4R2CA

Egr1/zif268 zinc fingers in complex with hydroxymethylated dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
86
structure length
86
Chain Sequence
ERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Early growth response protein 1
publication title Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 28
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4r2cA00
2I13A 3M99B 1ZAAC 2EM0A 2EMWA 2YTJA 2EL6A 4R2EA 2WCC3 1TN9A 2D9HA 1KJKA 2EORA 2EQ1A 4R2CA 3EPLA 3EPKA 2EMAA 2ENAA 4F6NA 2EOMA 2EQ0A 2LCEA 2EPUA 2LV2A 2ENHA 2EE8A 1UN6B 2LVHA 2EOIA 2YTNA 2EM5A 2EMYA 2EMHA 4F6MA 2EP3A 2VRDA 3EPJA 1X5WA 2M9AA 2EOXA 1A1LA 2E72A 1JK2A 2EMGA 2EMXA 1ZR9A 2EOHA 2YTIA 2YRMA 2EMLA 2PRTA 2EL5A 3VHTB 5KL5A 1B69A 2EN1A 2MKNA 4WSGA 2GLIA 1AAYA 1ZU1A 5KL2A 2MDGA 4R2PA 2YTEA 2EJ4A 2DGCA 1YSAC 2EN8A 2YTDA 5KL6A 2JPAA 2EN7A 2ADRA 2EMIA 2CSHA 1DGCA 2EL4A 2EM4A 1F2IG 1BBOA 2A25A 2EM6A 2CT1A 2HGHA 2YU5A 4FK5C 1A1IA 2WBSA 2R1FA 3MHHC 5KL7A 2EM7A 2EM9A 2CTDA 4F2JC 2EMKA 4IJDA 2EPXA 1A1FA 2YU8A 2EOFA 2LT7A 2YTOA 2EMZA 2EPCA 2EN2A 2EOOA 2EOEA 2YTGA 2EPZA 2RSIA 2EMCA 2EPAA 2YRHA 2YTQA 2ELZA 2GHFA 5KL3A 3UK3C 4GZNC 2YTFA 1LLMC 4R2AA 2DLKA 2YSPA 2EOJA 2DMIA 2EN6A 2EM8A 2EPRA 4R2SA 3MHSC 1X3CA 4R2DA 1MEYC 4M9VC 2EOZA 2NABA 2EN4A 2ELYA 2YSOA 4R2RA 2J7JA 1A1HA 2EM3A 1A1KA 2DRPA 1X6HA 2EM2A 1YUJA 1X6EA 2EOSA 1RMDA 2DLQA 2MKDA 1X6FA 1A1GA 1G2DC 4X9JA 1G2FC 2BB8A 2EOYA 2YTPA 1NCSA 2EOQA 1TF3A 1JK1A 5KL4A 2EQ3A 2RPCA 2EMFA 2WBTA 4IS1C 4R2QA 1Z1BA 2WBUA 3EPHA 2JP9A 1UBDC 1TF6A 2EMBA 2YRKA 2ENCA 1WJPA 1BB8A 2EPPA 1A1JA 2EN3A 2LO3A 1YUIA 1P47A
chains in the Genus database with same CATH superfamily
4RHBB 1YPNA 2B7TA 3M99B 4P78A 3FIGA 1TN9A 4DR6E 1KJKA 4DR5E 2EORA 2NUGA 2JVAA 2EQ1A 3EPLA 2F4VE 4M30A 2ENAA 2EPKX 4F6NA 1I94E 2LCEA 4MLVA 3VK6A 4AQYE 1IMUA 5TSEA 5AC5A 2YTNA 4DR4E 2EMHA 4DR3E 2LMZA 2V86A 1UILA 4LU9A 2EP3A 2M9AA 2EOXA 2ZM6E 1A1LA 4M0VA 2L3JA 2VF1A 2EN1A 2DMYA 4WYQB 2JOBA 2FV4B 3JTZA 3KZYA 