4R2CA

Egr1/zif268 zinc fingers in complex with hydroxymethylated dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
86
structure length
86
Chain Sequence
ERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Early growth response protein 1
total genus 28
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4r2cA00
2EM0A 2J7JA 2GLIA 4F6NA 2YU5A 2LO3A 2WBSA 1NCSA 2ENAA 1X6HA 2RSIA 2EQ0A 1ZU1A 2VRDA 2A25A 1A1HA 4R2PA 2EMAA 2EN4A 2JP9A 1UN6B 4R2RA 2YTFA 2EMXA 1AAYA 2RPCA 1KJKA 2EN7A 2EMBA 3EPJA 2MKDA 2LCEA 2DLKA 2EMIA 2EOFA 2LVHA 4R2QA 2I13A 2MKNA 4IJDA 1BBOA 2DMIA 2ELYA 2MDGA 1UBDC 2E72A 1X5WA 2YTOA 2EOXA 4R2SA 1ZAAC 2CT1A 5KL2A 2EN8A 4F6MA 4GZNC 1A1LA 2EOSA 2ELZA 2EN6A 3EPLA 1YUJA 3UK3C 2CTDA 2EMLA 2EMYA 5KL4A 2ADRA 2YSOA 1JK1A 1RMDA 3M99B 2YTGA 1TF3A 5KL6A 2EL6A 2EN1A 1A1FA 2YTJA 2EN3A 4M9VC 2EMCA 3EPHA 2JPAA 2WBTA 4IS1C 2EOYA 1DGCA 4R2DA 1G2DC 5KL3A 2PRTA 1X6FA 2YRKA 2EORA 2EMZA 3MHSC 2BB8A 2CSHA 1X3CA 2EOHA 2EL4A 1TN9A 2EMKA 2HGHA 3EPKA 1JK2A 1LLMC 2EPUA 2NABA 2EOOA 1WJPA 1ZR9A 2EOQA 2EMHA 2EM5A 2EMGA 2R1FA 3MHHC 1Z1BA 5KL5A 2YSPA 4R2EA 5KL7A 2EPPA 2EOIA 2EP3A 2YTIA 1A1GA 2EE8A 2YRHA 2WCC3 1TF6A 4X9JA 2EPXA 2YTDA 2LT7A 2YTQA 2LV2A 2DGCA 4F2JC 2EPCA 2EJ4A 2EL5A 2EN2A 2DLQA 2EOZA 1A1IA 1BB8A 2EPRA 2EMWA 2EM7A 1F2IG 2EM8A 1X6EA 2D9HA 2EOJA 4R2CA 4WSGA 4R2AA 2GHFA 2EM4A 1A1KA 2EOEA 2ENCA 2EPZA 2DRPA 2EOMA 2YTEA 2EM2A 2EM6A 1G2FC 3VHTB 1YUIA 2EM9A 1YSAC 4FK5C 2WBUA 2EQ1A 2EM3A 2YTPA 2ENHA 1MEYC 1A1JA 2EQ3A 2YTNA 2YU8A 2M9AA 2EMFA 2EPAA 2YRMA 1P47A 1B69A
chains in the Genus database with same CATH superfamily
