2N3GA

Solution structure of drb4 dsrbd1 (viz. drb4(1-72))
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
72
structure length
72
Chain Sequence
MDHVYKGQLQAYALQHNLELPVYANEREGPPHAPRFRCNVTFCGQTFQSSEFFPTLKSAEHAAAKIAVASLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Double-stranded RNA-binding protein 4
publication title DRB4 dsRBD1 drives dsRNA recognition in Arabidopsis thaliana tasi/siRNA pathway.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 14
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2n3gA00
2RSMA 3T1YE 1N32E 1RQ0A 4JI2E 5CFFE 4YHHE 4GKJE 2LRSA 4OX9E 2L2KB 4DR2E 4AQYE 4DR1E 2KHXA 2UXCE 4DV3E 5IWAE 1J26A 2L33A 2L3JA 4YY3E 4DR3E 3VYYA 3J7Yp 2LUQA 2NUGA 1FKAE 4OOGC 1YYWA 4DR6E 3HTXA 2F4VE 2UUCE 4JI1E 1I94E 1WHQA 4DV5E 4K0KE 2IHR1 4DUZE 2DB2A 4DKKA 2LTRA 2NA2A 2UXDE 2N3GA 2UU9E 3LLHA 4B3ME 3ADJA 1YYOA 1T4OA 5LMUE 1T4NA 2MDRA 4LFCE 1GQEA 1XMOE 4LF7E 4JI0E 2JVAA 1T4LB 4JV5E 4M2ZA 4DR7E 4DUYE 2UUAE 2LJHA 4B3SE 2NUEA 1UHZA 1UILA 1X49A 3ADLA 5LMNE 1HR0E 4X66E 2LUPB 4LF6E 1WHNA 3T1HE 1ZBTA 1PKPA 3ADIA 3VYXA 3P1XA 4JI8E 3OTOE 1O0WA 2B7TA 2VQEE 4X62E 4LFAE 1N36E 4JI4E 2EZ6A 4LF5E 2ZM6E 1YZ9A 2L2NA 2NUFA 4X8WA 4JYAE 2DMYA 4LF9E 1X47A 4GKKE 2YT4A 2E5LE 2B3TB 4DV7E 4DV6E 1FJGE 4B3RE 1QU6A 1XMQE 4M30A 4JI5E 4LFBE 4DV2E 1RC7A 1IBME 1YYKA 2RS6A 2VQFE 2UXBE 1IBLE 1XNQE 1DI2A 2UUBE 2JY9A 4DR4E 3ADGA 2RTXA 1STUA 1J5EE 3C4TA 2L2MA 4DR5E 2DIXA 1HNZE 4X64E 2CPNA 2L3CA 4KHPE 3C4BA 2RS7A 4WYQB 4DV1E 1HNXE 4X65E 4LF8E 4JI7E 4WFTA 1IBKE 2B7VA 4DV4E 4B3TE 1N34E 1X48A 2N3HA 5BR8E 4DV0E 1EKZA 4JI3E 4JI6E 1N33E 2HHHE 1XNRE 4NXME 4NXNE 1HNWE 2LBSB 4LF4E 2LTSA
chains in the Genus database with same CATH superfamily
4JI2E 5CFFE 3K6QA 4OX9E 2V86A 5A6JA 3C6KA 2KHXA 3THOB 5LLQA 2MC5A 2JPAA 2WBSA 3VYYA 4RH8A 2LUQA 2ODRC 2UUCE 1G2DC 2KONA 4K0KE 2EOZA 2DLKA 2DB2A 2LTRA 5LL6R 1YPNA 2MKNA 2R76A 3LLHA 2EPAA 2V85A 1T4OA 1A1LA 1ZBQA 3HPZA 1T4NA 1X6EA 1EH8A 1A1FA 1XMOE 2EOEA 1T4LB 3VK6A 4DR7E 4O4KA 2EP3A 3KZYA 2UUAE 2LJHA 1PJSA 2EMHA 1GZ6A 3JAMC 4R2SA 4M9VC 5AC4A 2EMZA 4TUGA 2EMWA 3VYXA 1GTKA 3OTOE 2K4VA 2B9DA 2EM5A 2MC6A 4GEQB 2HC5A 3MSWA 4BCAA 