4BBYA 1YSAC 2YTDA 2JPAA 4F9BB 2LUPB 1PDAA 1DGCA 1F2IG 1QU6A 5AASA 4DV6E 3MHHC 2EMKA 2LT7A 3BGHA 2YTOA 4X65E 1PJQA 2EPCA 1HNXE 5LLQA 2EPZA 1N36E 2GHFA 4GZNC 3KZZA 2V83A 3IWDA 1BBGA 1XMOE 2B3TB 4B3TE 1HNWE 2EPLX 5AC4A 5A6AA 2NA2A 3OMLA 1YFHA 2IHR1 1MEYC 2EOZA 4Q35B 1YZ9A 1WXRA 2JWOA 2EN4A 2ELYA 2YSOA 2RTXA 3DJWA 2EM3A 2DRPA 5IWAE 1YYKA 3KWRA 2EOSA 1RMDA 4BC7A 4DR2E 2LJHA 4NZVA 1G2FC 2EPOA 2EOQA 4JI8E 3BIDA 2E1MA 1JK1A 2RPCA 2L2MA 4OOGC 3LLHA 4L8NA 4JI3E 1N34E 2VQFE 2WBTA 4WX9A 4HTGA 4IS1C 3J7AG 2JP9A 2ODRD 2EMBA 2EZ6A 1BB8A 2EPPA 1GTKA 2N3HA 1YUIA 2YT4A 3ADJA 1YYOA 1ZBQA 5DNYA 4L5NC 2DB2A 5T6JA 2EMWA 4DV1E 2EL6A 3T1HE 5CFFE 2UU9E 1N33E 4O43A 1T39A 4DR1E 4O4KA 2EPNA 4DR7E 4P7DA 2M7QA 2EPUA 2ENHA 1UN6B 1STUA 5A6JA 4DMIA 2EMYA 4LF6E 1T4NA 2RSMA 4F6MA 2M4IA 3HPSA 1X5WA 3L00A 1T4LB 4X62E 4B3ME 2E72A 2L3CA 2YRMA 4DV3E 3OTOE 3IWBA 1J5EE 4I8OA 4YY3E 5KL5A 1B69A 2GLIA 1ZU1A 3P1XA 2EN8A 5FLXC 2ADRA 5IXMB 2CSHA 1PJSA 1BBOA 2EM6A 2HGHA 4JI4E 1GQEA 2E5LE 2YU5A 2H36X 4B3RE 1XNQE 2NUEA 2R1FA 2EM7A 2EPXA 2L33A 4DV2E 1XMQE 4J8ZA 4LF8E 3JAMC 3QG5C 4ZYGA 4DV0E 4GKKE 2MC5A 1X49A 2RSIA 2EMCA 3F6HA 2V88A 2LE2A 2EPAA 2YRHA 1QNTA 2ELZA 4F54A 5A6BD 3UK3C 4DV7E 3VYYA 3H09A 1LLMC 2DLKA 4Q28A 2EN6A 4R2SA 5AE1A 3MHSC 1IQOA 3EQ1A 3IWCA 4WXDA 1X3CA 1FKAE 1T38A 5F3WA 4BCAA 1A1KA 1SR9A 2VQEE 1YUJA 1GZ6A 2DLQA 4X8WA 5IT9C 2B7VA 1A1GA 1ZBTA 2DSYA 2YTPA 1TF3A 2RS6A 2M1SA 3TQMA 4TUIA 2L8TA 2EMFA 4LFAE 4R2QA 4GKJE 3J81C 4LFBE 4X66E 1UBDC 1RC7A 4B3SE 2HJJA 3J80C 1WJPA 1X48A 1NEIA 4JI7E 4DKKA 3J7Yp 4NXNE 2EPMX 1PJTA 3THOB 1A1JA 2VE7C 4YHHE 1XNRE 2LRSA 3BBGA 2FTXB 3ZOQB 4KHPE 2YTJA 2JXPA 4R2EA 3ADGA 4KWYA 2HHHE 4DUYE 4LTYA 4BS9A 3EPKA 4WXCA 3AUZA 2EMAA 2YPNA 4N4RB 2KOUA 5AE2A 2UUCE 4LF5E 2EWLA 2EQ0A 2G7HA 5LMUE 2EE8A 1IBME 4NXME 1IBKE 3C4BA 2L2KB 2VRDA 1WHQA 2EOHA 1ZR9A 2YTIA 2LUQA 2EL5A 2F8BA 2MKNA 4R8OA 1AAYA 3HTXA 2MDGA 2YTEA 2EJ4A 2DGCA 5KL6A 1O0WA 2EN7A 2JYAA 1IQSA 4F9AB 2YWQA 2B9DA 4JYAE 2EL4A 2EM4A 