1NEIA

Solution nmr structure of protein yoag from escherichia coli. ontario centre for structural proteomics target ec0264_1_60; northeast structural genomics consortium target et94.
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
60
structure length
60
Chain Sequence
MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein yoaG
publication title Solution structure of hypothetical protein dimer encoded by the Yoag gene from Escherichia coli
rcsb
source organism Escherichia coli
total genus 9
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08956 DUF1869 Domain of unknown function (DUF1869)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.220 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain YoaG 1neiA00
1NEIA
chains in the Genus database with same CATH superfamily
2EL4A 2YTEA 2EOJA 3J7Yp 5BR8E 1YUIA 3ZOQB 4BHCA 3DF6A 3HXLA 4FK5C 2B3TB 2B7VA 2MC6A 3C4BA 3KZZA 2YTJA 2HC5A 1KYQA 3ECRA 1A1LA 4JI1E 2ODRC 4WSPA 2EOHA 3J81C 3VYXA 4DV5E 3P1XA 4K0KE 1AH5A 3QG5C 4LF9E 4MLVA 2FGGA 5A6KA 2EMAA 2ENHA 2EOOA 2EN8A 4R2PA 2LUPB 2E1MA 1RC7A 2HHHE 4WXDA 2B7TA 2DRPA 3FIGA 2EM6A 4Q35B 2D9HA 4DR1E 2EOQA 1YYWA 2KHXA 1X6EA 4RH8A 2YTFA 2RQLA 2E5LE 4L8NA 5AC5A 2M4IA 3EPHA 4HTGA 2L2NA 4O24A 2MC5A 2EMZA 2WBUA 1N33E 4WPYA 2L3JA 2EPUA 4LFBE 1HNXE 2EN3A 2EM2A 2EMHA 3BF2A 4B3RE 1JK1A 4DUZE 2EM5A 2WZOA 4LFAE 2JVAA 2UXDE 4R2AA 2ELYA 2JYAA 2EPPA 2LJUA 2MDRA 1RMDA 2EORA 5A6BD 4F2JC 1YSAC 4DV7E 1A1IA 4R2SA 4GZNC 1TF3A 2LV2A 2YSOA 1MGTA 2DLKA 1RQ0A 1YYKA 3AUZA 4JI3E 1YPNA 2ODRD 2YRHA 2EOIA 2CPNA 4B3TE 5KL2A 1I94E 4R2CA 4Q28A 1J26A 2MKDA 1XMQE 1UILA 4DMIA 2JWOA 5KL5A 2NUGA 1N34E 2N3GA 2EQ0A 2YRMA 1A1HA 3HPSA 4LF5E 4ZYEA 1T4NA 2N8XA 2I9IA 4F9BB 3L00A 2LE2A 5KL4A 2CTDA 4NHRA 2VE7C 2RSIA 3ADJA 4LF7E 4BHBA 2EQ1A 2DLQA 2EPOA 2L6MA 2CSHA 3BIDA 2YU8A 3RMPA 4J8ZA 3UK3C 4DR3E 1SR9A 4F9AB 2EPAA 2JY9A 2EZ6A 4KWYA 3EQ1A 3IWDA 4JI7E 2Q8UA 3HTXA 2EOMA 1WRJA 2FV4B 2EOEA 4P7DA 2YT4A 4BC9A 4DV2E 4RHBB 1TF6A 2EN1A 4LTYA 4X65E 1X3CA 2EMIA 2JP9A 4B3ME 1J5EE 