2N3GA

Solution structure of drb4 dsrbd1 (viz. drb4(1-72))
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
72
structure length
72
Chain Sequence
MDHVYKGQLQAYALQHNLELPVYANEREGPPHAPRFRCNVTFCGQTFQSSEFFPTLKSAEHAAAKIAVASLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Double-stranded RNA-binding protein 4
publication title DRB4 dsRBD1 drives dsRNA recognition in Arabidopsis thaliana tasi/siRNA pathway.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Rna binding protein
total genus 14
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2n3gA00
2B7VA 4X8WA 4NXME 4DR5E 3LLHA 1N36E 4DUYE 1GQEA 1PKPA 4YHHE 2L2MA 3C4TA 4YY3E 1X48A 5LMNE 2MDRA 4DR3E 4JI2E 2NA2A 4B3SE 2UU9E 2LTSA 2VQFE 4DV0E 1HNWE 4M2ZA 2L2NA 2LJHA 4DV1E 4WYQB 1RQ0A 1O0WA 4DV4E 1IBKE 5IWAE 1XNRE 1ZBTA 2RS7A 2L3CA 4DR1E 2LBSB 2LRSA 1YYOA 1N32E 2VQEE 2F4VE 3ADGA 4JI8E 2RSMA 1X49A 1WHQA 3T1YE 4JI4E 4LF8E 4LFAE 2E5LE 2NUEA 4AQYE 4LF6E 4DR6E 4KHPE 2RTXA 2UXCE 4X65E 1T4LB 4JI0E 4LF7E 4DKKA 2N3GA 2RS6A 4DUZE 4DR2E 4JI1E 3HTXA 1EKZA 2JVAA 2B7TA 4OOGC 4X62E 4B3TE 2N3HA 4WFTA 2DMYA 2B3TB 2L3JA 1HNXE 4GKJE 4LF4E 4DR7E 4DV7E 4LF5E 4X66E 3VYYA 4DV5E 1QU6A 1YYWA 1DI2A 4X64E 1UILA 4DR4E 1WHNA 1YZ9A 2LUPB 1T4NA 2NUFA 1XMOE 1HR0E 2HHHE 5CFFE 4GKKE 1X47A 4K0KE 1HNZE 3T1HE 3OTOE 2DB2A 4JI6E 1XMQE 2UUCE 4B3ME 1UHZA 4JI7E 2UUBE 4JV5E 2ZM6E 1T4OA 1FKAE 2IHR1 2L33A 2LTRA 1J5EE 1FJGE 2KHXA 1IBME 2YT4A 4M30A 4LF9E 1STUA 1N34E 4DV3E 4DV6E 4NXNE 2UXBE 4LFCE 5BR8E 1N33E 2UXDE 3P1XA 2L2KB 1YYKA 1J26A 1RC7A 1XNQE 1IBLE 4B3RE 2LUQA 3C4BA 5LMUE 4JI3E 4JI5E 4LFBE 3J7Yp 2JY9A 4DV2E 2UUAE 2CPNA 2EZ6A 2NUGA 3ADLA 2DIXA 1I94E 4OX9E 3ADIA 3ADJA 4JYAE 3VYXA
chains in the Genus database with same CATH superfamily
1YFHA 2GHFA 4NXME 2YU8A 3LLHA 1N36E 1YPNA 5KL7A 1NEIA 3J7AG 2EMLA 1GQEA 2I13A 4J8ZA 2DLQA 2JYAA 4YHHE 1IQOA 4ZYDA 2E72A 4HTGA 1X48A 5IXMB 5ADZA 1MGTA 3KZYA 2DGCA 4B3SE 2VQFE 2EMCA 3HXLA 2M4IA 1IMUA 1O0WA 1BB8A 3VHTB 4DV4E 3KWRA 3F6GA 4DR1E 3H09A 2EN4A 2WCC3 2EWLA 1KYQA 4LTYA 4BMJA 4TUIA 3ADGA 2RSMA 3T1YE 2EPNA 4LF8E 2JP9A 4NHRA 2B9DA 2R1FA 1T4LB 3FIGA 5A6BA 2M9AA 2EN3A 1EH6A 4DR2E 4DUZE 1TN9A 4NZVA 