2EPMX 2L2NA 4X8WA 2DMYA 4O24A 2V8QB 2E5LE 4DV7E 1AAYA 1DQ3A 1FJGE 2F8BA 1NEIA 4X9JA 2RQLA 5AE2A 3RMPA 2RS6A 2VE7C 2VQFE 3L00A 1IBLE 4BMJA 3BIDA 2PRTA 4RHBB 1XNQE 2EJ4A 1YUJA 2JY9A 2RTXA 1STUA 3KZZA 1J5EE 3C4TA 2EMCA 2EQ1A 2NABA 1G2FC 5IV8B 2V89A 4KHPE 3C4BA 2YU8A 1NCSA 3J7AG 1Z1BA 1HNXE 2EOFA 1A1HA 4LF8E 4ZYGA 5KL7A 4WFTA 2ELZA 1N33E 4IS1C 4NXME 1HNWE 2MKDA 2E1MA 2EOXA 1SR9A 2WCC3 2LTSA 3T1YE 1X3CA 1QNTA 2FGGA 1N32E 2ENCA 4YHHE 4J8ZA 2ENHA 2EM9A 2L2KB 4DR2E 1KYQA 5KL4A 3JU0A 4WXDA 2UXCE 1J26A 4NZVA 5IWAE 2EQ3A 2L3JA 2JOBA 2V87A 2YWQA 2YTJA 4YY3E 4DR3E 3QG5C 3UK3C 2M4IA 2VF1A 3J7Yp 2NUGA 2YTGA 5FLXC 2N8XA 2YRKA 3FIGA 1YYWA 2EN8A 1I94E 3BGHA 2IHR1 4BC7A 2EWLA 5AE3A 2L92A 2N3GA 2UU9E 5A6BD 4B3ME 2UXDE 2YTQA 2YTIA 1YYOA 5LMUE 3MHHC 2MDRA 2JXPA 4LFCE 2FV4B 4LTYA 1GQEA 1TN9A 4LF7E 4ZYHA 3VHTB 4JV5E 4DUYE 2JR1A 4R2PA 2NUEA 3ECRA 2LE2A 1X49A 3ADLA 4O43A 2L8TA 3BBGA 3F6GA 4F2JC 5LMNE 2EM6A 1BBOA 3IWDA 2V88A 2LV2A 2M1SA 4X62E 2A25A 1ZU1A 1JK1A 2EORA 2EMFA 2EOIA 2WBTA 2ZM6E 5IT9C 4F6MA 1YUIA 2YRHA 1A1GA 2EOMA 2EM7A 1QU6A 3EPKA 1XMQE 2EOOA 2EN4A 4LFBE 2YPNA 3OMLA 2WBUA 2UXBE 2YZTA 1L4SA 2CSHA 4WPYA 4DR4E 3DJWA 2L2MA 3AUZA 2CT1A 3M99B 4R2CA 4X64E 2L3CA 2YRMA 2DSYA 2RS7A 3THNA 4DV1E 1B69A 2EPPA 2EM0A 4DV4E 4B3TE 1UN6B 5KL3A 2N3HA 5BR8E 4R2DA 5TSEA 1XNRE 5KL2A 4NXNE 2EMXA 2LBSB 4R2RA 1T39A 2RSMA 4MLVA 2EM8A 2I9IA 4AQYE 5IXMB 1PJTA 4DR1E 4DV3E 2L33A 3BF2A 2YTFA 1T38A 4WX9A 5A6AA 2EPZA 1FKAE 4M0VA 4KWYA 3EPJA 4DR6E 3IWBA 3HTXA 4LU9A 2LT7A 2F4VE 3HPSA 2EMBA 4BBYA 2M7QA 4JI1E 4I8OA 4DKKA 5AASA 2EL4A 2YTPA 2EMLA 2YTOA 2JWOA 2R1FA 2EPLX 4R2EA 4F9BB 2RSIA 3IWCA 4HTGA 2HGHA 4JI0E 2JVAA 2EPNA 1AH5A 2GLIA 1WJPA 5A6KA 2EOQA 5KL6A 4FK5C 1HR0E 2LUPB 2KOUA 2MDGA 4LF6E 5ADZA 3DF6A 4R2QA 3T1HE 3J81C 3EPHA 1X6FA 2EOJA 2ADRA 1BBGA 4JI8E 3ZOQB 2EM2A 3KWRA 1MGTA 2B7TA 4BS9A 2VQEE 4R8OA 2YSOA 2EPRA 4JI4E 2EZ6A 5AC5A 2NUFA 2I13A 4JYAE 5AE1A 4LF9E 4N4RB 2EM4A 4GKKE 4F54A 5DNYA 2EOHA 1BB8A 4JI5E 4O5GA 4KZSA 1RC7A 2DGCA 1YYKA 2YSPA 1EH7A 1A1KA 2UUBE 3F6HA 2EPCA 2DIXA 4F9CB 2DLQA 2CPNA 2H36X 4WSGA 5KL5A 2EL6A 2EN7A 2LCEA 4WSPA 3J80C 2JOXA 2L6MA 1IBKE 5F3WA 4DMIA 4P7DA 4NHRA 