE 4LFBE 2M7QA 4DV2E 2RTXA 4DR2E 2B7VA 1WXRA 2LTSA 3LMLA 2LRSA 1XNQE 4JI0E 3ZOQB 1HNXE 4LF6E 5LL6R 2V85A 5AE3A 2L3CA 5AE1A 2B7TA 1YYKA 5DNYA 2E1MA 3HPSA 2B3TB 2HHHE 4OOGC 4P7DA 2UUBE 2ODRC 2WZOA 4X62E 2L2KB 2NA2A 2LUPB 4DV4E 1GZ6A 2LJHA 4F54A 4LF7E 3IWDA 2F4VE 5AASA 4DV5E 2V86A 1N34E 1HR0E 4JYAE 3DF6A 3OTOE 2L3JA 2M4IA 1EKZA 2E5LE 1N33E 2N3GA 4JI3E 3ADLA 2CPNA 4DV1E 2DB2A 4WSPA 1FJGE 2DMYA 2NUFA 3ADJA 3OMLA 1O0WA 4L5NC 4DR6E 2M1SA 4L8NA 3VYYA 4DUYE 2MC6A 3ADGA 3DJWA 2L8TA 2L92A 3C4TA 1HNZE 2YZTA 1FKAE 1STUA 4JI2E 1YYWA 2NUGA 2V83A 4LFAE 2UXDE 4I8OA 2V88A 3K6QA 5FLXC 1PKPA 4B3TE 2N3HA 1RC7A 4R8OA 4LF5E 1QU6A 2LE2A 3HQ1A 2NUEA 1ZBTA 3ADIA 4BBYA 4AQYE 4LTYA 4DV0E 1T4OA 2L2NA 1I94E 4M2ZA 4OX9E 4KZSA 3F6GA 3FIGA 3JU0A 2L33A 3C4BA 1T4LB 1N32E 4BC9A 4J8ZA 3JAMC 2JVAA 4K0KE 1T4NA 4B3ME 2VE7C 1X49A 4DV7E 1J5EE 4JI6E 2IHR1 1RQ0A 1X48A 2DSYA 4M0VA 1XMQE 4TUGA 3HPZA 4DV6E 1IBLE 4LF9E 2VF1A 4R03A 2MC5A 3KWRA 2MDRA 3IWBA 4DR1E 1GQEA 2ODRD 4JI5E 1WHNA 4LF4E 5ADZA 3IWCA 1N36E 4DR7E 3RMPA 3J7AG 4JI1E 2G7HA 2RS6A 2EWLA 2KOUA 1WHQA 2RSMA 4WYQB 1YZ9A 2UXBE 2YT4A 5LMUE 2V89A 1YYOA 1HNWE 3VYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CFF E;  1X47 A;  4X65 E;  4JI4 E;  2JY9 A;  4X66 E;  2EZ6 A;  2VQE E;  1J26 A;  2DIX A;  3T1H E;  2LUQ A;  4KHP E;  4X64 E;  1DI2 A;  2ZM6 E;  5IWA E;  2LTR A;  4YHH E;  3T1Y E;  4JV5 E;  4DR5 E;  4DUZ E;  4M30 A;  5LMN E;  4LFC E;  4X8W A;  4B3S E;  4GKJ E;  2VQF E;  1XMO E;  3HTX A;  2L2M A;  4DKK A;  2UXC E;  3P1X A;  3J7Y p;  4JI8 E;  2UUC E;  5BR8 E;  4JI7 E;  4YY3 E;  2RS7 A;  4NXM E;  4DR4 E;  4B3R E;  4WFT A;  1UHZ A;  1UIL A;  3LLH A;  1IBK E;  4DV3 E;  4DR3 E;  2UU9 E;  2LBS B;  4LF8 E;  4GKK E;  1IBM E;  2KHX A;  2UUA E;  1XNR E;  4NXN E;  4LFB E;  4DV2 E;  2RTX A;  4DR2 E;  2B7V A;  2LTS A;  2LRS A;  1XNQ E;  4JI0 E;  1HNX E;  4LF6 E;  2L3C A;  1YYK A;  2B7T A;  2B3T B;  2HHH E;  4OOG C;  2UUB E;  4X62 E;  2LUP B;  2L2K B;  2NA2 A;  4DV4 E;  2LJH A;  4LF7 E;  2F4V E;  4DV5 E;  1N34 E;  1HR0 E;  4JYA E;  3OTO E;  2L3J A;  1EKZ A;  2E5L E;  1N33 E;  2N3G A;  4JI3 E;  3ADL A;  2CPN A;  4DV1 E;  2DB2 A;  1FJG E;  2DMY A;  2NUF A;  3ADJ A;  1O0W A;  4DR6 E;  3VYY A;  4DUY E;  3ADG A;  