3VK6A 1G2FC 1YUIA 2EPMX 2B7TA 2E1MA 2EN6A 2MC6A 2YTIA 3BBGA 2DSYA 2YSPA 4GEQB 3C6KA 5A6JA 5AC5A 2EL6A 2YTFA 4O4KA 4RH8A 1MEYC 4LF4E 2MDGA 4LF5E 4DR7E 4TUGA 2L92A 1NCSA 4X66E 1WRJA 4P7DA 4X64E 2RQLA 2V85A 2M1SA 2FGGA 4O24A 3J80C 1B69A 1A1GA 1WHNA 2YRKA 1X3CA 1YZ9A 2ENAA 2EPLX 2ADRA 1XMOE 5KL3A 1L4SA 5AE1A 3T1HE 4O5GA 4R2AA 2DB2A 2HGHA 1UHZA 2CSHA 2V88A 2ENCA 2EMAA 2YRHA 4BHBA 2LO3A 2EOJA 3AV0A 4RHBB 1FKAE 1A1LA 4KWYA 2EPZA 1WXRA 1J5EE 1FJGE 2YT4A 4M30A 1ZAAC 1N34E 2EM6A 2YPNA 1YSAC 2L6MA 2YWQA 5KL5A 2MKNA 2EN8A 3DF6A 1N33E 2L2KB 2DMIA 4F9BB 2V86A 3JAMC 4F54A 4I8OA 1RC7A 2M7QA 2LUQA 4JI5E 4LFBE 2DLKA 2EMYA 2UUAE 2LE2A 2DIXA 3THNA 2YU5A 3M99B 2EPKX 2V8QB 2EOQA 3BIDA 2WBTA 2L2MA 3C4TA 4YY3E 2ODRD 2MC5A 4F2JC 4DR3E 4DV0E 2EOIA 2L2NA 4N4RB 4DV1E 5AE2A 1RQ0A 2RPCA 5TSEA 5IWAE 2LBSB 4WPYA 2V87A 3THOB 1N32E 2I9IA 2WZOA 2YTPA 1WHQA 1P47A 2NUEA 2K4VA 4DR6E 2RTXA 2MKDA 2VE7C 4X65E 2LT7A 4JI0E 3HQ1A 3MHHC 2N3GA 4JI1E 1ZR9A 2R76A 4M9VC 2D9HA 4WXDA 3MHSC 3L00A 4R03A 5FLXC 4B3TE 5KL2A 3J81C 2EL5A 4BC7A 2NABA 2EM2A 3IWBA 1DGCA 3C6MA 4DV7E 1A1HA 5A6BD 1A1IA 2EOHA 3JTZA 3EPLA 4DV5E 1QU6A 1N3GA 1UILA 2EOMA 2EM3A 3MSWA 2LUPB 4R2RA 2EMHA 2HHHE 2RSIA 5CFFE 1AAYA 2JOBA 3AUZA 4MLVA 1HNZE 1XMQE 2UUCE 4BS9A 4B3ME 3OMLA 1GTKA 2GLIA 4JV5E 2JXPA 2EORA 2YTEA 5IV8B 2WBUA 1YUJA 4BC9A 2JWOA 4R2QA 2ODRC 2YTOA 2UXBE 1JK1A 2EJ4A 3JU0A 2EOFA 3P1XA 4F9CB 2BB8A 4F9AB 2EOYA 2ELZA 1IBLE 3C4BA 4FK5C 2EP3A 4X9JA 3J7Yp 3BGHA 2NUGA 4DV2E 3ADLA 3RMPA 3ADIA 1A1FA 3VYXA 1AH5A 2B7VA 2LCEA 4DR5E 2DRPA 2VF1A 2F8BA 1PKPA 2FTXB 4Q28A 5LMNE 2K7IA 4BBYA 5A69A 2EMXA 3F6HA 2NA2A 4JI2E 2UU9E 1RMDA 3HPZA 2HJJA 4P78A 2LJHA 2EM7A 3TQMA 1XNRE 2G7HA 2EM4A 2EMFA 2LRSA 2EOOA 2F4VE 2PRTA 2EQ3A 2EPRA 5IT9C 1PJTA 1X49A 4LFAE 2E5LE 5AE3A 2N8XA 3IWDA 4AQYE 1T39A 4LF6E 4KHPE 2UXCE 2CT1A 4LF7E 2CTDA 4DKKA 3HTXA 1F2IG 3ZOQB 2EM9A 2FV4B 2L8TA 4X62E 1BBOA 2N3HA 1X6HA 2JR1A 4WFTA 2HC5A 2ELYA 2DMYA 2YSOA 2B3TB 4F6NA 2EPOA 1HNXE 4WX9A 1PJSA 1ZU1A 2EL4A 2EMGA 4ZYGA 2EE8A 1WJPA 1IQSA 2H36X 4L8NA 1DI2A 4IJDA 3UK3C 2EPCA 5KL4A 2YRMA 4DMIA 2NUFA 4R2DA 2LV2A 2EOZA 3IWCA 3QG5C 1X47A 4L5NC 3OTOE 4JI6E 2EM5A 2UUBE 4F6MA 