1N34E 2FTXB 2E72A 1X48A 1EKZA 4JI3E 2HHHE 4WXCA 1LLMC 2LVHA 2EE8A 3HXLA 4L8NA 2BBGA 4MLQA 4P78A 4L5NC 1MEYC 1RQ0A 4GKJE 2HJJA 2LRSA 4TUIA 3MHSC 4BHBA 1YSAC 2EMKA 2EMIA 1JK2A 1ZR9A 1UBDC 2D9HA 2EM3A 3EPLA 1F2IG 2BB8A 1PJQA 2ENAA 4OOGC 2K7IA 2G7HA 4F9AB 1WXRA 3EQ1A 1WHQA 4DV5E 4HEIA 4DUZE 1RMDA 3H09A 2NA2A 3ADJA 1WRJA 2DMIA 2LO3A 4R03A 2GHFA 3LMLA 2EPUA 1PDAA 1ZAAC 4M2ZA 2EPOA 4B3SE 2YTEA 1UHZA 4GZNC 1UILA 5A2QC 4Q28A 4Q35B 3JTZA 2Q8UA 4X66E 3C6MA 4IJDA 1WHNA 1ZBTA 1PKPA 2ELYA 3ADIA 3P1XA 5A6BA 2EN1A 2CTDA 1O0WA 1A1JA 4LFAE 2EN3A 1N36E 2VRDA 2EMGA 4LF5E 2RPCA 1YZ9A 1DGCA 2LMZA 1X47A 1YFHA 2YT4A 2DRPA 2B3TB 2EPKX 4DV6E 2GPIA 2V83A 4B3RE 4ZYEA 1IMUA 2EQ0A 4M30A 4DV2E 1IBME 2EL5A 2EMAA 3AV0A 5A69A 5T6JA 1DI2A 4BC9A 1IQSA 2YTNA 2EPXA 3HQ1A 2EN6A 3ADGA 1TF3A 1A1IA 2EOYA 1X5WA 4DR5E 4F6NA 1HNZE 1KJKA 1TF6A 4BHCA 1P47A 2WZOA 2YU5A 2ODRD 4R2AA 2J7JA 4ZYDA 2YTDA 4WYQB 1EH6A 2LJUA 4X65E 4JI7E 2JP9A 1X6HA 2B7VA 2M9AA 3TQMA 4DV0E 2EMYA 2JYAA 4JI6E 2EOSA 1IQOA 1SFEA 1N3GA 4LF4E 2EN2A
chains in the Genus database with same CATH topology
2RSMA 3T1YE 2FGGA 1N32E 1RQ0A 4JI2E 5CFFE 4YHHE 3K6QA 4GKJE 4J8ZA 2LRSA 4OX9E 4TUIA 2L2KB 4DR2E 2V86A 4AQYE 3JU0A 4DR1E 2KHXA 2UXCE 4DV3E 5IWAE 1J26A 2L33A 2L3JA 2JOBA 2V87A 2MC5A 4YY3E 4DR3E 3VYYA 2M4IA 2VF1A 2LUQA 3J7Yp 2NUGA 1FKAE 4M0VA 5FLXC 3FIGA 4OOGC 1YYWA 2G7HA 3IWBA 2ODRC 4LU9A 4F9AB 2UUCE 3HPSA 3HTXA 2F4VE 4BBYA 1WXRA 2KONA 2M7QA 1I94E 4JI1E 1WHQA 4DV5E 4K0KE 4I8OA 2IHR1 4DUZE 4BC7A 2DB2A 2EWLA 4DKKA 5AASA 2LTRA 2NA2A 3H09A 5LL6R 2L92A 2N3GA 4P78A 3LLHA 5AE3A 2UU9E 4B3ME 2UXDE 3ADJA 2V85A 1YYOA 1T4OA 5LMUE 1ZBQA 2JWOA 1T4NA 2MDRA 3HPZA 4F9BB 4LFCE 4R03A 2FV4B 3IWCA 3LMLA 4LTYA 1GQEA 1XMOE 4LF7E 4JI0E 2JVAA 1T4LB 4JV5E 4M2ZA 3VK6A 4DR7E 4DUYE 2JR1A 2UUAE 2LJHA 4B3SE 2NUEA 1UHZA 1UILA 4DR6E 1GZ6A 2LE2A 1X49A 3JAMC 5A2QC 3ADLA 2L8TA 4Q28A 3JTZA 3F6GA 5LMNE 1HR0E 4X66E 2KOUA 2LUPB 4LF6E 5ADZA 3IWDA 3DF6A 1WHNA 3T1HE 4TUGA 1ZBTA 3J81C 1PKPA 3ADIA 3VYXA 3P1XA 4JI8E 3OTOE 3ZOQB 1O0WA 2V88A 2K4VA 3KWRA 2B7TA 2M1SA 4BS9A 2B9DA 2VQEE 2MC6A 4R8OA 4X62E 4GEQB 3MSWA 4LFAE 1N36E 4JI4E 4BCAA 2EZ6A 4LF5E 2ZM6E 5IT9C 1YZ9A 