3HQ1A 2WZOA 3K6QA 2CT1A 1FJGE 4FK5C 3ECRA 4GEQB 1L4SA 2WBSA 2CTDA 2EM9A 4KZSA 5BR8E 2I9IA 4F2JC 4IJDA 1EKZA 2UXDE 1RQ0A 2EOOA 2EOEA 2LTRA 4JV5E 5A6BA 5IV8B 4R2AA 2YSPA 2EOJA 2DMIA 3MSWA 4TUGA 2UXCE 3DF6A 4LFCE 1DQ3A 4M9VC 5A69A 4K0KE 1AH5A 2NABA 1A1HA 4WPYA 1X6HA 4ZYEA 2JR1A 1X6EA 3BF2A 2MKDA 1HR0E 1X6FA 4X9JA 2LBSB 2EOYA 1NCSA 5AE3A 2EQ3A 2HC5A 3C4TA 3ADIA 1WHNA 4OX9E 4ZYDA 2WBUA 4JI0E 4X64E 3F6GA 2ENCA 4JI2E 2Q8UA 2R76A 3C6KA 1YYWA 4WSPA 3C6MA 2I13A 1ZAAC 2EM0A 3THNA 2WCC3 4JI5E 2D9HA 3RMPA 4R2CA 4LF4E 5LMNE 2EOMA 5A2QC 1SFEA 2LV2A 2N8XA 1J26A 4DV4E 2L92A 4F9CB 2LVHA 2EOIA 4DUZE 2EM5A 2UUBE 4WFTA 2V87A 4BC9A 4O24A 2K4VA 3EPJA 4DV5E 1T4OA 1JK2A 2EMGA 2EMXA 2UXBE 2EMLA 2LTSA 2PRTA 3VHTB 4NHRA 2RQLA 4WSGA 3VYXA 2V89A 3HPZA 1HNZE 4R2PA 5KL2A 1KYQA 2MC6A 2ODRC 1EH7A 2K7IA 2CPNA 4BHBA 4BHCA 4ZYHA 1WRJA 2EMIA 4HEIA 2GPIA 4BMJA 2A25A 2DIXA 1A1IA 1N32E 4LF9E 5KL7A 1UHZA 2KONA 2BBGA 1A1FA 4R03A 2L6MA 1PKPA 2YU8A 3HXLA 2EOFA 2EMZA 2EN2A 5LL6R 1DI2A 2YTGA 1X47A 2YTQA 4O5GA 5KL3A 2FGGA 2YTFA 3T1YE 2EM8A 2EPRA 2N3GA 4M2ZA 1IBLE 2LJUA 1MGTA 3JU0A 4R2DA 2YZTA 4RH8A 4R2RA 2J7JA 2L2NA 2EM2A 3ADLA 2V8QB 4MLQA 1G2DC 1EH8A 2BB8A 3AV0A 1EH6A 2JY9A 2MDRA 5KL4A 2RS7A 2UUAE 4JI6E 3LMLA 2KHXA 4JI1E 4LF7E 1Z1BA 2V85A 3EPHA 1TF6A 2JOXA 2YRKA 2NUFA 5A6KA 1N3GA 2EN3A 2LO3A 1P47A 5ADZA
chains in the Genus database with same CATH topology
2I13A 3M99B 1ZAAC 2EM0A 2EMWA 2YTJA 2EL6A 4R2EA 2WCC3 1TN9A 2D9HA 1KJKA 2EORA 2EQ1A 4R2CA 3EPLA 3EPKA 2EMAA 2ENAA 4F6NA 2EOMA 2EQ0A 2LCEA 2EPUA 2LV2A 2ENHA 2EE8A 1UN6B 2LVHA 2EOIA 2YTNA 2EM5A 2EMYA 2EMHA 4F6MA 2EP3A 2VRDA 3EPJA 1X5WA 2M9AA 2EOXA 1A1LA 2E72A 1JK2A 2EMGA 2EMXA 1ZR9A 2EOHA 2YTIA 2YRMA 2EMLA 2PRTA 2EL5A 3VHTB 5KL5A 1B69A 2EN1A 2MKNA 4WSGA 2GLIA 1AAYA 1ZU1A 5KL2A 2MDGA 4R2PA 2YTEA 2EJ4A 2DGCA 1YSAC 2EN8A 2YTDA 5KL6A 2JPAA 2EN7A 2ADRA 2EMIA 2CSHA 1DGCA 2EL4A 2EM4A 1F2IG 1BBOA 2A25A 2EM6A 2CT1A 2HGHA 2YU5A 4FK5C 1A1IA 2WBSA 2R1FA 3MHHC 5KL7A 2EM7A 2EM9A 