5LMUE 2LT7A 2VRDA 4OOGC 5IT9C 4JI0E 2EN4A 1YYOA 2JOXA 2EP3A 5IXMB 3T1YE 2F4VE 2NA2A 2UXCE 1IBME 2RSMA 4LFCE 2WBTA 4F6MA 5F3WA 2YSPA 2UUCE 4JI5E 1A1JA 1P47A 1ZU1A 2H36X 4JI8E 3EPJA 2LBSB 2LJHA 2M1SA 4LF4E 2L8TA 2V87A 2EOFA 3LMLA 2LUQA 2I13A 5CFFE 1EH7A 2HGHA 2JR1A 5DNYA 3JU0A 1QU6A 1PJSA 3VYYA 2YTNA 5FLXC 2JPAA 3C4TA 2L92A 4NXNE 1LLMC 2YTQA 2N3HA 3C6KA 1UN6B 2JOBA 1XNRE 4O43A 2NABA 1DGCA 2EWLA 4F54A 1EH6A 2LTRA 3LLHA 1ZBTA 3VK6A 2WCC3 1TN9A 5A69A 2EMCA 2V86A 3JTZA 4DR2E 2V83A 1QNTA 2V89A 4GKKE 2JXPA 1ZAAC 4JYAE 2EQ3A 1N3GA 2VF1A 2K4VA 3THNA 2LTSA 4JI4E 1BBGA 4X62E 5A6AA 4NZVA 4DR6E 5AE1A 2EM0A 1NEIA 2RTXA 2EMGA 4M30A 5A6BA 2KONA 2ENAA 2L3CA 4R2QA 2NUEA 4TUIA 2M7QA 3K6QA 5LL6R 1KJKA 4ZYHA 2EN7A 2EPCA 2M9AA 2EPKX 2EM8A 1X49A 2BB8A 2J7JA 1T39A 1XNQE 3F6HA 2EL5A 2EN6A 5A2QC 2EL6A 2EE8A 2R76A 2RS7A 1X48A 1UBDC 3J7AG 2EM7A 2WBSA 3KZYA 1DI2A 1T4LB 1HR0E 2V88A 3H09A 4BCAA 2L2KB 2ADRA 1T4OA 2LMZA 3HQ1A 2ZM6E 1NCSA 4B3SE 4N4RB 1T38A 1IBLE 4I8OA 4WXCA 2EPMX 1XMOE 1GTKA 2EMBA 1MEYC 2ELZA 2EN2A 5KL6A 2EOYA 2LCEA 4DR5E 4F9CB 4LU9A 2R1FA 2NUFA 4JI6E 2VQFE 2GPIA 4R03A 3ADIA 5KL3A 1G2DC 1GZ6A 1EKZA 2V8QB 2EJ4A 1FKAE 4KZSA 4F6NA 5AE2A 1SFEA 4DV6E 4DV0E 2K7IA 4BS9A 4ZYDA 1BBOA 2V85A 2EMFA 2EPRA 3MHHC 1IQSA 1HNWE 5IWAE 4NXME 2RPCA 4GEQB 1A1GA 1A1FA 4L5NC 3IWBA 4M2ZA 4IS1C 4LF8E 1X6HA 1DQ3A 2YPNA 4P78A 4DR4E 4X8WA 2F8BA 4OX9E 3T1HE 2EOXA 1ZBQA 4DV3E 4LF6E 4R2EA 1N36E 4GKJE 4JI2E 4R8OA 2EMYA 4AQYE 2RS6A 2LRSA 2DMIA 2EM9A 1L4SA 2YZTA 4BC7A 4DKKA 1EH8A 2EMKA 2DSYA 3DJWA 3TQMA 5AE3A 4DUYE 2EOZA 2YU5A 2EM4A 4M0VA 3MHSC 4WX9A 2DMYA 2DIXA 1O0WA 1X6FA 5ADZA 2BBGA 3IWCA 2ENCA 2HJJA 3BGHA 2YTPA 4HEIA 2YWQA 4X66E 4ZYGA 2GHFA 3VHTB 1PDAA 4BMJA 4BBYA 2UUAE 2EMXA 4YY3E 1WHNA 1AAYA 2YTDA 2GLIA 2EPNA 1B69A 1F2IG 1IQOA 1YFHA 4DV1E 3OMLA 4MLQA 1PJTA 2VQEE 2YTGA 2MDGA 2LO3A 4R2DA 3BBGA 3M99B 4IJDA 4YHHE 2YTIA 4DR7E 3HPZA 1WHQA 1FJGE 2EPXA 1G2FC 1X47A 2FTXB 5TSEA 1WXRA 1ZR9A 2MKNA 1IMUA 5AASA 1Z1BA 1IBKE 2B9DA 1STUA 3OTOE 1BB8A 2UUBE 1PJQA 1X5WA 4M9VC 2CT1A 3EPKA 