1NEIA

Solution nmr structure of protein yoag from escherichia coli. ontario centre for structural proteomics target ec0264_1_60; northeast structural genomics consortium target et94.
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
60
structure length
60
Chain Sequence
MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein yoaG
publication title Solution structure of hypothetical protein dimer encoded by the Yoag gene from Escherichia coli
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 9
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08956 DUF1869 Domain of unknown function (DUF1869)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.220 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain YoaG 1neiA00
1NEIA
chains in the Genus database with same CATH superfamily
4DV0E 1G2DC 5KL2A 1GZ6A 4Q28A 2EOXA 1FKAE 2EPAA 4TUGA 4LU9A 3BF2A 4YY3E 4Q35B 2EPOA 3VK6A 4GZNC 2EPMX 1YSAC 3VYXA 4OX9E 2YTGA 5BR8E 4JYAE 2G7HA 1A1JA 3EPKA 2MC6A 2EJ4A 5TSEA 4O5GA 1N33E 5A6KA 1WXRA 2EN1A 4WXDA 3JU0A 4F9AB 4BMJA 1XNQE 2DLKA 3ECRA 4R2DA 3ADJA 1DQ3A 4JI5E 4HTGA 4DV6E 1KJKA 1BBOA 4JI6E 3MHHC 5F3WA 3P1XA 5AASA 2LBSB 3HPZA 2M1SA 2RS7A 2EORA 2N3HA 5IT9C 3J7AG 1QU6A 4DMIA 1YUJA 4X8WA 5ADZA 1SFEA 2EMLA 3IWBA 2UUAE 3BBGA 1X6HA 3HXLA 4R03A 1MEYC 2JWOA 4DUZE 2NABA 4NXNE 2CPNA 4J8ZA 4L5NC 2EMFA 2EN7A 4F54A 1X49A 1ZU1A 2EMGA 2JPAA 4DR3E 4OOGC 1T4LB 5KL7A 2V83A 2EPCA 2RTXA 2YU8A 2EE8A 4R2PA 3OTOE 4DV5E 4DR7E 4ZYGA 4LF8E 1EKZA 2HGHA 2LO3A 4DR5E 2KHXA 2LT7A 2V85A 3T1HE 3DF6A 2V86A 2RSIA 3EPHA 2NA2A 1L4SA 4DV4E 2FGGA 2M7QA 3LMLA 1IBLE 1DI2A 4WYQB 3C4BA 2EN3A 2M9AA 1TF6A 2LVHA 3MSWA 2EMHA 3VHTB 2JOBA 1BBGA 1TF3A 4JI2E 2K7IA 2YTFA 4IS1C 4ZYHA 3VYYA 2JOXA 4O43A 3TQMA 2EL5A 2V89A 1HNXE 2IHR1 3T1YE 4O24A 3C4TA 2L2KB 2MDGA 3JTZA 5AE1A 3JAMC 1A1LA 1STUA 4LF7E 2YT4A 2EMXA 5AE2A 2EPZA 2EOSA 2EMYA 2EOMA 1EH6A 2N3GA 2EOIA 2RS6A 1ZBQA 1X5WA 1I94E 1O0WA 2EPKX 4R2RA 5LMNE 2LJUA 1TN9A 2HHHE 2EOYA 3LLHA 1T39A 5A6JA 2F8BA 4ZYEA 1X6EA 2DSYA 3HPSA 2EM4A 2JVAA 