1HNZ E;  3C4T A;  4JI2 E;  1FKA E;  1STU A;  1YYW A;  2NUG A;  2UXD E;  4LFA E;  1PKP A;  4B3T E;  2N3H A;  1RC7 A;  2NUE A;  4LF5 E;  1QU6 A;  1ZBT A;  3ADI A;  4AQY E;  4DV0 E;  1T4O A;  2L2N A;  1I94 E;  4M2Z A;  4OX9 E;  2L33 A;  3C4B A;  1T4L B;  1N32 E;  2JVA A;  4K0K E;  1T4N A;  4B3M E;  1X49 A;  4DV7 E;  1J5E E;  4JI6 E;  2IHR 1;  1RQ0 A;  1X48 A;  1XMQ E;  4DV6 E;  1IBL E;  4LF9 E;  2MDR A;  4DR1 E;  1GQE A;  4JI5 E;  1WHN A;  4LF4 E;  1N36 E;  4DR7 E;  4JI1 E;  2RS6 A;  1WHQ A;  2RSM A;  4WYQ B;  1YZ9 A;  2UXB E;  2YT4 A;  5LMU E;  1YYO A;  1HNW E;  3VYX A; 
#chains in the Genus database with same CATH topology
 2JR1 A;  2B9D A;  5CFF E;  2DLQ A;  2YTJ A;  2EQ3 A;  1UN6 B;  1G2D C;  2VQE E;  2WBS A;  1BBO A;  3T1H E;  2LUQ A;  4R2D A;  1A1K A;  1A1J A;  1ZR9 A;  5IWA E;  2D9H A;  2EPX A;  4DR5 E;  1MGT A;  2L6M A;  2EMB A;  4LFC E;  2EOH A;  4GKJ E;  2YTF A;  2YSO A;  5A6B D;  2H36 X;  1XMO E;  1ZAA C;  2L2M A;  1WJP A;  2EOE A;  4O43 A;  3VHT B;  2EPL X;  4WFT A;  1AH5 A;  1X5W A;  2YRM A;  4WXD A;  5A6K A;  2LBS B;  4GKK E;  3VK6 A;  2UUA E;  1PJS A;  2M7Q A;  4F2J C;  4DV2 E;  4IS1 C;  2EML A;  1QNT A;  1JK2 A;  2EPC A;  3LML A;  5IV8 B;  1SFE A;  2N8X A;  1HNX E;  1IQO A;  5AE3 A;  3BGH A;  2B7T A;  2EN4 A;  3HPS A;  4P7D A;  2UUB E;  4RHB B;  4DV4 E;  2LJH A;  4LF7 E;  3IWD A;  2EOS A;  2VRD A;  1HR0 E;  3EPJ A;  2E5L E;  4F6M A;  3ADL A;  4R2P A;  4NHR A;  2EPU A;  1X6E A;  4MLV A;  4DR6 E;  2M1S A;  4DUY E;  3C4T A;  2JPA A;  3C6M A;  2YU5 A;  4LFA E;  2YTD A;  1A1F A;  4B3T E;  2HGH A;  3TQM A;  2LE2 A;  4ZYD A;  1IQS A;  4DV0 E;  2L2N A;  4M2Z A;  4KZS A;  3EPK A;  4M9V C;  4J8Z A;  2E72 A;  1LLM C;  2EOZ A;  4ZYH A;  2EOF A;  2GPI A;  2ENH A;  2M9A A;  4LF9 E;  3KWR A;  4DR1 E;  4RH8 A;  2EP3 A;  2ODR D;  2EL6 A;  1WHN A;  4LF4 E;  2ELY A;  4O4K A;  2EPZ A;  2RS6 A;  4NZV A;  2EWL A;  2KOU A;  2LJU A;  3VYX A;  1WRJ A;  2J7J A;  4DMI A;  3AUZ A;  1YUJ A;  4BS9 A;  2JOB A;  2YTO A;  1J26 A;  2DIX A;  4BMJ A;  3ECR A;  4F9A B;  1DI2 A;  3EPL A;  1N3G A;  5IT9 C;  1A1L A;  3JTZ A;  3T1Y E;  4JV5 E;  2EMW A;  1RMD A;  1PDA A;  4M30 A;  5AE2 A;  3J80 C;  2EM0 A;  5A2Q C;  2UXC E;  2F8B A;  