2J7JA 4BBYA 2MC5A 3KZZA 4R8OA 2EPMX 4F54A 2KOUA 1A1HA 1EH7A 4DR1E 1XNRE 3DJWA 2EPOA 4HTGA 4JI5E 1AAYA 4F9BB 2I13A 4IJDA 5A69A 2ELYA 4NHRA 5AASA 2LJHA 2RSMA 4KZSA 2E72A 4BCAA 5A6AA 4GZNC 5IWAE 4RHBB 1UHZA 2ELZA 2L3CA 1YUJA 2FTXB 1YFHA 2EMLA 2HC5A 2YSOA 2YWQA 1N34E 2YTGA 5A6BD 2R76A 3ADLA 3EPHA 4MLVA 4DV6E 4NZVA 2WBTA 2EOYA 3RMPA 1IMUA 2B7VA 2EORA 2EMZA 1YZ9A 5IXMB 2LTSA 2L2KB 4B3TE 2L3JA 2DSYA 3MSWA 1LLMC 2JOBA 1HNXE 4DR4E 2L6MA 1XMQE 4WXCA 1SFEA 4ZYDA 2EOIA 4LF5E 3C6MA 1X48A 4DV0E 2YPNA 2RS7A 3ADJA 1KYQA 2VQFE 2LUPB 2EJ4A 1QNTA 4HEIA 3AUZA 1O0WA 2N3HA 3F6GA 2ODRD 5A2QC 1F2IG 2EOJA 2D9HA 4WXDA 4R2AA 1RC7A 4KWYA 5AC4A 1A1KA 1EH6A 4JYAE 2ENCA 2Q8UA 2YZTA 3T1YE 4WX9A 2LJUA 4JI0E 2YTPA 2EM3A 1MEYC 2ENHA 2EPLX 4JI1E 4O24A 2YTNA 3K6QA 4DR6E 2EMFA 2EPAA 2YRMA 2NUFA 4JI3E 4DKKA 2EM0A 5IV8B 4F6NA 4X66E 2WBSA 3LLHA 4O4KA 4O43A 1ZU1A 2V86A 4BC7A 4F9AB 4DMIA 4R2PA 2EN4A 3T1HE 1GZ6A 4DV5E 3HPSA 2EMXA 1FKAE 1KJKA 4KHPE 2JYAA 3HTXA 2MDRA 1MGTA 2DB2A 5TSEA 3AV0A 3ZOQB 3J81C 1J26A 5AE2A 1ZAAC 4F6MA 1A1LA 1YPNA 2JOXA 1BBGA 2EN6A 2UU9E 2EMYA 3OMLA 4LTYA 4TUIA 1JK1A 5KL6A 2EN1A 1PJQA 1A1FA 4GKJE 2YTJA 2EN3A 2UXDE 1GTKA 4R2DA 4P78A 2PRTA 1T4LB 5CFFE 4JI4E 3MHSC 2JXPA 3FIGA 2BB8A 2CSHA 1X3CA 3THOB 2F8BA 2IHR1 4BHCA 4LF6E 3KZYA 4NXNE 3BBGA 3JU0A 1XNQE 4I8OA 4DUYE 3J7AG 4AQYE 2EPUA 3TQMA 4JV5E 4J8ZA 1WJPA 1ZR9A 4ZYGA 2EM5A 2K4VA 1Z1BA 4M0VA 4GEQB 2YSPA 4R2EA 2EPPA 5LLQA 4R03A 2CPNA 1A1GA 2EE8A 4RH8A 2WCC3 2JR1A 1TF6A 5LL6R 1WXRA 2LT7A 2YTQA 2DGCA 4F2JC 2EPCA 2EL5A 4X64E 2EOZA 4N4RB 2VF1A 1EH8A 1BB8A 4F9CB 5DNYA 1IBLE 5F3WA 3THNA 1X6EA 2EM4A 2GHFA 2I9IA 2LBSB 2DRPA 4YY3E 2YTEA 4JI7E 2EM9A 2B9DA 2WBUA 2FGGA 2EQ1A 1A1JA 4DV4E 2HHHE 2YU8A 2K7IA 3OTOE 3IWDA 1N33E 1RQ0A 2ENAA 1HNZE 3J80C 1X6HA 2RSIA 2EQ0A 2VRDA 5AE1A 5IT9C 2JP9A 4OOGC 2YTFA 2H36X 1WRJA 2RPCA 2EN7A 1HR0E 2LCEA 1T38A 4X65E 1XMOE 2EOFA 2LVHA 1DI2A 4LF9E 2V87A 1X5WA 2EOXA 2L8TA 4BS9A 2KONA 2EOSA 2G7HA 3ADGA 2V89A 2EPNA 3BF2A 2ADRA 1PJTA 1RMDA 1HNWE 3JTZA 2EL6A 5A6BA 5FLXC 4ZYEA 4K0KE 4BMJA 4DR3E 2L33A 4IS1C 1DGCA 1G2DC 4LFBE 1I94E 2YRKA 4LF8E 1YYKA 4Q35B 2YT4A 4LU9A 1N36E 2EL4A 1TN9A 