2K4VA 1HNZE 4DV2E 1WJPA 5A2QC 3C6MA 2GLIA 2EPNA 2LJHA 4DR4E 1XNRE 2CSHA 2DB2A 2VF1A 1ZR9A 2EM8A 1ZBTA 4JI4E 3KZZA 4KHPE 4NZVA 2EMWA 2EPPA 2EOFA 2L2MA 4WFTA 3QG5C 4M2ZA 2D9HA 2JY9A 1RQ0A 4R2SA 3L00A 1EH7A 2HC5A 2V8QB 1AH5A 2B3TB 2LRSA 2DLQA 1X3CA 1N34E 1UBDC 2GHFA 4DR6E 2ODRD 1YZ9A 2EN2A 4GKKE 3F6GA 2WBTA 1YYKA 2ENAA 2EM6A 2YPNA 1Z1BA 1J26A 2EOOA 4LTYA 4JI1E 1A1GA 2L33A 4R2AA 2PRTA 2B7VA 4X9JA 2VQEE 2EPLX 4N4RB 4F6NA 1N32E 5T6JA 2EOHA 2YTEA 2UUCE 3IWCA 2UUBE 4JI0E 4WSGA 4R2EA 1IMUA 4F6MA 4M30A 2M4IA 2DMYA 1NCSA 1WRJA 4JI8E 3EPJA 1WHNA 2LTRA 4JI3E 5A6BD 2EOQA 2ELYA 2LMZA 4X65E 2H36X 5A6BA 1YFHA 3J7Yp 1GTKA 1SR9A 2EPUA 2EM5A 4F9CB 1T4OA 2YRMA 5LL6R 5AC4A 2CT1A 4LFCE 1QNTA 5LMUE 2L3CA 4DV7E 5A6AA 2MC5A 2NUEA 4NXME 4ZYDA 1RMDA 1XMOE 2R76A 1WHQA 5LLQA 1IBME 2EMCA 1PJSA 3IWDA 3OMLA 4YHHE 1UHZA 2EMAA 2EM9A 3DJWA 3M99B 3C6KA 4B3RE 1UILA 2E72A 3BIDA 1PKPA 2LCEA 4R2CA 4WSPA 1LLMC 3ADLA 2YZTA 4DKKA 1A1KA 4GKJE 4HEIA 2EM3A 2RQLA 2YSOA 3AV0A 2LUQA 4LF5E 4WPYA 2UU9E 3EQ1A 2YTJA 3MHSC 5AC5A 2ENCA 2N8XA 4BHCA 1AAYA 2CTDA 3ADIA 2EWLA 4FK5C 2MKDA 4BHBA 4X64E 1HNWE 3F6HA 5IV8B 2J7JA 4O4KA 2EPRA 4RH8A 2RPCA 2L8TA 1YYOA 4KZSA 4R2QA 2LUPB 2YTPA 2EP3A 4JV5E 4RHBB 2KOUA 4LF6E 3BGHA 2WBSA 4DV3E 5FLXC 3EPLA 2L2NA 4M9VC 4MLVA 1GQEA 2YRKA 1X48A 1PJQA 3HQ1A 4MLQA 4LF9E 2DGCA 4BC9A 4DR2E 1KYQA 4TUIA 1HR0E 1A1HA 2E5LE 2NUGA 1FJGE 2YTDA 4LFBE 1DGCA 2EN6A 2EM7A 1EH8A 2ENHA 2EM0A 4P7DA 4DV1E 4F2JC 2EZ6A 5KL4A 2BB8A 2EN8A 2Q8UA 3KWRA 2YTIA 3ADGA 2V87A 4B3ME 1N3GA 2F4VE 2EMBA 2LTSA 2R1FA 4R8OA 2NUFA 2YTQA 2JYAA 1J5EE 5KL5A 2L6MA 4F9BB 1YUIA 2JP9A 4M0VA 3THOB 2YU5A 5IXMB 2DIXA 2LE2A 1PDAA 1XMQE 1JK1A 2V88A 2FTXB 5A69A 3J81C 1A1IA 2ODRC 3HTXA 1P47A 1N36E 2EL6A 2ZM6E 2B7TA 2KONA 4X66E 4WXCA 2DRPA 4AQYE 1UN6B 2MKNA 1A1FA 2A25A 1X47A 1B69A 4P78A 5CFFE 2YRHA 2ADRA 4GEQB 2YWQA 4L8NA 4LF4E 4BC7A 4WX9A 1ZAAC 2UXDE 2VE7C 4K0KE 2EMIA 2I9IA 2L3JA 1F2IG 2WBUA 4JI7E 2EOEA 2EOZA 3THNA 4DR1E 2EL4A 4IJDA 1G2FC 2E1MA 2UXCE 5KL6A 4LFAE 1BB8A 2EPXA 2JXPA 1JK2A 2RSMA 2EOJA 2EN4A 