2LMZA 2L2NA 2NUFA 4X8WA 4JYAE 2DMYA 5AE1A 1X47A 4LF9E 4GKKE 2V8QB 2YT4A 2E5LE 2B3TB 4F54A 4DV7E 5DNYA 4DV6E 1DQ3A 1FJGE 2V83A 4B3RE 1QU6A 2F8BA 1XMQE 4M30A 4JI5E 4LFBE 4DV2E 4KZSA 5AE2A 1RC7A 1IBME 1YYKA 3OMLA 3RMPA 2RS6A 2VE7C 2VQFE 2UXBE 1IBLE 4BMJA 3AV0A 1XNQE 2YZTA 5T6JA 1DI2A 4BC9A 2UUBE 2JY9A 3F6HA 4WPYA 4DR4E 3HQ1A 3ADGA 2RTXA 1STUA 1J5EE 3C4TA 2L2MA 3DJWA 4DR5E 3AUZA 2DIXA 4F9CB 1HNZE 4X64E 2H36X 2CPNA 2L3CA 2V89A 4KHPE 2WZOA 3C4BA 2DSYA 2ODRD 2RS7A 3J7AG 4WYQB 4DV1E 1HNXE 4WSPA 4X65E 4JI7E 2JOXA 3J80C 2L6MA 4LF8E 4WFTA 1IBKE 2B7VA 4DV4E 5F3WA 4DMIA 4B3TE 4P7DA 1N34E 2FTXB 1X48A 2N3HA 5BR8E 4DV0E 1EKZA 4JI3E 4JI6E 1N33E 2HHHE 1XNRE 4NXME 3HXLA 4NXNE 1HNWE 2LBSB 2E1MA 4L8NA 4LF4E 1SR9A 4L5NC 2LTSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RSM A;  3T1Y E;  1N32 E;  1RQ0 A;  4JI2 E;  5CFF E;  4YHH E;  4GKJ E;  2LRS A;  4OX9 E;  2L2K B;  4DR2 E;  4AQY E;  4DR1 E;  2KHX A;  2UXC E;  4DV3 E;  5IWA E;  1J26 A;  2L33 A;  2L3J A;  4YY3 E;  4DR3 E;  3VYY A;  3J7Y p;  2LUQ A;  2NUG A;  1FKA E;  4OOG C;  1YYW A;  4DR6 E;  3HTX A;  2F4V E;  2UUC E;  4JI1 E;  1I94 E;  1WHQ A;  4DV5 E;  4K0K E;  2IHR 1;  4DUZ E;  2DB2 A;  4DKK A;  2LTR A;  2NA2 A;  2UXD E;  2N3G A;  2UU9 E;  3LLH A;  4B3M E;  3ADJ A;  1YYO A;  1T4O A;  5LMU E;  1T4N A;  2MDR A;  4LFC E;  1GQE A;  1XMO E;  4LF7 E;  4JI0 E;  2JVA A;  1T4L B;  4JV5 E;  4M2Z A;  4DR7 E;  4DUY E;  2UUA E;  2LJH A;  4B3S E;  2NUE A;  1UHZ A;  1UIL A;  1X49 A;  3ADL A;  5LMN E;  1HR0 E;  4X66 E;  2LUP B;  4LF6 E;  1WHN A;  3T1H E;  1ZBT A;  1PKP A;  3ADI A;  3VYX A;  3P1X A;  4JI8 E;  3OTO E;  1O0W A;  2B7T A;  2VQE E;  4X62 E;  4LFA E;  1N36 E;  4JI4 E;  2EZ6 A;  4LF5 E;  2ZM6 E;  1YZ9 A;  2L2N A;  2NUF A;  4X8W A;  4JYA E;  2DMY A;  4LF9 E;  1X47 A;  4GKK E;  2YT4 A;  2E5L E;  2B3T B;  4DV7 E;  4DV6 E;  1FJG E;  4B3R E;  1QU6 A;  1XMQ E;  4M30 A;  4JI5 E;  4LFB E;  4DV2 E;  1RC7 A;  1IBM E;  1YYK A;  2RS6 A;  2VQF E;  2UXB E;  1IBL E;  1XNQ E;  1DI2 A;  2UUB E;  2JY9 A;  4DR4 E;  3ADG A;  2RTX A;  1STU A;  1J5E E;  3C4T A;  2L2M A;  4DR5 E;  2DIX A;  1HNZ E;  4X64 E;  2CPN A;  2L3C A;  4KHP E;  3C4B A;  2RS7 A;  4WYQ B;  4DV1 E;  1HNX E;  4X65 E;  4LF8 E;  4JI7 E;  4WFT A;  1IBK E;  2B7V A;  4DV4 E;  4B3T E;  1N34 E;  1X48 A;  2N3H A;  5BR8 E;  4DV0 E;  1EKZ A;  4JI3 E;  4JI6 E;  1N33 E;  2HHH E;  1XNR E;  4NXM E;  4NXN E;  1HNW E;  2LBS B;  4LF4 E;  2LTS A; 