3J80C 5A6JA 4WFTA 3KWRA 3MSWA 2L2MA 1JK2A 3ADLA 3F6GA 4O4KA 4TUGA 2IHR1 5LLQA 4X9JA 3EPLA 2KOUA 4DV4E 1YUJA 5KL7A 2DB2A 5T6JA 3ADGA 3C6MA 4WSGA 2EM3A 4KHPE 4X64E 2UU9E 2LVHA 1UHZA 2EPLX 2E72A 1PKPA 5AC4A 1N32E 1A1KA 1HNZE 2EPZA 2EMLA 2L33A 5LMNE 2EMWA 3JAMC 2EOSA 1GQEA 2PRTA 3THOB 4JV5E 2UXBE 4R2RA 4O5GA 4WYQB 1WJPA 3AV0A 5IV8B 2DGCA 2YRKA 2YTOA 1YZ9A 2G7HA 2A25A
chains in the Genus database with same CATH topology
1NEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NEI A; 
#chains in the Genus database with same CATH topology
 2EL4 A;  2YTE A;  2EOJ A;  3J7Y p;  5BR8 E;  1YUI A;  3ZOQ B;  4BHC A;  3DF6 A;  3HXL A;  4FK5 C;  2B3T B;  2B7V A;  2MC6 A;  3C4B A;  3KZZ A;  2YTJ A;  2HC5 A;  1KYQ A;  3ECR A;  1A1L A;  4JI1 E;  2ODR C;  4WSP A;  2EOH A;  3J81 C;  3VYX A;  4DV5 E;  3P1X A;  4K0K E;  1AH5 A;  3QG5 C;  4LF9 E;  4MLV A;  2FGG A;  5A6K A;  2EMA A;  2ENH A;  2EOO A;  2EN8 A;  4R2P A;  2LUP B;  2E1M A;  1RC7 A;  2HHH E;  4WXD A;  2B7T A;  2DRP A;  3FIG A;  2EM6 A;  4Q35 B;  2D9H A;  4DR1 E;  2EOQ A;  1YYW A;  2KHX A;  1X6E A;  4RH8 A;  2YTF A;  2RQL A;  2E5L E;  4L8N A;  5AC5 A;  2M4I A;  3EPH A;  4HTG A;  2L2N A;  4O24 A;  2MC5 A;  2EMZ A;  2WBU A;  1N33 E;  4WPY A;  2L3J A;  2EPU A;  4LFB E;  1HNX E;  2EN3 A;  2EM2 A;  2EMH A;  3BF2 A;  4B3R E;  1JK1 A;  4DUZ E;  2EM5 A;  2WZO A;  4LFA E;  2JVA A;  2UXD E;  4R2A A;  2ELY A;  2JYA A;  2EPP A;  2LJU A;  2MDR A;  1RMD A;  2EOR A;  5A6B D;  4F2J C;  1YSA C;  4DV7 E;  1A1I A;  4R2S A;  4GZN C;  1TF3 A;  2LV2 A;  2YSO A;  1MGT A;  2DLK A;  1RQ0 A;  1YYK A;  3AUZ A;  4JI3 E;  1YPN A;  2ODR D;  2YRH A;  2EOI A;  2CPN A;  4B3T E;  5KL2 A;  1I94 E;  4R2C A;  4Q28 A;  1J26 A;  2MKD A;  1XMQ E;  1UIL A;  4DMI A;  2JWO A;  5KL5 A;  2NUG A;  1N34 E;  2N3G A;  2EQ0 A;  2YRM A;  1A1H A;  3HPS A;  4LF5 E;  4ZYE A;  1T4N A;  2N8X A;  2I9I A;  4F9B B;  3L00 A;  2LE2 A;  5KL4 A;  2CTD A;  4NHR A;  2VE7 C;  2RSI A;  3ADJ A;  4LF7 E;  4BHB A;  2EQ1 A;  2DLQ A;  2EPO A;  2L6M A;  2CSH A;  