4ZYE A;  4JI8 E;  4JI7 E;  2RS7 A;  1YFH A;  4NXM E;  4B3R E;  1UHZ A;  1BBG A;  2EMA A;  3LLH A;  2CSH A;  3MSW A;  2EM8 A;  2FGG A;  4DV3 E;  4DR3 E;  4F9B B;  2UU9 E;  1A1G A;  4LF8 E;  1IBM E;  2KHX A;  4NXN E;  4LFB E;  1X6F A;  4DR2 E;  4R2S A;  2L3C A;  1YYK A;  2E1M A;  4OOG C;  2EN8 A;  2EM3 A;  4HTG A;  2LVH A;  2NA2 A;  1GZ6 A;  2EQ0 A;  2YSP A;  2LT7 A;  2F4V E;  2R1F A;  5AAS A;  4DV5 E;  4JYA E;  2EN3 A;  2RSI A;  1N33 E;  4JI3 E;  2CPN A;  1YUI A;  2DMY A;  2NUF A;  3ADJ A;  2I9I A;  2EE8 A;  3OML A;  2YTG A;  4L8N A;  4MLQ A;  2MC6 A;  3M99 B;  2L92 A;  2YZT A;  1FKA E;  2V83 A;  2YRK A;  2EL4 A;  2V88 A;  3K6Q A;  1ZU1 A;  2YTP A;  1PKP A;  2ENC A;  2EOR A;  2CTD A;  1ZBT A;  3ADI A;  4BBY A;  1T4O A;  1I94 E;  3F6G A;  3C4B A;  5IXM B;  1T4N A;  2EM4 A;  4B3M E;  4O5G A;  4JI6 E;  2IHR 1;  5LLQ A;  3HPZ A;  2HJJ A;  2K7I A;  2VF1 A;  2MC5 A;  1GQE A;  2EPP A;  5ADZ A;  2EMF A;  2EMY A;  1P47 A;  4FK5 C;  2PRT A;  4WXC A;  2RSM A;  2EPN A;  3EPH A;  2RPC A;  2Q8U A;  2DGC A;  2MKD A;  1EH7 A;  1KYQ A;  3H09 A;  1X47 A;  2EM9 A;  5KL4 A;  4ZYG A;  2EOM A;  5A6A A;  5AC4 A;  2JY9 A;  5T6J A;  4BCA A;  4X66 E;  2EPM X;  2EOI A;  1YSA C;  4KHP E;  4R2C A;  2WCC 3;  5KL3 A;  2EPO A;  2KON A;  2YRH A;  5LMN E;  4X8W A;  3J81 C;  2JWO A;  4KWY A;  4O24 A;  4WSG A;  3HTX A;  2K4V A;  2EMK A;  3P1X A;  4Q35 B;  1PJT A;  3KZZ A;  3UK3 C;  1ZBQ A;  4YY3 E;  4DR4 E;  4Q28 A;  2EMH A;  2V8Q B;  5KL6 A;  3QG5 C;  5F3W A;  3L00 A;  1AAY A;  4P78 A;  2GHF A;  2LMZ A;  1F2I G;  2EN6 A;  4GEQ B;  2V87 A;  1XNR E;  2FV4 B;  4WX9 A;  2RTX A;  4R2Q A;  2ADR A;  2B7V A;  2LTS A;  1WXR A;  1XNQ E;  5LL6 R;  2B3T B;  2EOX A;  2HHH E;  2ODR C;  4X62 E;  2L2K B;  2LUP B;  2EN2 A;  2YTN A;  1L4S A;  5KL5 A;  2V86 A;  2WBT A;  2YTI A;  3OTO E;  1JK1 A;  1EKZ A;  5A6J A;  2R76 A;  4WSP A;  3KZY A;  1A1I A;  2JYA A;  4L5N C;  3ADG A;  3DJW A;  4JI2 E;  2UXD E;  1STU A;  2DLK A;  2EPK X;  4HEI A;  4I8O A;  5FLX C;  2EM6 A;  2EOQ A;  4LF5 E;  3HQ1 A;  1X3C A;  2JP9 A;  1IMU A;  3FIG A;  3JU0 A;  2L33 A;  1T4L B;  4X9J A;  2JVA A;  4BHB A;  1TF3 A;  2VE7 C;  2YTQ A;  1X49 A;  4DV7 E;  1J5E E;  1G2F C;  1RQ0 A;  4M0V A;  