#chains in the Genus database with same CATH topology
 4JI2 E;  5CFF E;  3K6Q A;  4OX9 E;  2V86 A;  5A6J A;  3C6K A;  2KHX A;  3THO B;  5LLQ A;  2MC5 A;  2JPA A;  2WBS A;  3VYY A;  4RH8 A;  2LUQ A;  2ODR C;  2UUC E;  1G2D C;  2KON A;  4K0K E;  2EOZ A;  2DLK A;  2DB2 A;  2LTR A;  5LL6 R;  1YPN A;  2MKN A;  2R76 A;  3LLH A;  2EPA A;  2V85 A;  1T4O A;  1A1L A;  1ZBQ A;  3HPZ A;  1T4N A;  1X6E A;  1EH8 A;  1A1F A;  1XMO E;  2EOE A;  1T4L B;  3VK6 A;  4DR7 E;  4O4K A;  2EP3 A;  3KZY A;  2UUA E;  2LJH A;  1PJS A;  2EMH A;  1GZ6 A;  3JAM C;  4R2S A;  4M9V C;  5AC4 A;  2EMZ A;  4TUG A;  2EMW A;  3VYX A;  1GTK A;  3OTO E;  2K4V A;  2B9D A;  2EM5 A;  2MC6 A;  4GEQ B;  2HC5 A;  3MSW A;  4BCA A;  2EPM X;  2L2N A;  4X8W A;  2DMY A;  4O24 A;  2V8Q B;  2E5L E;  4DV7 E;  1AAY A;  1DQ3 A;  1FJG E;  2F8B A;  1NEI A;  4X9J A;  2RQL A;  5AE2 A;  3RMP A;  2RS6 A;  2VE7 C;  2VQF E;  3L00 A;  1IBL E;  4BMJ A;  3BID A;  2PRT A;  4RHB B;  1XNQ E;  2EJ4 A;  1YUJ A;  2JY9 A;  2RTX A;  1STU A;  3KZZ A;  1J5E E;  3C4T A;  2EMC A;  2EQ1 A;  2NAB A;  1G2F C;  5IV8 B;  2V89 A;  4KHP E;  3C4B A;  2YU8 A;  1NCS A;  3J7A G;  1Z1B A;  1HNX E;  2EOF A;  1A1H A;  4LF8 E;  4ZYG A;  5KL7 A;  4WFT A;  2ELZ A;  1N33 E;  4IS1 C;  4NXM E;  1HNW E;  2MKD A;  2E1M A;  2EOX A;  1SR9 A;  2WCC 3;  2LTS A;  3T1Y E;  1X3C A;  1QNT A;  2FGG A;  1N32 E;  2ENC A;  4YHH E;  4J8Z A;  2ENH A;  2EM9 A;  2L2K B;  4DR2 E;  1KYQ A;  5KL4 A;  3JU0 A;  4WXD A;  2UXC E;  1J26 A;  4NZV A;  5IWA E;  2EQ3 A;  2L3J A;  2JOB A;  2V87 A;  2YWQ A;  2YTJ A;  4YY3 E;  4DR3 E;  3QG5 C;  3UK3 C;  2M4I A;  2VF1 A;  3J7Y p;  2NUG A;  2YTG A;  5FLX C;  2N8X A;  2YRK A;  3FIG A;  1YYW A;  2EN8 A;  1I94 E;  3BGH A;  2IHR 1;  4BC7 A;  2EWL A;  5AE3 A;  2L92 A;  2N3G A;  2UU9 E;  5A6B D;  4B3M E;  2UXD E;  2YTQ A;  2YTI A;  1YYO A;  5LMU E;  