3BID A;  2YU8 A;  3RMP A;  4J8Z A;  3UK3 C;  4DR3 E;  1SR9 A;  4F9A B;  2EPA A;  2JY9 A;  2EZ6 A;  4KWY A;  3EQ1 A;  3IWD A;  4JI7 E;  2Q8U A;  3HTX A;  2EOM A;  1WRJ A;  2FV4 B;  2EOE A;  4P7D A;  2YT4 A;  4BC9 A;  4DV2 E;  4RHB B;  1TF6 A;  2EN1 A;  4LTY A;  4X65 E;  1X3C A;  2EMI A;  2JP9 A;  4B3M E;  1J5E E;  5LMU E;  2LT7 A;  2VRD A;  4OOG C;  5IT9 C;  4JI0 E;  2EN4 A;  1YYO A;  2JOX A;  2EP3 A;  5IXM B;  3T1Y E;  2F4V E;  2NA2 A;  2UXC E;  1IBM E;  2RSM A;  4LFC E;  2WBT A;  4F6M A;  5F3W A;  2YSP A;  2UUC E;  4JI5 E;  1A1J A;  1P47 A;  1ZU1 A;  2H36 X;  4JI8 E;  3EPJ A;  2LBS B;  2LJH A;  2M1S A;  4LF4 E;  2L8T A;  2V87 A;  2EOF A;  3LML A;  2LUQ A;  2I13 A;  5CFF E;  1EH7 A;  2HGH A;  2JR1 A;  5DNY A;  3JU0 A;  1QU6 A;  1PJS A;  3VYY A;  2YTN A;  5FLX C;  2JPA A;  3C4T A;  2L92 A;  4NXN E;  1LLM C;  2YTQ A;  2N3H A;  3C6K A;  1UN6 B;  2JOB A;  1XNR E;  4O43 A;  2NAB A;  1DGC A;  2EWL A;  4F54 A;  1EH6 A;  2LTR A;  3LLH A;  1ZBT A;  3VK6 A;  2WCC 3;  1TN9 A;  5A69 A;  2EMC A;  2V86 A;  3JTZ A;  4DR2 E;  2V83 A;  1QNT A;  2V89 A;  4GKK E;  2JXP A;  1ZAA C;  4JYA E;  2EQ3 A;  1N3G A;  2VF1 A;  2K4V A;  3THN A;  2LTS A;  4JI4 E;  1BBG A;  4X62 E;  5A6A A;  4NZV A;  4DR6 E;  5AE1 A;  2EM0 A;  1NEI A;  2RTX A;  2EMG A;  4M30 A;  5A6B A;  2KON A;  2ENA A;  2L3C A;  4R2Q A;  2NUE A;  4TUI A;  2M7Q A;  3K6Q A;  5LL6 R;  1KJK A;  4ZYH A;  2EN7 A;  2EPC A;  2M9A A;  2EPK X;  2EM8 A;  1X49 A;  2BB8 A;  2J7J A;  1T39 A;  1XNQ E;  3F6H A;  2EL5 A;  2EN6 A;  5A2Q C;  2EL6 A;  2EE8 A;  2R76 A;  2RS7 A;  1X48 A;  1UBD C;  3J7A G;  2EM7 A;  2WBS A;  3KZY A;  1DI2 A;  1T4L B;  1HR0 E;  2V88 A;  3H09 A;  4BCA A;  2L2K B;  2ADR A;  1T4O A;  2LMZ A;  3HQ1 A;  2ZM6 E;  1NCS A;  4B3S E;  4N4R B;  1T38 A;  1IBL E;  4I8O A;  4WXC A;  2EPM X;  1XMO E;  1GTK A;  2EMB A;  1MEY C;  2ELZ A;  2EN2 A;  5KL6 A;  2EOY A;  2LCE A;  4DR5 E;  4F9C B;  4LU9 A;  2R1F A;  2NUF A;  4JI6 E;  2VQF E;  2GPI A;  4R03 A;  3ADI A;  5KL3 A;  1G2D C;  1GZ6 A;  