1G2DC 2YTGA 4R8OA 1T4OA 2EM0A 4IS1C 2IHR1 2EN7A 4M0VA 1IBME 4LF9E 2EN1A 4R2EA 1GZ6A 4DV6E 1BBGA 4LFCE 2V83A 3ECRA 5BR8E 2YTNA 1ZBQA 4Q35B 3BF2A 1YYKA 3HPSA 1J26A 5AASA 2ENHA 3LMLA 1XNQE 5A6AA 2EM8A 1UBDC 5LMUE 4JI3E 2JY9A 2EZ6A 4JYAE 5AC4A 1I94E 1TF6A 3ADJA 2WBSA 4GKKE 4X8WA 4ZYEA 1DQ3A 4DUYE 1KJKA 4WSPA 2EOSA 2GPIA 2EPUA 1SR9A 4ZYHA 2KONA 2MDRA 5LLQA 2LTSA 1HNWE 4M2ZA 2BBGA 1EH7A 4WYQB 2EN2A 5LL6R 1PJQA 2EPPA 2EOEA 1IBKE 1ZBTA 2RS7A 2V89A 2L3CA 2EQ0A 1YYOA 2VQEE 4JI8E 4GZNC 4JI4E 3EPKA 2YTDA 2LJUA 3EPJA 1T38A 3DJWA 2RS6A 2YZTA 1EKZA 2EMBA 2JVAA 1X6EA 2EPAA 4OOGC 4WSGA 1X5WA 2JPAA 2LVHA 4LU9A 2L3JA 4GKJE 3KZZA 3K6QA 2JOXA 2VRDA 2KOUA 4R2CA 3VYYA 1YYWA 2EMIA 4BCAA 4KZSA 1QNTA 4R2PA 4DR4E 1T4NA 5A6KA 4HEIA 5F3WA 1PDAA 1HR0E 2EQ1A 2EMZA 4K0KE 1EH8A 4O43A 1UN6B 4WXCA 1Z1BA 4JI7E 2J7JA 2EPXA 2ZM6E 2YTQA 2L33A 2A25A 2LTRA 2KHXA 1LLMC 4R2SA 2Q8UA 1STUA 3EQ1A 4DV3E 4NXNE 5KL6A 1TF3A 2EMWA 5A2QC 1A1JA 5DNYA 2UXDE 4BHCA 1SFEA 3EPHA 5T6JA 2YTJA 2EOXA 1X6FA 2EMKA 4B3RE 1A1KA 4MLQA 2CPNA 4OX9E 1JK2A 2LMZA
chains in the Genus database with same CATH topology
2B7VA 4X8WA 4NXME 4DR5E 3LLHA 1N36E 1DQ3A 4DUYE 2VF1A 2V8QB 4JYAE 2F8BA 3J7AG 1GQEA 4WSPA 4J8ZA 1PKPA 4YHHE 2FTXB 4Q28A 2L2MA 3C4TA 4YY3E 2ODRD 1SR9A 1X48A 5LMNE 2KONA 2MC5A 4BBYA 5ADZA 2MDRA 4DR3E 3F6HA 4JI2E 2NA2A 4B3SE 2UU9E 3HPZA 2LTSA 2VQFE 3HXLA 4DV0E 1HNWE 2M4IA 4M2ZA 4P78A 2L2NA 2LJHA 5LL6R 4WYQB 1RQ0A 1O0WA 5AE2A 4DV1E 4DV4E 3KWRA 5IWAE 1IBKE 1XNRE 3F6GA 1ZBTA 2G7HA 2RS7A 2V89A 2L3CA 2LRSA 3H09A 4DR1E 4WPYA 2LBSB 2V87A 2EWLA 1YYOA 1N32E 4LTYA 4BMJA 4TUIA 2VQEE 2F4VE 3ADGA 4JI8E 5IT9C 2RSMA 1X49A 2WZOA 1WHQA 3T1YE 4JI4E 4LF8E 4LFAE 2E5LE 2NUEA 2K4VA 5AE3A 4AQYE 3IWDA 4LF6E 4DR6E 4KHPE 2RTXA 2B9DA 2UXCE 4X65E 2VE7C 1T4LB 4JI0E 4LF7E 3DJWA 4DKKA 3FIGA 3HQ1A 2N3GA 2RS6A 4DUZE 4DR2E 4JI1E 3HTXA 2YZTA 3VK6A 3ZOQB 1EKZA 2JVAA 2B7TA 4R03A 2E1MA 2MC6A 2FV4B 2L8TA 4OOGC 4X62E 5FLXC 2N3HA 2DSYA 4B3TE 2JR1A 4WFTA 3J81C 4GEQB 2DMYA 2B3TB 4BC7A 4LU9A 2L3JA 1HNXE 4GKJE 3K6QA 3IWBA 2JOXA 4LF4E 4DR7E 4DV7E 4LF5E 4TUGA 2L92A 4X66E 2KOUA 2H36X 3JTZA 3VYYA 4DV5E 4P7DA 4L8NA 1QU6A 1YYWA 1DI2A 4X64E 4BCAA 2V85A 