3MHH C;  2MDR A;  2JXP A;  4LFC E;  2FV4 B;  4LTY A;  1GQE A;  1TN9 A;  4LF7 E;  4ZYH A;  3VHT B;  4JV5 E;  4DUY E;  2JR1 A;  4R2P A;  2NUE A;  3ECR A;  2LE2 A;  1X49 A;  3ADL A;  4O43 A;  2L8T A;  3BBG A;  3F6G A;  4F2J C;  5LMN E;  2EM6 A;  1BBO A;  3IWD A;  2V88 A;  2LV2 A;  2M1S A;  4X62 E;  2A25 A;  1ZU1 A;  1JK1 A;  2EOR A;  2EMF A;  2EOI A;  2WBT A;  2ZM6 E;  5IT9 C;  4F6M A;  1YUI A;  2YRH A;  1A1G A;  2EOM A;  2EM7 A;  1QU6 A;  3EPK A;  1XMQ E;  2EOO A;  2EN4 A;  4LFB E;  2YPN A;  3OML A;  2WBU A;  2UXB E;  2YZT A;  1L4S A;  2CSH A;  4WPY A;  4DR4 E;  3DJW A;  2L2M A;  3AUZ A;  2CT1 A;  3M99 B;  4R2C A;  4X64 E;  2L3C A;  2YRM A;  2DSY A;  2RS7 A;  3THN A;  4DV1 E;  1B69 A;  2EPP A;  2EM0 A;  4DV4 E;  4B3T E;  1UN6 B;  5KL3 A;  2N3H A;  5BR8 E;  4R2D A;  5TSE A;  1XNR E;  5KL2 A;  4NXN E;  2EMX A;  2LBS B;  4R2R A;  1T39 A;  2RSM A;  4MLV A;  2EM8 A;  2I9I A;  4AQY E;  5IXM B;  1PJT A;  4DR1 E;  4DV3 E;  2L33 A;  3BF2 A;  2YTF A;  1T38 A;  4WX9 A;  5A6A A;  2EPZ A;  1FKA E;  4M0V A;  4KWY A;  3EPJ A;  4DR6 E;  3IWB A;  3HTX A;  4LU9 A;  2LT7 A;  2F4V E;  3HPS A;  2EMB A;  4BBY A;  2M7Q A;  4JI1 E;  4I8O A;  4DKK A;  5AAS A;  2EL4 A;  2YTP A;  2EML A;  2YTO A;  2JWO A;  2R1F A;  2EPL X;  4R2E A;  4F9B B;  2RSI A;  3IWC A;  4HTG A;  2HGH A;  4JI0 E;  2JVA A;  2EPN A;  1AH5 A;  2GLI A;  1WJP A;  5A6K A;  2EOQ A;  5KL6 A;  4FK5 C;  1HR0 E;  2LUP B;  2KOU A;  2MDG A;  4LF6 E;  5ADZ A;  3DF6 A;  4R2Q A;  3T1H E;  3J81 C;  3EPH A;  1X6F A;  2EOJ A;  2ADR A;  1BBG A;  4JI8 E;  3ZOQ B;  2EM2 A;  3KWR A;  1MGT A;  2B7T A;  4BS9 A;  2VQE E;  4R8O A;  2YSO A;  2EPR A;  4JI4 E;  2EZ6 A;  5AC5 A;  2NUF A;  2I13 A;  4JYA E;  5AE1 A;  4LF9 E;  4N4R B;  2EM4 A;  4GKK E;  4F54 A;  5DNY A;  2EOH A;  1BB8 A;  4JI5 E;  4O5G A;  4KZS A;  1RC7 A;  2DGC A;  1YYK A;  2YSP A;  1EH7 A;  1A1K A;  2UUB E;  3F6H A;  2EPC A;  2DIX A;  4F9C B;  2DLQ A;  2CPN A;  2H36 X;  4WSG A;  5KL5 A;  2EL6 A;  2EN7 A;  2LCE A;  4WSP A;  3J80 C;  2JOX A;  2L6M A;  1IBK E;  5F3W A;  4DMI A;  4P7D A;  4NHR A;  1N34 E;  2FTX B;  2E72 A;  1X48 A;  1EKZ A;  4JI3 E;  2HHH E;  