2CTDA 4F2JC 2EMKA 4IJDA 2EPXA 1A1FA 2YU8A 2EOFA 2LT7A 2YTOA 2EMZA 2EPCA 2EN2A 2EOOA 2EOEA 2YTGA 2EPZA 2RSIA 2EMCA 2EPAA 2YRHA 2YTQA 2ELZA 2GHFA 5KL3A 3UK3C 4GZNC 2YTFA 1LLMC 4R2AA 2DLKA 2YSPA 2EOJA 2DMIA 2EN6A 2EM8A 2EPRA 4R2SA 3MHSC 1X3CA 4R2DA 1MEYC 4M9VC 2EOZA 2NABA 2EN4A 2ELYA 2YSOA 4R2RA 2J7JA 1A1HA 2EM3A 1A1KA 2DRPA 1X6HA 2EM2A 1YUJA 1X6EA 2EOSA 1RMDA 2DLQA 2MKDA 1X6FA 1A1GA 1G2DC 4X9JA 1G2FC 2BB8A 2EOYA 2YTPA 1NCSA 2EOQA 1TF3A 1JK1A 5KL4A 2EQ3A 2RPCA 2EMFA 2WBTA 4IS1C 4R2QA 1Z1BA 2WBUA 3EPHA 2JP9A 1UBDC 1TF6A 2EMBA 2YRKA 2ENCA 1WJPA 1BB8A 2EPPA 1A1JA 2EN3A 2LO3A 1YUIA 1P47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I13 A;  3M99 B;  1ZAA C;  2EM0 A;  2EMW A;  2YTJ A;  2EL6 A;  4R2E A;  2WCC 3;  1TN9 A;  2D9H A;  1KJK A;  2EOR A;  2EQ1 A;  4R2C A;  3EPL A;  3EPK A;  2EMA A;  2ENA A;  4F6N A;  2EOM A;  2EQ0 A;  2LCE A;  2EPU A;  2LV2 A;  2ENH A;  2EE8 A;  1UN6 B;  2LVH A;  2EOI A;  2YTN A;  2EM5 A;  2EMY A;  2EMH A;  4F6M A;  2EP3 A;  2VRD A;  3EPJ A;  1X5W A;  2M9A A;  2EOX A;  1A1L A;  2E72 A;  1JK2 A;  2EMG A;  2EMX A;  1ZR9 A;  2EOH A;  2YTI A;  2YRM A;  2EML A;  2PRT A;  2EL5 A;  3VHT B;  5KL5 A;  1B69 A;  2EN1 A;  2MKN A;  4WSG A;  2GLI A;  1AAY A;  1ZU1 A;  5KL2 A;  2MDG A;  4R2P A;  2YTE A;  2EJ4 A;  2DGC A;  1YSA C;  2EN8 A;  2YTD A;  5KL6 A;  2JPA A;  2EN7 A;  2ADR A;  2EMI A;  2CSH A;  1DGC A;  2EL4 A;  2EM4 A;  1F2I G;  1BBO A;  2A25 A;  2EM6 A;  2CT1 A;  2HGH A;  2YU5 A;  4FK5 C;  1A1I A;  2WBS A;  2R1F A;  3MHH C;  5KL7 A;  2EM7 A;  2EM9 A;  2CTD A;  4F2J C;  2EMK A;  4IJD A;  2EPX A;  1A1F A;  2YU8 A;  2EOF A;  2LT7 A;  2YTO A;  2EMZ A;  2EPC A;  2EN2 A;  2EOO A;  2EOE A;  2YTG A;  2EPZ A;  2RSI A;  2EMC A;  2EPA A;  2YRH A;  2YTQ A;  2ELZ A;  2GHF A;  5KL3 A;  3UK3 C;  4GZN C;  2YTF A;  1LLM C;  4R2A A;  2DLK A;  2YSP A;  2EOJ A;  2DMI A;  2EN6 A;  2EM8 A;  2EPR A;  4R2S A;  3MHS C;  1X3C A;  4R2D A;  1MEY C;  4M9V C;  2EOZ A;  2NAB A;  