1EKZ A;  2V8Q B;  2EJ4 A;  1FKA E;  4KZS A;  4F6N A;  5AE2 A;  1SFE A;  4DV6 E;  4DV0 E;  2K7I A;  4BS9 A;  4ZYD A;  1BBO A;  2V85 A;  2EMF A;  2EPR A;  3MHH C;  1IQS A;  1HNW E;  5IWA E;  4NXM E;  2RPC A;  4GEQ B;  1A1G A;  1A1F A;  4L5N C;  3IWB A;  4M2Z A;  4IS1 C;  4LF8 E;  1X6H A;  1DQ3 A;  2YPN A;  4P78 A;  4DR4 E;  4X8W A;  2F8B A;  4OX9 E;  3T1H E;  2EOX A;  1ZBQ A;  4DV3 E;  4LF6 E;  4R2E A;  1N36 E;  4GKJ E;  4JI2 E;  4R8O A;  2EMY A;  4AQY E;  2RS6 A;  2LRS A;  2DMI A;  2EM9 A;  1L4S A;  2YZT A;  4BC7 A;  4DKK A;  1EH8 A;  2EMK A;  2DSY A;  3DJW A;  3TQM A;  5AE3 A;  4DUY E;  2EOZ A;  2YU5 A;  2EM4 A;  4M0V A;  3MHS C;  4WX9 A;  2DMY A;  2DIX A;  1O0W A;  1X6F A;  5ADZ A;  2BBG A;  3IWC A;  2ENC A;  2HJJ A;  3BGH A;  2YTP A;  4HEI A;  2YWQ A;  4X66 E;  4ZYG A;  2GHF A;  3VHT B;  1PDA A;  4BMJ A;  4BBY A;  2UUA E;  2EMX A;  4YY3 E;  1WHN A;  1AAY A;  2YTD A;  2GLI A;  2EPN A;  1B69 A;  1F2I G;  1IQO A;  1YFH A;  4DV1 E;  3OML A;  4MLQ A;  1PJT A;  2VQE E;  2YTG A;  2MDG A;  2LO3 A;  4R2D A;  3BBG A;  3M99 B;  4IJD A;  4YHH E;  2YTI A;  4DR7 E;  3HPZ A;  1WHQ A;  1FJG E;  2EPX A;  1G2F C;  1X47 A;  2FTX B;  5TSE A;  1WXR A;  1ZR9 A;  2MKN A;  1IMU A;  5AAS A;  1Z1B A;  1IBK E;  2B9D A;  1STU A;  3OTO E;  1BB8 A;  2UUB E;  1PJQ A;  1X5W A;  4M9V C;  2CT1 A;  3EPK A;  3J80 C;  5A6J A;  4WFT A;  3KWR A;  3MSW A;  2L2M A;  1JK2 A;  3ADL A;  3F6G A;  4O4K A;  4TUG A;  2IHR 1;  5LLQ A;  4X9J A;  3EPL A;  2KOU A;  4DV4 E;  1YUJ A;  5KL7 A;  2DB2 A;  5T6J A;  3ADG A;  3C6M A;  4WSG A;  2EM3 A;  4KHP E;  4X64 E;  2UU9 E;  2LVH A;  1UHZ A;  2EPL X;  2E72 A;  1PKP A;  5AC4 A;  1N32 E;  1A1K A;  1HNZ E;  2EPZ A;  2EML A;  2L33 A;  5LMN E;  2EMW A;  3JAM C;  2EOS A;  1GQE A;  2PRT A;  3THO B;  4JV5 E;  2UXB E;  4R2R A;  4O5G A;  4WYQ B;  1WJP A;  3AV0 A;  5IV8 B;  2DGC A;  2YRK A;  2YTO A;  1YZ9 A;  2G7H A;  2A25 A; 
#chains in the Genus database with same CATH homology
 1NEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...