1UILA 2M1SA 4KZSA 2FGGA 3J80C 4DR4E 1WHNA 4DMIA 1YZ9A 2LUPB 1T4NA 3MSWA 2NUFA 5F3WA 1XMOE 1HR0E 2HHHE 3IWCA 5CFFE 4GKKE 2JOBA 3AUZA 1X47A 5AE1A 4K0KE 1HNZE 3T1HE 4L5NC 3OTOE 2DB2A 4JI6E 1XMQE 2UUCE 4BS9A 4B3ME 1UHZA 2V88A 3OMLA 4JI7E 2UUBE 4JV5E 2ZM6E 3AV0A 1T4OA 4R8OA 1FKAE 3ADLA 2IHR1 2L33A 2LTRA 1WXRA 1J5EE 1FJGE 2KHXA 4M0VA 1IBME 2YT4A 4M30A 4LF9E 1STUA 1N34E 1GZ6A 2L6MA 2JWOA 4BC9A 4DV3E 2ODRC 4DV6E 4NXNE 2UXBE 4LFCE 2V83A 5A2QC 3JU0A 5BR8E 5DNYA 1N33E 3DF6A 3P1XA 2UXDE 1ZBQA 4F9CB 2L2KB 4F9BB 1YYKA 2V86A 3JAMC 3HPSA 1J26A 5AASA 4F54A 3LMLA 4I8OA 4F9AB 1RC7A 5T6JA 2M7QA 1XNQE 1IBLE 4B3RE 2LUQA 3C4BA 5LMUE 4JI3E 4JI5E 4LFBE 3J7Yp 2JY9A 4DV2E 2UUAE 2CPNA 2EZ6A 2LE2A 2NUGA 2DIXA 3RMPA 1I94E 4OX9E 3ADJA 3ADIA 3VYXA 2LMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B7V A;  4X8W A;  4NXM E;  4DR5 E;  3LLH A;  1N36 E;  4DUY E;  1GQE A;  1PKP A;  4YHH E;  2L2M A;  3C4T A;  4YY3 E;  1X48 A;  5LMN E;  2MDR A;  4DR3 E;  4JI2 E;  2NA2 A;  4B3S E;  2UU9 E;  2LTS A;  2VQF E;  4DV0 E;  1HNW E;  4M2Z A;  2L2N A;  2LJH A;  4DV1 E;  4WYQ B;  1RQ0 A;  1O0W A;  4DV4 E;  1IBK E;  5IWA E;  1XNR E;  1ZBT A;  2RS7 A;  2L3C A;  4DR1 E;  2LBS B;  2LRS A;  1YYO A;  1N32 E;  2VQE E;  2F4V E;  3ADG A;  4JI8 E;  2RSM A;  1X49 A;  1WHQ A;  3T1Y E;  4JI4 E;  4LF8 E;  4LFA E;  2E5L E;  2NUE A;  4AQY E;  4LF6 E;  4DR6 E;  4KHP E;  2RTX A;  2UXC E;  4X65 E;  1T4L B;  4JI0 E;  4LF7 E;  4DKK A;  2N3G A;  2RS6 A;  4DUZ E;  4DR2 E;  4JI1 E;  3HTX A;  1EKZ A;  2JVA A;  2B7T A;  4OOG C;  4X62 E;  4B3T E;  2N3H A;  4WFT A;  2DMY A;  2B3T B;  2L3J A;  1HNX E;  4GKJ E;  4LF4 E;  4DR7 E;  4DV7 E;  4LF5 E;  4X66 E;  3VYY A;  4DV5 E;  1QU6 A;  1YYW A;  1DI2 A;  4X64 E;  1UIL A;  4DR4 E;  1WHN A;  1YZ9 A;  2LUP B;  1T4N A;  2NUF A;  1XMO E;  1HR0 E;  2HHH E;  5CFF E;  4GKK E;  1X47 A;  4K0K E;  1HNZ E;  3T1H E;  3OTO E;  2DB2 A;  4JI6 E;  1XMQ E;  2UUC E;  4B3M E;  1UHZ A;  4JI7 E;  2UUB E;  4JV5 E;  2ZM6 E;  1T4O A;  1FKA E;  2IHR 1;  2L33 A;  2LTR A;  1J5E E;  1FJG E;  2KHX A;  1IBM E;  2YT4 A;  4M30 A;  4LF9 E;  1STU A;  1N34 E;  4DV3 E;  4DV6 E;  4NXN E;  2UXB E;  4LFC E;  5BR8 E;  1N33 E;  2UXD E;  3P1X A;  2L2K B;  1YYK A;  1J26 A;  1RC7 A;  1XNQ E;  1IBL E;  4B3R E;  2LUQ A;  3C4B A;  5LMU E;  4JI3 E;  4JI5 E;  4LFB E;  3J7Y p;  2JY9 A;  4DV2 E;  2UUA E;  2CPN A;  2EZ6 A;  2NUG A;  3ADL A;  2DIX A;  1I94 E;  4OX9 E;  3ADI A;  3ADJ A;  4JYA E;  3VYX A; 