3ZOQB 5DNYA 1IQOA 4BBYA 1NEIA 2LV2A 4NHRA 1T38A 2EQ3A 3UK3C 2VRDA 1YYWA 2FV4B 4KWYA 2ELZA 2L92A 1IBKE 1X6FA 1YPNA 4BS9A 5IWAE 4DUYE 3H09A 3K6QA 2EM2A 2JR1A 1MGTA 3J80C 2WCC3 3FIGA 1PJTA 2UXBE 1IQSA 3AUZA 2EQ1A 2GPIA 4I8OA 3RMPA 2EQ0A 4B3TE 4X62E 2YTNA 2EMKA 4BCAA 2YTOA 1T4NA 2BBGA 2WZOA 2VQFE 4B3SE 2EMZA 2YSPA 5KL3A 2DMIA 2B9DA 5AE3A 2HJJA 2MDRA 3KZYA 2I13A 1RC7A
chains in the Genus database with same CATH topology
1NEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NEI A; 
#chains in the Genus database with same CATH topology
 4DV0 E;  1G2D C;  5KL2 A;  1GZ6 A;  4Q28 A;  2EOX A;  1FKA E;  2EPA A;  4TUG A;  4LU9 A;  3BF2 A;  4YY3 E;  4Q35 B;  2EPO A;  3VK6 A;  4GZN C;  2EPM X;  1YSA C;  3VYX A;  4OX9 E;  2YTG A;  5BR8 E;  4JYA E;  2G7H A;  1A1J A;  3EPK A;  2MC6 A;  2EJ4 A;  5TSE A;  4O5G A;  1N33 E;  5A6K A;  1WXR A;  2EN1 A;  4WXD A;  3JU0 A;  4F9A B;  4BMJ A;  1XNQ E;  2DLK A;  3ECR A;  4R2D A;  3ADJ A;  1DQ3 A;  4JI5 E;  4HTG A;  4DV6 E;  1KJK A;  1BBO A;  4JI6 E;  3MHH C;  5F3W A;  3P1X A;  5AAS A;  2LBS B;  3HPZ A;  2M1S A;  2RS7 A;  2EOR A;  2N3H A;  5IT9 C;  3J7A G;  1QU6 A;  4DMI A;  1YUJ A;  4X8W A;  5ADZ A;  1SFE A;  2EML A;  3IWB A;  2UUA E;  3BBG A;  1X6H A;  3HXL A;  4R03 A;  1MEY C;  2JWO A;  4DUZ E;  2NAB A;  4NXN E;  2CPN A;  4J8Z A;  4L5N C;  2EMF A;  2EN7 A;  4F54 A;  1X49 A;  1ZU1 A;  2EMG A;  2JPA A;  4DR3 E;  4OOG C;  1T4L B;  5KL7 A;  2V83 A;  2EPC A;  2RTX A;  2YU8 A;  2EE8 A;  4R2P A;  3OTO E;  4DV5 E;  4DR7 E;  4ZYG A;  4LF8 E;  1EKZ A;  2HGH A;  2LO3 A;  4DR5 E;  2KHX A;  2LT7 A;  2V85 A;  3T1H E;  3DF6 A;  2V86 A;  2RSI A;  3EPH A;  2NA2 A;  1L4S A;  4DV4 E;  2FGG A;  2M7Q A;  3LML A;  1IBL E;  1DI2 A;  4WYQ B;  3C4B A;  2EN3 A;  2M9A A;  1TF6 A;  2LVH A;  3MSW A;  2EMH A;  3VHT B;  2JOB A;  1BBG A;  1TF3 A;  4JI2 E;  2K7I A;  2YTF A;  4IS1 C;  4ZYH A;  3VYY A;  2JOX A;  4O43 A;  3TQM A;  2EL5 A;  2V89 A;  1HNX E;  2IHR 1;  3T1Y E;  4O24 A;  3C4T A;  2L2K B;  2MDG A;  3JTZ A;  5AE1 A;  3JAM