2BBG A;  3MHS C;  1IBL E;  1T39 A;  4R03 A;  2YTE A;  2MDG A;  4JI5 E;  1B69 A;  3BID A;  3J7A G;  2RQL A;  4JI1 E;  1PJQ A;  4WYQ B;  2UXB E;  2YT4 A;  2V89 A;  1YYO A;  1HNW E;  2WBU A;  5TSE A;  2A25 A;  2JOX A;  2YPN A;  4X65 E;  4TUI A;  4JI4 E;  4BHC A;  2EZ6 A;  3C6K A;  2LO3 A;  4R2R A;  4LU9 A;  1YPN A;  4N4R B;  1DQ3 A;  4F6N A;  4X64 E;  2EMZ A;  1KJK A;  2ZM6 E;  2EOY A;  2EMG A;  2LTR A;  4YHH E;  2YWQ A;  4F9C B;  1NCS A;  2YU8 A;  4DUZ E;  3HXL A;  2EL5 A;  4B3S E;  1DGC A;  2EM5 A;  4WPY A;  2VQF E;  2FTX B;  1Z1B A;  4DKK A;  1SR9 A;  3J7Y p;  2DMI A;  2UUC E;  5BR8 E;  3EQ1 A;  4BC7 A;  1NEI A;  1UIL A;  3BBG A;  3AV0 A;  1IBK E;  3F6H A;  2LV2 A;  2ENA A;  2MKN A;  2I13 A;  2EMC A;  2EPR A;  3MHH C;  2EN7 A;  1GTK A;  1EH6 A;  2LRS A;  4JI0 E;  3ZOQ B;  4LF6 E;  2V85 A;  1X6H A;  5AE1 A;  5DNY A;  1MEY C;  2EOJ A;  2ELZ A;  1T38 A;  2WZO A;  2EJ4 A;  4F54 A;  4GZN C;  2JXP A;  5A6B A;  1N34 E;  2EN1 A;  3DF6 A;  1TF6 A;  2L3J A;  2M4I A;  1BB8 A;  2EM2 A;  2EQ1 A;  2LCE A;  2N3G A;  4DV1 E;  2DB2 A;  1FJG E;  2CT1 A;  1O0W A;  3VYY A;  1HNZ E;  2L8T A;  1YYW A;  2NUG A;  1TN9 A;  2EMI A;  1EH8 A;  2N3H A;  1RC7 A;  4R8O A;  2NUE A;  1QU6 A;  4IJD A;  4AQY E;  2EM7 A;  5AC5 A;  3THO B;  4LTY A;  2EPA A;  2NAB A;  4OX9 E;  2GLI A;  1N32 E;  4R2E A;  5KL7 A;  4BC9 A;  2HC5 A;  3JAM C;  2EOO A;  4K0K E;  3BF2 A;  1X48 A;  2DSY A;  5KL2 A;  1XMQ E;  4TUG A;  4DV6 E;  2MDR A;  3IWB A;  2EMX A;  3IWC A;  5A69 A;  4R2A A;  1N36 E;  1UBD C;  4DR7 E;  3RMP A;  1A1H A;  2G7H A;  2DRP A;  3THN A;  2BB8 A;  1WHQ A;  1YZ9 A;  5LMU E; 
#chains in the Genus database with same CATH homology
 2JR1 A;  2B9D A;  5CFF E;  3H09 A;  1X47 A;  2JOX A;  4DMI A;  3AUZ A;  4X65 E;  4TUI A;  4JI4 E;  4BS9 A;  2JY9 A;  2JOB A;  5T6J A;  4BCA A;  4X66 E;  2EZ6 A;  2VQE E;  1J26 A;  2DIX A;  4LU9 A;  4BMJ A;  3T1H E;  2LUQ A;  1DQ3 A;  4KHP E;  4F9A B;  4X64 E;  1DI2 A;  2ZM6 E;  5IWA E;  2LTR A;  5IT9 C;  2KON A;  3JTZ A;  4YHH E;  3T1Y E;  4JV5 E;  4F9C B;  4DR5 E;  2L6M A;  4DUZ E;  4M30 A;  3HXL A;  5LMN E;  4LFC E;  4X8W A;  4B3S E;  5AE2 A;  3J81 C;  2JWO A;  4WPY A;  4GKJ E;  2VQF E;  2FTX B;  3J80 C;  2H36 X;  1XMO