#chains in the Genus database with same CATH topology
 1YFH A;  2GHF A;  4NXM E;  2YU8 A;  3LLH A;  1N36 E;  1YPN A;  5KL7 A;  1NEI A;  3J7A G;  2EML A;  1GQE A;  2I13 A;  4J8Z A;  2DLQ A;  2JYA A;  4YHH E;  1IQO A;  4ZYD A;  2E72 A;  4HTG A;  1X48 A;  5IXM B;  5ADZ A;  1MGT A;  3KZY A;  2DGC A;  4B3S E;  2VQF E;  2EMC A;  3HXL A;  2M4I A;  1IMU A;  1O0W A;  1BB8 A;  3VHT B;  4DV4 E;  3KWR A;  3F6G A;  4DR1 E;  3H09 A;  2EN4 A;  2WCC 3;  2EWL A;  1KYQ A;  4LTY A;  4BMJ A;  4TUI A;  3ADG A;  2RSM A;  3T1Y E;  2EPN A;  4LF8 E;  2JP9 A;  4NHR A;  2B9D A;  2R1F A;  1T4L B;  3FIG A;  5A6B A;  2M9A A;  2EN3 A;  1EH6 A;  4DR2 E;  4DUZ E;  1TN9 A;  4NZV A;  3VK6 A;  1G2F C;  1YUI A;  2EPM X;  2B7T A;  2E1M A;  2EN6 A;  2MC6 A;  2YTI A;  3BBG A;  2DSY A;  2YSP A;  4GEQ B;  3C6K A;  5A6J A;  5AC5 A;  2EL6 A;  2YTF A;  4O4K A;  4RH8 A;  1MEY C;  4LF4 E;  2MDG A;  4LF5 E;  4DR7 E;  4TUG A;  2L92 A;  1NCS A;  4X66 E;  1WRJ A;  4P7D A;  4X64 E;  2RQL A;  2V85 A;  2M1S A;  2FGG A;  4O24 A;  3J80 C;  1B69 A;  1A1G A;  1WHN A;  2YRK A;  1X3C A;  1YZ9 A;  2ENA A;  2EPL X;  2ADR A;  1XMO E;  5KL3 A;  1L4S A;  5AE1 A;  3T1H E;  4O5G A;  4R2A A;  2DB2 A;  2HGH A;  1UHZ A;  2CSH A;  2V88 A;  2ENC A;  2EMA A;  2YRH A;  4BHB A;  2LO3 A;  2EOJ A;  3AV0 A;  4RHB B;  1FKA E;  1A1L A;  4KWY A;  2EPZ A;  1WXR A;  1J5E E;  1FJG E;  2YT4 A;  4M30 A;  1ZAA C;  1N34 E;  2EM6 A;  2YPN A;  1YSA C;  2L6M A;  2YWQ A;  5KL5 A;  2MKN A;  2EN8 A;  3DF6 A;  1N33 E;  2L2K B;  2DMI A;  4F9B B;  2V86 A;  3JAM C;  4F54 A;  4I8O A;  1RC7 A;  2M7Q A;  2LUQ A;  4JI5 E;  4LFB E;  2DLK A;  2EMY A;  2UUA E;  2LE2 A;  2DIX A;  3THN A;  2YU5 A;  3M99 B;  2EPK X;  2V8Q B;  2EOQ A;  3BID A;  2WBT A;  2L2M A;  3C4T A;  4YY3 E;  2ODR D;  2MC5 A;  4F2J C;  4DR3 E;  4DV0 E;  2EOI A;  2L2N A;  4N4R B;  4DV1 