2EN4 A;  2ELY A;  2YSO A;  4R2R A;  2J7J A;  1A1H A;  2EM3 A;  1A1K A;  2DRP A;  1X6H A;  2EM2 A;  1YUJ A;  1X6E A;  2EOS A;  1RMD A;  2DLQ A;  2MKD A;  1X6F A;  1A1G A;  1G2D C;  4X9J A;  1G2F C;  2BB8 A;  2EOY A;  2YTP A;  1NCS A;  2EOQ A;  1TF3 A;  1JK1 A;  5KL4 A;  2EQ3 A;  2RPC A;  2EMF A;  2WBT A;  4IS1 C;  4R2Q A;  1Z1B A;  2WBU A;  3EPH A;  2JP9 A;  1UBD C;  1TF6 A;  2EMB A;  2YRK A;  2ENC A;  1WJP A;  1BB8 A;  2EPP A;  1A1J A;  2EN3 A;  2LO3 A;  1YUI A;  1P47 A; 
#chains in the Genus database with same CATH topology
 4RHB B;  1YPN A;  2B7T A;  3M99 B;  4P78 A;  3FIG A;  1TN9 A;  4DR6 E;  1KJK A;  4DR5 E;  2EOR A;  2NUG A;  2JVA A;  2EQ1 A;  3EPL A;  2F4V E;  4M30 A;  2ENA A;  2EPK X;  4F6N A;  1I94 E;  2LCE A;  4MLV A;  3VK6 A;  4AQY E;  1IMU A;  5TSE A;  5AC5 A;  2YTN A;  4DR4 E;  2EMH A;  4DR3 E;  2LMZ A;  2V86 A;  1UIL A;  4LU9 A;  2EP3 A;  2M9A A;  2EOX A;  2ZM6 E;  1A1L A;  4M0V A;  2L3J A;  2VF1 A;  2EN1 A;  2DMY A;  4WYQ B;  2JOB A;  2FV4 B;  3JTZ A;  3KZY A;  4BBY A;  1YSA C;  2YTD A;  2JPA A;  4F9B B;  2LUP B;  1PDA A;  1DGC A;  1F2I G;  1QU6 A;  5AAS A;  4DV6 E;  3MHH C;  2EMK A;  2LT7 A;  3BGH A;  2YTO A;  4X65 E;  1PJQ A;  2EPC A;  1HNX E;  5LLQ A;  2EPZ A;  1N36 E;  2GHF A;  4GZN C;  3KZZ A;  2V83 A;  3IWD A;  1BBG A;  1XMO E;  2B3T B;  4B3T E;  1HNW E;  2EPL X;  5AC4 A;  5A6A A;  2NA2 A;  3OML A;  1YFH A;  2IHR 1;  1MEY C;  2EOZ A;  4Q35 B;  1YZ9 A;  1WXR A;  2JWO A;  2EN4 A;  2ELY A;  2YSO A;  2RTX A;  3DJW A;  2EM3 A;  2DRP A;  5IWA E;  1YYK A;  3KWR A;  2EOS A;  1RMD A;  4BC7 A;  4DR2 E;  2LJH A;  4NZV A;  1G2F C;  2EPO A;  2EOQ A;  4JI8 E;  3BID A;  2E1M A;  1JK1 A;  2RPC A;  2L2M A;  4OOG C;  3LLH A;  4L8N A;  4JI3 E;  1N34 E;  2VQF E;  2WBT A;  4WX9 A;  4HTG A;  4IS1 C;  3J7A G;  2JP9 A;  2ODR D;  2EMB A;  2EZ6 A;  1BB8 A;  2EPP A;  1GTK A;  2N3H A;  1YUI A;  2YT4 A;  3ADJ A;  1YYO A;  1ZBQ A;  5DNY A;  4L5N C;  2DB2 A;  5T6J A;  2EMW A;  