4WXC A;  1LLM C;  2LVH A;  2EE8 A;  3HXL A;  4L8N A;  2BBG A;  4MLQ A;  4P78 A;  4L5N C;  1MEY C;  1RQ0 A;  4GKJ E;  2HJJ A;  2LRS A;  4TUI A;  3MHS C;  4BHB A;  1YSA C;  2EMK A;  2EMI A;  1JK2 A;  1ZR9 A;  1UBD C;  2D9H A;  2EM3 A;  3EPL A;  1F2I G;  2BB8 A;  1PJQ A;  2ENA A;  4OOG C;  2K7I A;  2G7H A;  4F9A B;  1WXR A;  3EQ1 A;  1WHQ A;  4DV5 E;  4HEI A;  4DUZ E;  1RMD A;  3H09 A;  2NA2 A;  3ADJ A;  1WRJ A;  2DMI A;  2LO3 A;  4R03 A;  2GHF A;  3LML A;  2EPU A;  1PDA A;  1ZAA C;  4M2Z A;  2EPO A;  4B3S E;  2YTE A;  1UHZ A;  4GZN C;  1UIL A;  5A2Q C;  4Q28 A;  4Q35 B;  3JTZ A;  2Q8U A;  4X66 E;  3C6M A;  4IJD A;  1WHN A;  1ZBT A;  1PKP A;  2ELY A;  3ADI A;  3P1X A;  5A6B A;  2EN1 A;  2CTD A;  1O0W A;  1A1J A;  4LFA E;  2EN3 A;  1N36 E;  2VRD A;  2EMG A;  4LF5 E;  2RPC A;  1YZ9 A;  1DGC A;  2LMZ A;  1X47 A;  1YFH A;  2YT4 A;  2DRP A;  2B3T B;  2EPK X;  4DV6 E;  2GPI A;  2V83 A;  4B3R E;  4ZYE A;  1IMU A;  2EQ0 A;  4M30 A;  4DV2 E;  1IBM E;  2EL5 A;  2EMA A;  3AV0 A;  5A69 A;  5T6J A;  1DI2 A;  4BC9 A;  1IQS A;  2YTN A;  2EPX A;  3HQ1 A;  2EN6 A;  3ADG A;  1TF3 A;  1A1I A;  2EOY A;  1X5W A;  4DR5 E;  4F6N A;  1HNZ E;  1KJK A;  1TF6 A;  4BHC A;  1P47 A;  2WZO A;  2YU5 A;  2ODR D;  4R2A A;  2J7J A;  4ZYD A;  2YTD A;  4WYQ B;  1EH6 A;  2LJU A;  4X65 E;  4JI7 E;  2JP9 A;  1X6H A;  2B7V A;  2M9A A;  3TQM A;  4DV0 E;  2EMY A;  2JYA A;  4JI6 E;  2EOS A;  1IQO A;  1SFE A;  1N3G A;  4LF4 E;  2EN2 A; 
#chains in the Genus database with same CATH homology
 2RSM A;  3T1Y E;  2FGG A;  1N32 E;  1RQ0 A;  4JI2 E;  5CFF E;  4YHH E;  3K6Q A;  4GKJ E;  4J8Z A;  2LRS A;  4OX9 E;  4TUI A;  2L2K B;  4DR2 E;  2V86 A;  4AQY E;  3JU0 A;  4DR1 E;  2KHX A;  2UXC E;  4DV3 E;  5IWA E;  1J26 A;  2L33 A;  2L3J A;  2JOB A;  2V87 A;  2MC5 A;  4YY3 E;  4DR3 E;  3VYY A;  2M4I A;  2VF1 A;  2LUQ A;  3J7Y p;  2NUG A;  1FKA E;  4M0V A;  5FLX C;  3FIG A;  4OOG C;  1YYW A;  2G7H A;  3IWB A;  2ODR C;  4LU9 A;  4F9A B;  2UUC E;  3HPS A;  3HTX A;  2F4V E;  4BBY A;  1WXR A;  2KON A;  2M7Q A;  1I94 E;  4JI1 E;  1WHQ A;  4DV5 E;  4K0K E;  4I8O A;  2IHR 1;  4DUZ E;  4BC7 A;  2DB2 