E;  5AE2 A;  1RQ0 A;  2RPC A;  5TSE A;  5IWA E;  2LBS B;  4WPY A;  2V87 A;  3THO B;  1N32 E;  2I9I A;  2WZO A;  2YTP A;  1WHQ A;  1P47 A;  2NUE A;  2K4V A;  4DR6 E;  2RTX A;  2MKD A;  2VE7 C;  4X65 E;  2LT7 A;  4JI0 E;  3HQ1 A;  3MHH C;  2N3G A;  4JI1 E;  1ZR9 A;  2R76 A;  4M9V C;  2D9H A;  4WXD A;  3MHS C;  3L00 A;  4R03 A;  5FLX C;  4B3T E;  5KL2 A;  3J81 C;  2EL5 A;  4BC7 A;  2NAB A;  2EM2 A;  3IWB A;  1DGC A;  3C6M A;  4DV7 E;  1A1H A;  5A6B D;  1A1I A;  2EOH A;  3JTZ A;  3EPL A;  4DV5 E;  1QU6 A;  1N3G A;  1UIL A;  2EOM A;  2EM3 A;  3MSW A;  2LUP B;  4R2R A;  2EMH A;  2HHH E;  2RSI A;  5CFF E;  1AAY A;  2JOB A;  3AUZ A;  4MLV A;  1HNZ E;  1XMQ E;  2UUC E;  4BS9 A;  4B3M E;  3OML A;  1GTK A;  2GLI A;  4JV5 E;  2JXP A;  2EOR A;  2YTE A;  5IV8 B;  2WBU A;  1YUJ A;  4BC9 A;  2JWO A;  4R2Q A;  2ODR C;  2YTO A;  2UXB E;  1JK1 A;  2EJ4 A;  3JU0 A;  2EOF A;  3P1X A;  4F9C B;  2BB8 A;  4F9A B;  2EOY A;  2ELZ A;  1IBL E;  3C4B A;  4FK5 C;  2EP3 A;  4X9J A;  3J7Y p;  3BGH A;  2NUG A;  4DV2 E;  3ADL A;  3RMP A;  3ADI A;  1A1F A;  3VYX A;  1AH5 A;  2B7V A;  2LCE A;  4DR5 E;  2DRP A;  2VF1 A;  2F8B A;  1PKP A;  2FTX B;  4Q28 A;  5LMN E;  2K7I A;  4BBY A;  5A69 A;  2EMX A;  3F6H A;  2NA2 A;  4JI2 E;  2UU9 E;  1RMD A;  3HPZ A;  2HJJ A;  4P78 A;  2LJH A;  2EM7 A;  3TQM A;  1XNR E;  2G7H A;  2EM4 A;  2EMF A;  2LRS A;  2EOO A;  2F4V E;  2PRT A;  2EQ3 A;  2EPR A;  5IT9 C;  1PJT A;  1X49 A;  4LFA E;  2E5L E;  5AE3 A;  2N8X A;  3IWD A;  4AQY E;  1T39 A;  4LF6 E;  4KHP E;  2UXC E;  2CT1 A;  4LF7 E;  2CTD A;  4DKK A;  3HTX A;  1F2I G;  3ZOQ B;  2EM9 A;  2FV4 B;  2L8T A;  4X62 E;  1BBO A;  2N3H A;  1X6H A;  2JR1 A;  4WFT A;  2HC5 A;  2ELY A;  2DMY A;  2YSO A;  2B3T B;  4F6N A;  2EPO A;  1HNX E;  4WX9 A;  1PJS A;  1ZU1 A;  2EL4 A;  2EMG A;  4ZYG A;  2EE8 A;  1WJP A;  1IQS A;  2H36 X;  4L8N A;  1DI2 A;  4IJD A;  3UK3 C;  2EPC A;  5KL4 A;  2YRM A;  4DMI A;  2NUF A;  4R2D A;  2LV2 A;  2EOZ A;  3IWC A;  3QG5 C;  1X47 A;  4L5N C;  3OTO E;  4JI6 E;  2EM5 A;  2UUB E;  4F6M A;  1G2D C;  2YTG A;  4R8O A;  1T4O A;  2EM0 A;  4IS1 C;  2IHR 1;  2EN7 A;  4M0V A;  1IBM E;  