E;  2K4V A;  3HTX A;  5A2Q C;  2L2M A;  4DKK A;  2UXC E;  3P1X A;  1SR9 A;  2F8B A;  3J7Y p;  4JI8 E;  2UUC E;  5BR8 E;  4JI7 E;  1ZBQ A;  4YY3 E;  2RS7 A;  4NXM E;  4DR4 E;  4BC7 A;  4Q28 A;  4B3R E;  4WFT A;  1UHZ A;  2V8Q B;  1UIL A;  3AV0 A;  3LLH A;  3F6H A;  1IBK E;  3MSW A;  5F3W A;  2FGG A;  4P78 A;  2LMZ A;  4DV3 E;  4F9B B;  4DR3 E;  4GEQ B;  2LBS B;  2UU9 E;  4LF8 E;  2V87 A;  1IBM E;  4GKK E;  2KHX A;  3VK6 A;  2UUA E;  2FV4 B;  4NXN E;  1XNR E;  4LFB E;  2M7Q A;  4DV2 E;  2RTX A;  4DR2 E;  2B7V A;  1WXR A;  2LTS A;  3LML A;  2LRS A;  1XNQ E;  4JI0 E;  3ZOQ B;  1HNX E;  4LF6 E;  5LL6 R;  2V85 A;  5AE3 A;  2L3C A;  5AE1 A;  2B7T A;  1YYK A;  5DNY A;  2E1M A;  3HPS A;  2B3T B;  2HHH E;  4OOG C;  4P7D A;  2UUB E;  2ODR C;  2WZO A;  4X62 E;  2L2K B;  2NA2 A;  2LUP B;  4DV4 E;  1GZ6 A;  2LJH A;  4F54 A;  4LF7 E;  3IWD A;  2F4V E;  5AAS A;  4DV5 E;  2V86 A;  1N34 E;  1HR0 E;  4JYA E;  3DF6 A;  3OTO E;  2L3J A;  2M4I A;  1EKZ A;  2E5L E;  1N33 E;  2N3G A;  4JI3 E;  3ADL A;  2CPN A;  4DV1 E;  2DB2 A;  4WSP A;  1FJG E;  2DMY A;  2NUF A;  3ADJ A;  3OML A;  1O0W A;  4L5N C;  4DR6 E;  2M1S A;  4L8N A;  3VYY A;  4DUY E;  2MC6 A;  3ADG A;  3DJW A;  2L8T A;  2L92 A;  3C4T A;  1HNZ E;  2YZT A;  1FKA E;  1STU A;  4JI2 E;  1YYW A;  2NUG A;  2V83 A;  4LFA E;  2UXD E;  4I8O A;  2V88 A;  3K6Q A;  5FLX C;  1PKP A;  4B3T E;  2N3H A;  1RC7 A;  4R8O A;  4LF5 E;  1QU6 A;  2LE2 A;  3HQ1 A;  2NUE A;  1ZBT A;  3ADI A;  4BBY A;  4AQY E;  4LTY A;  4DV0 E;  1T4O A;  2L2N A;  1I94 E;  4M2Z A;  4OX9 E;  4KZS A;  3F6G A;  3FIG A;  3JU0 A;  2L33 A;  3C4B A;  1T4L B;  1N32 E;  4BC9 A;  4J8Z A;  3JAM C;  2JVA A;  4K0K E;  1T4N A;  4B3M E;  2VE7 C;  1X49 A;  4DV7 E;  1J5E E;  4JI6 E;  2IHR 1;  1RQ0 A;  1X48 A;  2DSY A;  4M0V A;  1XMQ E;  4TUG A;  3HPZ A;  4DV6 E;  1IBL E;  4LF9 E;  2VF1 A;  4R03 A;  2MC5 A;  3KWR A;  2MDR A;  3IWB A;  4DR1 E;  1GQE A;  2ODR D;  4JI5 E;  1WHN A;  4LF4 E;  5ADZ A;  3IWC A;  1N36 E;  4DR7 E;  3RMP A;  3J7A G;  4JI1 E;  2G7H A;  2RS6 A;  2EWL A;  2KOU A;  1WHQ A;  2RSM A;  4WYQ B;  1YZ9 A;  2UXB E;  2YT4 A;  5LMU E;  2V89 A;  1YYO A;  1HNW E;  3VYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...