A;  2EWL A;  4DKK A;  5AAS A;  2LTR A;  2NA2 A;  3H09 A;  5LL6 R;  2L92 A;  2N3G A;  4P78 A;  3LLH A;  5AE3 A;  2UU9 E;  4B3M E;  2UXD E;  3ADJ A;  2V85 A;  1YYO A;  1T4O A;  5LMU E;  1ZBQ A;  2JWO A;  1T4N A;  2MDR A;  3HPZ A;  4F9B B;  4LFC E;  4R03 A;  2FV4 B;  3IWC A;  3LML A;  4LTY A;  1GQE A;  1XMO E;  4LF7 E;  4JI0 E;  2JVA A;  1T4L B;  4JV5 E;  4M2Z A;  3VK6 A;  4DR7 E;  4DUY E;  2JR1 A;  2UUA E;  2LJH A;  4B3S E;  2NUE A;  1UHZ A;  1UIL A;  4DR6 E;  1GZ6 A;  2LE2 A;  1X49 A;  3JAM C;  5A2Q C;  3ADL A;  2L8T A;  4Q28 A;  3JTZ A;  3F6G A;  5LMN E;  1HR0 E;  4X66 E;  2KOU A;  2LUP B;  4LF6 E;  5ADZ A;  3IWD A;  3DF6 A;  1WHN A;  3T1H E;  4TUG A;  1ZBT A;  3J81 C;  1PKP A;  3ADI A;  3VYX A;  3P1X A;  4JI8 E;  3OTO E;  3ZOQ B;  1O0W A;  2V88 A;  2K4V A;  3KWR A;  2B7T A;  2M1S A;  4BS9 A;  2B9D A;  2VQE E;  2MC6 A;  4R8O A;  4X62 E;  4GEQ B;  3MSW A;  4LFA E;  1N36 E;  4JI4 E;  4BCA A;  2EZ6 A;  4LF5 E;  2ZM6 E;  5IT9 C;  1YZ9 A;  2LMZ A;  2L2N A;  2NUF A;  4X8W A;  4JYA E;  2DMY A;  5AE1 A;  1X47 A;  4LF9 E;  4GKK E;  2V8Q B;  2YT4 A;  2E5L E;  2B3T B;  4F54 A;  4DV7 E;  5DNY A;  4DV6 E;  1DQ3 A;  1FJG E;  2V83 A;  4B3R E;  1QU6 A;  2F8B A;  1XMQ E;  4M30 A;  4JI5 E;  4LFB E;  4DV2 E;  4KZS A;  5AE2 A;  1RC7 A;  1IBM E;  1YYK A;  3OML A;  3RMP A;  2RS6 A;  2VE7 C;  2VQF E;  2UXB E;  1IBL E;  4BMJ A;  3AV0 A;  1XNQ E;  2YZT A;  5T6J A;  1DI2 A;  4BC9 A;  2UUB E;  2JY9 A;  3F6H A;  4WPY A;  4DR4 E;  3HQ1 A;  3ADG A;  2RTX A;  1STU A;  1J5E E;  3C4T A;  2L2M A;  3DJW A;  4DR5 E;  3AUZ A;  2DIX A;  4F9C B;  1HNZ E;  4X64 E;  2H36 X;  2CPN A;  2L3C A;  2V89 A;  4KHP E;  2WZO A;  3C4B A;  2DSY A;  2ODR D;  2RS7 A;  3J7A G;  4WYQ B;  4DV1 E;  1HNX E;  4WSP A;  4X65 E;  4JI7 E;  2JOX A;  3J80 C;  2L6M A;  4LF8 E;  4WFT A;  1IBK E;  2B7V A;  4DV4 E;  5F3W A;  4DMI A;  4B3T E;  4P7D A;  1N34 E;  2FTX B;  1X48 A;  2N3H A;  5BR8 E;  4DV0 E;  1EKZ A;  4JI3 E;  4JI6 E;  1N33 E;  2HHH E;  1XNR E;  4NXM E;  3HXL A;  4NXN E;  1HNW E;  2LBS B;  2E1M A;  4L8N A;  4LF4 E;  1SR9 A;  4L5N C;  2LTS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...