4LF9 E;  2EN1 A;  4R2E A;  1GZ6 A;  4DV6 E;  1BBG A;  4LFC E;  2V83 A;  3ECR A;  5BR8 E;  2YTN A;  1ZBQ A;  4Q35 B;  3BF2 A;  1YYK A;  3HPS A;  1J26 A;  5AAS A;  2ENH A;  3LML A;  1XNQ E;  5A6A A;  2EM8 A;  1UBD C;  5LMU E;  4JI3 E;  2JY9 A;  2EZ6 A;  4JYA E;  5AC4 A;  1I94 E;  1TF6 A;  3ADJ A;  2WBS A;  4GKK E;  4X8W A;  4ZYE A;  1DQ3 A;  4DUY E;  1KJK A;  4WSP A;  2EOS A;  2GPI A;  2EPU A;  1SR9 A;  4ZYH A;  2KON A;  2MDR A;  5LLQ A;  2LTS A;  1HNW E;  4M2Z A;  2BBG A;  1EH7 A;  4WYQ B;  2EN2 A;  5LL6 R;  1PJQ A;  2EPP A;  2EOE A;  1IBK E;  1ZBT A;  2RS7 A;  2V89 A;  2L3C A;  2EQ0 A;  1YYO A;  2VQE E;  4JI8 E;  4GZN C;  4JI4 E;  3EPK A;  2YTD A;  2LJU A;  3EPJ A;  1T38 A;  3DJW A;  2RS6 A;  2YZT A;  1EKZ A;  2EMB A;  2JVA A;  1X6E A;  2EPA A;  4OOG C;  4WSG A;  1X5W A;  2JPA A;  2LVH A;  4LU9 A;  2L3J A;  4GKJ E;  3KZZ A;  3K6Q A;  2JOX A;  2VRD A;  2KOU A;  4R2C A;  3VYY A;  1YYW A;  2EMI A;  4BCA A;  4KZS A;  1QNT A;  4R2P A;  4DR4 E;  1T4N A;  5A6K A;  4HEI A;  5F3W A;  1PDA A;  1HR0 E;  2EQ1 A;  2EMZ A;  4K0K E;  1EH8 A;  4O43 A;  1UN6 B;  4WXC A;  1Z1B A;  4JI7 E;  2J7J A;  2EPX A;  2ZM6 E;  2YTQ A;  2L33 A;  2A25 A;  2LTR A;  2KHX A;  1LLM C;  4R2S A;  2Q8U A;  1STU A;  3EQ1 A;  4DV3 E;  4NXN E;  5KL6 A;  1TF3 A;  2EMW A;  5A2Q C;  1A1J A;  5DNY A;  2UXD E;  4BHC A;  1SFE A;  3EPH A;  5T6J A;  2YTJ A;  2EOX A;  1X6F A;  2EMK A;  4B3R E;  1A1K A;  4MLQ A;  2CPN A;  4OX9 E;  1JK2 A;  2LMZ A; 
#chains in the Genus database with same CATH homology
 2B7V A;  4X8W A;  4NXM E;  4DR5 E;  3LLH A;  1N36 E;  1DQ3 A;  4DUY E;  2VF1 A;  2V8Q B;  4JYA E;  2F8B A;  3J7A G;  1GQE A;  4WSP A;  4J8Z A;  1PKP A;  4YHH E;  2FTX B;  4Q28 A;  2L2M A;  3C4T A;  4YY3 E;  2ODR D;  1SR9 A;  1X48 A;  5LMN E;  2KON A;  2MC5 A;  4BBY A;  5ADZ A;  2MDR A;  4DR3 E;  3F6H A;  4JI2 E;  2NA2 A;  4B3S E;  2UU9 E;  3HPZ A;  2LTS A;  2VQF E;  3HXL A;  4DV0 E;  1HNW E;  2M4I A;  4M2Z A;  4P78 A;  2L2N A;  2LJH A;  5LL6 R;  4WYQ B;  1RQ0 A;  1O0W A;  5AE2 A;  4DV1 E;  4DV4 E;  3KWR A;  5IWA E;  1IBK E;  1XNR E;  3F6G A;  1ZBT A;  2G7H A;  2RS7 A;  2V89 A;  2L3C A;  