C;  1A1L A;  1STU A;  4LF7 E;  2YT4 A;  2EMX A;  5AE2 A;  2EPZ A;  2EOS A;  2EMY A;  2EOM A;  1EH6 A;  2N3G A;  2EOI A;  2RS6 A;  1ZBQ A;  1X5W A;  1I94 E;  1O0W A;  2EPK X;  4R2R A;  5LMN E;  2LJU A;  1TN9 A;  2HHH E;  2EOY A;  3LLH A;  1T39 A;  5A6J A;  2F8B A;  4ZYE A;  1X6E A;  2DSY A;  3HPS A;  2EM4 A;  2JVA A;  2K4V A;  1HNZ E;  4DV2 E;  1WJP A;  5A2Q C;  3C6M A;  2GLI A;  2EPN A;  2LJH A;  4DR4 E;  1XNR E;  2CSH A;  2DB2 A;  2VF1 A;  1ZR9 A;  2EM8 A;  1ZBT A;  4JI4 E;  3KZZ A;  4KHP E;  4NZV A;  2EMW A;  2EPP A;  2EOF A;  2L2M A;  4WFT A;  3QG5 C;  4M2Z A;  2D9H A;  2JY9 A;  1RQ0 A;  4R2S A;  3L00 A;  1EH7 A;  2HC5 A;  2V8Q B;  1AH5 A;  2B3T B;  2LRS A;  2DLQ A;  1X3C A;  1N34 E;  1UBD C;  2GHF A;  4DR6 E;  2ODR D;  1YZ9 A;  2EN2 A;  4GKK E;  3F6G A;  2WBT A;  1YYK A;  2ENA A;  2EM6 A;  2YPN A;  1Z1B A;  1J26 A;  2EOO A;  4LTY A;  4JI1 E;  1A1G A;  2L33 A;  4R2A A;  2PRT A;  2B7V A;  4X9J A;  2VQE E;  2EPL X;  4N4R B;  4F6N A;  1N32 E;  5T6J A;  2EOH A;  2YTE A;  2UUC E;  3IWC A;  2UUB E;  4JI0 E;  4WSG A;  4R2E A;  1IMU A;  4F6M A;  4M30 A;  2M4I A;  2DMY A;  1NCS A;  1WRJ A;  4JI8 E;  3EPJ A;  1WHN A;  2LTR A;  4JI3 E;  5A6B D;  2EOQ A;  2ELY A;  2LMZ A;  4X65 E;  2H36 X;  5A6B A;  1YFH A;  3J7Y p;  1GTK A;  1SR9 A;  2EPU A;  2EM5 A;  4F9C B;  1T4O A;  2YRM A;  5LL6 R;  5AC4 A;  2CT1 A;  4LFC E;  1QNT A;  5LMU E;  2L3C A;  4DV7 E;  5A6A A;  2MC5 A;  2NUE A;  4NXM E;  4ZYD A;  1RMD A;  1XMO E;  2R76 A;  1WHQ A;  5LLQ A;  1IBM E;  2EMC A;  1PJS A;  3IWD A;  3OML A;  4YHH E;  1UHZ A;  2EMA A;  2EM9 A;  3DJW A;  3M99 B;  3C6K A;  4B3R E;  1UIL A;  2E72 A;  3BID A;  1PKP A;  2LCE A;  4R2C A;  4WSP A;  1LLM C;  3ADL A;  2YZT A;  4DKK A;  1A1K A;  4GKJ E;  4HEI A;  2EM3 A;  2RQL A;  2YSO A;  3AV0 A;  2LUQ A;  4LF5 E;  4WPY A;  2UU9 E;  3EQ1 A;  2YTJ A;  3MHS C;  5AC5 A;  2ENC A;  2N8X A;  4BHC A;  1AAY A;  2CTD A;  3ADI A;  2EWL A;  4FK5 C;  2MKD A;  4BHB A;  4X64 E;  1HNW E;  3F6H A;  5IV8 B;  2J7J A;  4O4K A;  2EPR A;  