4DV1 E;  2EL6 A;  3T1H E;  5CFF E;  2UU9 E;  1N33 E;  4O43 A;  1T39 A;  4DR1 E;  4O4K A;  2EPN A;  4DR7 E;  4P7D A;  2M7Q A;  2EPU A;  2ENH A;  1UN6 B;  1STU A;  5A6J A;  4DMI A;  2EMY A;  4LF6 E;  1T4N A;  2RSM A;  4F6M A;  2M4I A;  3HPS A;  1X5W A;  3L00 A;  1T4L B;  4X62 E;  4B3M E;  2E72 A;  2L3C A;  2YRM A;  4DV3 E;  3OTO E;  3IWB A;  1J5E E;  4I8O A;  4YY3 E;  5KL5 A;  1B69 A;  2GLI A;  1ZU1 A;  3P1X A;  2EN8 A;  5FLX C;  2ADR A;  5IXM B;  2CSH A;  1PJS A;  1BBO A;  2EM6 A;  2HGH A;  4JI4 E;  1GQE A;  2E5L E;  2YU5 A;  2H36 X;  4B3R E;  1XNQ E;  2NUE A;  2R1F A;  2EM7 A;  2EPX A;  2L33 A;  4DV2 E;  1XMQ E;  4J8Z A;  4LF8 E;  3JAM C;  3QG5 C;  4ZYG A;  4DV0 E;  4GKK E;  2MC5 A;  1X49 A;  2RSI A;  2EMC A;  3F6H A;  2V88 A;  2LE2 A;  2EPA A;  2YRH A;  1QNT A;  2ELZ A;  4F54 A;  5A6B D;  3UK3 C;  4DV7 E;  3VYY A;  3H09 A;  1LLM C;  2DLK A;  4Q28 A;  2EN6 A;  4R2S A;  5AE1 A;  3MHS C;  1IQO A;  3EQ1 A;  3IWC A;  4WXD A;  1X3C A;  1FKA E;  1T38 A;  5F3W A;  4BCA A;  1A1K A;  1SR9 A;  2VQE E;  1YUJ A;  1GZ6 A;  2DLQ A;  4X8W A;  5IT9 C;  2B7V A;  1A1G A;  1ZBT A;  2DSY A;  2YTP A;  1TF3 A;  2RS6 A;  2M1S A;  3TQM A;  4TUI A;  2L8T A;  2EMF A;  4LFA E;  4R2Q A;  4GKJ E;  3J81 C;  4LFB E;  4X66 E;  1UBD C;  1RC7 A;  4B3S E;  2HJJ A;  3J80 C;  1WJP A;  1X48 A;  1NEI A;  4JI7 E;  4DKK A;  3J7Y p;  4NXN E;  2EPM X;  1PJT A;  3THO B;  1A1J A;  2VE7 C;  4YHH E;  1XNR E;  2LRS A;  3BBG A;  2FTX B;  3ZOQ B;  4KHP E;  2YTJ A;  2JXP A;  4R2E A;  3ADG A;  4KWY A;  2HHH E;  4DUY E;  4LTY A;  4BS9 A;  3EPK A;  4WXC A;  3AUZ A;  2EMA A;  2YPN A;  4N4R B;  2KOU A;  5AE2 A;  2UUC E;  4LF5 E;  2EWL A;  2EQ0 A;  2G7H A;  5LMU E;  2EE8 A;  1IBM E;  4NXM E;  1IBK E;  3C4B A;  2L2K B;  2VRD A;  1WHQ A;  2EOH A;  1ZR9 A;  2YTI A;  2LUQ A;  2EL5 A;  2F8B A;  2MKN A;  4R8O A;  1AAY A;  3HTX A;  2MDG A;  2YTE A;  2EJ4 A;  2DGC A;  5KL6 A;  1O0W A;  2EN7 A;  2JYA A;  1IQS A;  4F9A B;  2YWQ A;  