2LRS A;  3H09 A;  4DR1 E;  4WPY A;  2LBS B;  2V87 A;  2EWL A;  1YYO A;  1N32 E;  4LTY A;  4BMJ A;  4TUI A;  2VQE E;  2F4V E;  3ADG A;  4JI8 E;  5IT9 C;  2RSM A;  1X49 A;  2WZO A;  1WHQ A;  3T1Y E;  4JI4 E;  4LF8 E;  4LFA E;  2E5L E;  2NUE A;  2K4V A;  5AE3 A;  4AQY E;  3IWD A;  4LF6 E;  4DR6 E;  4KHP E;  2RTX A;  2B9D A;  2UXC E;  4X65 E;  2VE7 C;  1T4L B;  4JI0 E;  4LF7 E;  3DJW A;  4DKK A;  3FIG A;  3HQ1 A;  2N3G A;  2RS6 A;  4DUZ E;  4DR2 E;  4JI1 E;  3HTX A;  2YZT A;  3VK6 A;  3ZOQ B;  1EKZ A;  2JVA A;  2B7T A;  4R03 A;  2E1M A;  2MC6 A;  2FV4 B;  2L8T A;  4OOG C;  4X62 E;  5FLX C;  2N3H A;  2DSY A;  4B3T E;  2JR1 A;  4WFT A;  3J81 C;  4GEQ B;  2DMY A;  2B3T B;  4BC7 A;  4LU9 A;  2L3J A;  1HNX E;  4GKJ E;  3K6Q A;  3IWB A;  2JOX A;  4LF4 E;  4DR7 E;  4DV7 E;  4LF5 E;  4TUG A;  2L92 A;  4X66 E;  2KOU A;  2H36 X;  3JTZ A;  3VYY A;  4DV5 E;  4P7D A;  4L8N A;  1QU6 A;  1YYW A;  1DI2 A;  4X64 E;  4BCA A;  2V85 A;  1UIL A;  2M1S A;  4KZS A;  2FGG A;  3J80 C;  4DR4 E;  1WHN A;  4DMI A;  1YZ9 A;  2LUP B;  1T4N A;  3MSW A;  2NUF A;  5F3W A;  1XMO E;  1HR0 E;  2HHH E;  3IWC A;  5CFF E;  4GKK E;  2JOB A;  3AUZ A;  1X47 A;  5AE1 A;  4K0K E;  1HNZ E;  3T1H E;  4L5N C;  3OTO E;  2DB2 A;  4JI6 E;  1XMQ E;  2UUC E;  4BS9 A;  4B3M E;  1UHZ A;  2V88 A;  3OML A;  4JI7 E;  2UUB E;  4JV5 E;  2ZM6 E;  3AV0 A;  1T4O A;  4R8O A;  1FKA E;  3ADL A;  2IHR 1;  2L33 A;  2LTR A;  1WXR A;  1J5E E;  1FJG E;  2KHX A;  4M0V A;  1IBM E;  2YT4 A;  4M30 A;  4LF9 E;  1STU A;  1N34 E;  1GZ6 A;  2L6M A;  2JWO A;  4BC9 A;  4DV3 E;  2ODR C;  4DV6 E;  4NXN E;  2UXB E;  4LFC E;  2V83 A;  5A2Q C;  3JU0 A;  5BR8 E;  5DNY A;  1N33 E;  3DF6 A;  3P1X A;  2UXD E;  1ZBQ A;  4F9C B;  2L2K B;  4F9B B;  1YYK A;  2V86 A;  3JAM C;  3HPS A;  1J26 A;  5AAS A;  4F54 A;  3LML A;  4I8O A;  4F9A B;  1RC7 A;  5T6J A;  2M7Q A;  1XNQ E;  1IBL E;  4B3R E;  2LUQ A;  3C4B A;  5LMU E;  4JI3 E;  4JI5 E;  4LFB E;  3J7Y p;  2JY9 A;  4DV2 E;  2UUA E;  2CPN A;  2EZ6 A;  2LE2 A;  2NUG A;  2DIX A;  3RMP A;  1I94 E;  4OX9 E;  3ADJ A;  3ADI A;  3VYX A;  2LMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...