4RH8 A;  2RPC A;  2L8T A;  1YYO A;  4KZS A;  4R2Q A;  2LUP B;  2YTP A;  2EP3 A;  4JV5 E;  4RHB B;  2KOU A;  4LF6 E;  3BGH A;  2WBS A;  4DV3 E;  5FLX C;  3EPL A;  2L2N A;  4M9V C;  4MLV A;  1GQE A;  2YRK A;  1X48 A;  1PJQ A;  3HQ1 A;  4MLQ A;  4LF9 E;  2DGC A;  4BC9 A;  4DR2 E;  1KYQ A;  4TUI A;  1HR0 E;  1A1H A;  2E5L E;  2NUG A;  1FJG E;  2YTD A;  4LFB E;  1DGC A;  2EN6 A;  2EM7 A;  1EH8 A;  2ENH A;  2EM0 A;  4P7D A;  4DV1 E;  4F2J C;  2EZ6 A;  5KL4 A;  2BB8 A;  2EN8 A;  2Q8U A;  3KWR A;  2YTI A;  3ADG A;  2V87 A;  4B3M E;  1N3G A;  2F4V E;  2EMB A;  2LTS A;  2R1F A;  4R8O A;  2NUF A;  2YTQ A;  2JYA A;  1J5E E;  5KL5 A;  2L6M A;  4F9B B;  1YUI A;  2JP9 A;  4M0V A;  3THO B;  2YU5 A;  5IXM B;  2DIX A;  2LE2 A;  1PDA A;  1XMQ E;  1JK1 A;  2V88 A;  2FTX B;  5A69 A;  3J81 C;  1A1I A;  2ODR C;  3HTX A;  1P47 A;  1N36 E;  2EL6 A;  2ZM6 E;  2B7T A;  2KON A;  4X66 E;  4WXC A;  2DRP A;  4AQY E;  1UN6 B;  2MKN A;  1A1F A;  2A25 A;  1X47 A;  1B69 A;  4P78 A;  5CFF E;  2YRH A;  2ADR A;  4GEQ B;  2YWQ A;  4L8N A;  4LF4 E;  4BC7 A;  4WX9 A;  1ZAA C;  2UXD E;  2VE7 C;  4K0K E;  2EMI A;  2I9I A;  2L3J A;  1F2I G;  2WBU A;  4JI7 E;  2EOE A;  2EOZ A;  3THN A;  4DR1 E;  2EL4 A;  4IJD A;  1G2F C;  2E1M A;  2UXC E;  5KL6 A;  4LFA E;  1BB8 A;  2EPX A;  2JXP A;  1JK2 A;  2RSM A;  2EOJ A;  2EN4 A;  3ZOQ B;  5DNY A;  1IQO A;  4BBY A;  1NEI A;  2LV2 A;  4NHR A;  1T38 A;  2EQ3 A;  3UK3 C;  2VRD A;  1YYW A;  2FV4 B;  4KWY A;  2ELZ A;  2L92 A;  1IBK E;  1X6F A;  1YPN A;  4BS9 A;  5IWA E;  4DUY E;  3H09 A;  3K6Q A;  2EM2 A;  2JR1 A;  1MGT A;  3J80 C;  2WCC 3;  3FIG A;  1PJT A;  2UXB E;  1IQS A;  3AUZ A;  2EQ1 A;  2GPI A;  4I8O A;  3RMP A;  2EQ0 A;  4B3T E;  4X62 E;  2YTN A;  2EMK A;  4BCA A;  2YTO A;  1T4N A;  2BBG A;  2WZO A;  2VQF E;  4B3S E;  2EMZ A;  2YSP A;  5KL3 A;  2DMI A;  2B9D A;  5AE3 A;  2HJJ A;  2MDR A;  3KZY A;  2I13 A;  1RC7 A; 
#chains in the Genus database with same CATH homology
 1NEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...