2B9D A;  4JYA E;  2EL4 A;  2EM4 A;  3HQ1 A;  2WZO A;  3K6Q A;  2CT1 A;  1FJG E;  4FK5 C;  3ECR A;  4GEQ B;  1L4S A;  2WBS A;  2CTD A;  2EM9 A;  4KZS A;  5BR8 E;  2I9I A;  4F2J C;  4IJD A;  1EKZ A;  2UXD E;  1RQ0 A;  2EOO A;  2EOE A;  2LTR A;  4JV5 E;  5A6B A;  5IV8 B;  4R2A A;  2YSP A;  2EOJ A;  2DMI A;  3MSW A;  4TUG A;  2UXC E;  3DF6 A;  4LFC E;  1DQ3 A;  4M9V C;  5A69 A;  4K0K E;  1AH5 A;  2NAB A;  1A1H A;  4WPY A;  1X6H A;  4ZYE A;  2JR1 A;  1X6E A;  3BF2 A;  2MKD A;  1HR0 E;  1X6F A;  4X9J A;  2LBS B;  2EOY A;  1NCS A;  5AE3 A;  2EQ3 A;  2HC5 A;  3C4T A;  3ADI A;  1WHN A;  4OX9 E;  4ZYD A;  2WBU A;  4JI0 E;  4X64 E;  3F6G A;  2ENC A;  4JI2 E;  2Q8U A;  2R76 A;  3C6K A;  1YYW A;  4WSP A;  3C6M A;  2I13 A;  1ZAA C;  2EM0 A;  3THN A;  2WCC 3;  4JI5 E;  2D9H A;  3RMP A;  4R2C A;  4LF4 E;  5LMN E;  2EOM A;  5A2Q C;  1SFE A;  2LV2 A;  2N8X A;  1J26 A;  4DV4 E;  2L92 A;  4F9C B;  2LVH A;  2EOI A;  4DUZ E;  2EM5 A;  2UUB E;  4WFT A;  2V87 A;  4BC9 A;  4O24 A;  2K4V A;  3EPJ A;  4DV5 E;  1T4O A;  1JK2 A;  2EMG A;  2EMX A;  2UXB E;  2EML A;  2LTS A;  2PRT A;  3VHT B;  4NHR A;  2RQL A;  4WSG A;  3VYX A;  2V89 A;  3HPZ A;  1HNZ E;  4R2P A;  5KL2 A;  1KYQ A;  2MC6 A;  2ODR C;  1EH7 A;  2K7I A;  2CPN A;  4BHB A;  4BHC A;  4ZYH A;  1WRJ A;  2EMI A;  4HEI A;  2GPI A;  4BMJ A;  2A25 A;  2DIX A;  1A1I A;  1N32 E;  4LF9 E;  5KL7 A;  1UHZ A;  2KON A;  2BBG A;  1A1F A;  4R03 A;  2L6M A;  1PKP A;  2YU8 A;  3HXL A;  2EOF A;  2EMZ A;  2EN2 A;  5LL6 R;  1DI2 A;  2YTG A;  1X47 A;  2YTQ A;  4O5G A;  5KL3 A;  2FGG A;  2YTF A;  3T1Y E;  2EM8 A;  2EPR A;  2N3G A;  4M2Z A;  1IBL E;  2LJU A;  1MGT A;  3JU0 A;  4R2D A;  2YZT A;  4RH8 A;  4R2R A;  2J7J A;  2L2N A;  2EM2 A;  3ADL A;  2V8Q B;  4MLQ A;  1G2D C;  1EH8 A;  2BB8 A;  3AV0 A;  1EH6 A;  2JY9 A;  2MDR A;  5KL4 A;  2RS7 A;  2UUA E;  4JI6 E;  3LML A;  2KHX A;  4JI1 E;  4LF7 E;  1Z1B A;  2V85 A;  3EPH A;  1TF6 A;  2JOX A;  2YRK A;  2NUF A;  5A6K A;  1N3G A;  2EN3 A;  2LO3 A;  1P47 A;  5ADZ A; 
#chains in the Genus database with same CATH homology
 2I13 A;  3M99 B;  1ZAA C;  2EM0 A;  2EMW A;  2YTJ A;  2EL6 A;  4R2E A;  2WCC 3;  1TN9 A;  2D9H A;  1KJK A;  2EOR A;  2EQ1 A;  4R2C A;  3EPL A;  3EPK A;  2EMA A;  2ENA A;  4F6N A;  2EOM A;  2EQ0 A;  2LCE A;  2EPU A;  2LV2 A;  2ENH A;  2EE8 A;  1UN6 B;  2LVH A;  2EOI A;  2YTN A;  2EM5 A;  2EMY A;  2EMH A;  4F6M A;  2EP3 A;  2VRD A;  3EPJ A;  1X5W A;  2M9A A;  2EOX A;  1A1L A;  2E72 A;  1JK2 A;  2EMG A;  2EMX A;  1ZR9 A;  2EOH A;  2YTI A;  2YRM A;  2EML A;  2PRT A;  2EL5 A;  3VHT B;  5KL5 A;  1B69 A;  2EN1 A;  2MKN A;  4WSG A;  2GLI A;  1AAY A;  1ZU1 A;  5KL2 A;  2MDG A;  4R2P A;  2YTE A;  2EJ4 A;  2DGC A;  1YSA C;  2EN8 A;  2YTD A;  5KL6 A;  2JPA A;  2EN7 A;  2ADR A;  2EMI A;  2CSH A;  1DGC A;  2EL4 A;  2EM4 A;  1F2I G;  1BBO A;  2A25 A;  2EM6 A;  2CT1 A;  2HGH A;  2YU5 A;  4FK5 C;  1A1I A;  2WBS A;  2R1F A;  3MHH C;  5KL7 A;  2EM7 A;  2EM9 A;  2CTD A;  4F2J C;  2EMK A;  4IJD A;  2EPX A;  1A1F A;  2YU8 A;  2EOF A;  2LT7 A;  2YTO A;  2EMZ A;  2EPC A;  2EN2 A;  2EOO A;  2EOE A;  2YTG A;  2EPZ A;  2RSI A;  2EMC A;  2EPA A;  2YRH A;  2YTQ A;  2ELZ A;  2GHF A;  5KL3 A;  3UK3 C;  4GZN C;  2YTF A;  1LLM C;  4R2A A;  2DLK A;  2YSP A;  2EOJ A;  2DMI A;  2EN6 A;  2EM8 A;  2EPR A;  4R2S A;  3MHS C;  1X3C A;  4R2D A;  1MEY C;  4M9V C;  2EOZ A;  2NAB A;  2EN4 A;  2ELY A;  2YSO A;  4R2R A;  2J7J A;  1A1H A;  2EM3 A;  1A1K A;  2DRP A;  1X6H A;  2EM2 A;  1YUJ A;  1X6E A;  2EOS A;  1RMD A;  2DLQ A;  2MKD A;  1X6F A;  1A1G A;  1G2D C;  4X9J A;  1G2F C;  2BB8 A;  2EOY A;  2YTP A;  1NCS A;  2EOQ A;  1TF3 A;  1JK1 A;  5KL4 A;  2EQ3 A;  2RPC A;  2EMF A;  2WBT A;  4IS1 C;  4R2Q A;  1Z1B A;  2WBU A;  3EPH A;  2JP9 A;  1UBD C;  1TF6 A;  2EMB A;  2YRK A;  2ENC A;  1WJP A;  1BB8 A;  2EPP A;  1A1J A;  2EN3 A;  2LO3 A;  1YUI A;  1P47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...