3BGHA 5AC5A 3EPKA 4LF4E 2NABA 2M7QA 4X62E 3ADIA 2V83A 4P7DA 2EOQA 2EMHA 5KL7A 2EP3A 2VQEE 4B3SE 2UUBE 2YTIA 5LMNE 2V88A 1SR9A 1L4SA 5A6KA 2LV2A 4OX9E 2KHXA 2UUAE 1NEIA 2DLQA 2RQLA 1IQOA 2EPRA 1WHNA 2EMWA 2B3TB 2EM7A 2NA2A 2LTRA 3F6HA 4R2CA 2EZ6A 1X49A 3IWCA 1PKPA 2L2NA 5LMUE 3JAMC 2EOEA 4ZYHA 2EOMA 3QG5C 2UUCE 2EM2A 2EM6A 4X8WA 3VHTB 3VK6A 1G2FC 3C6KA 1J5EE 5T6JA 1YSAC 1AH5A 1T4OA 2N3GA 3IWBA 2EQ3A 4Q28A 4DV2E 2DMYA 2UXCE 1STUA 4BHBA 1N3GA 2GLIA 2GPIA 3LMLA 1DQ3A 2V85A 2YU5A 2RTXA 2LO3A 2E5LE 1NCSA 4JI6E 2JVAA 2A25A 2EMAA 2VE7C 1IBME 1UN6B 4R2RA 2EMBA 3EPJA 2MKDA 2DLKA 2EMIA 3P1XA 4R2QA 2MKNA 2WZOA 5AE3A 1BBOA 2DMIA 3C4BA 2MDGA 1T39A 1UBDC 2V8QB 2NUGA 4YHHE 3VYXA 2JY9A 2YTOA 4R2SA 3HQ1A 3L00A 3VYYA 2CT1A 2EPKX 5KL2A 2EN8A 2M4IA 1IQSA 1ZBTA 4B3RE 2LRSA 3EPLA 2ODRC 3UK3C 2JWOA 1YYOA 3J7Yp 2CTDA 5KL4A 4DR2E 5ADZA 4DR7E 3M99B 4DUZE 2L92A 1TF3A 5BR8E 2FV4B 2B7TA 2MC6A 2RS6A 2UXBE 1GQEA 4M9VC 2EMCA 2NUEA 2JPAA 2BBGA 5KL3A 1X6FA 2LMZA 2M1SA 1PDAA 4B3ME 4TUGA 2EOHA 2EMKA 2HGHA 4JI2E 1JK2A 3EQ1A 2EOOA 4L8NA 4LFCE 2F4VE 1UILA 2EWLA 2EMGA 2R1FA 3MHHC 1IBKE 1N32E 5KL5A 2ZM6E 3KWRA 2LUQA 2HJJA 3H09A 5A6JA 4WSPA 4L5NC 4DV7E 2YRHA 4X9JA 2EPXA 2YTDA 4GKKE 3HXLA 1QU6A 4M2ZA 2EN2A 1A1IA 2E1MA 4JI8E 3C4TA 3DF6A 1X47A 4WFTA 1EKZA 2EM8A 1YYWA 4DV1E 1WHQA 4WSGA 4BC9A 1PJSA 4NXME 3HPZA 2EPZA 4O5GA 4WYQB 3BIDA 4DR5E 4MLQA 2LE2A 2L2MA 4WPYA 4LFAE 1ZBQA 1YUIA 4FK5C 4M30A 1FJGE 2N8XA 1T4NA 2M9AA 4DV3E 3ECRA 4LF7E 2DIXA 1P47A 1B69A
chains in the Genus database with same CATH topology
2EM0A 2J7JA 2GLIA 4F6NA 2YU5A 2LO3A 2WBSA 1NCSA 2ENAA 1X6HA 2RSIA 2EQ0A 1ZU1A 2VRDA 2A25A 1A1HA 4R2PA 2EMAA 2EN4A 2JP9A 1UN6B 4R2RA 2YTFA 2EMXA 1AAYA 2RPCA 1KJKA 2EN7A 2EMBA 3EPJA 2MKDA 2LCEA 2DLKA 2EMIA 2EOFA 2LVHA 4R2QA 2I13A 2MKNA 4IJDA 1BBOA 2DMIA 2ELYA 2MDGA 1UBDC 2E72A 1X5WA 2YTOA 2EOXA 4R2SA 1ZAAC 2CT1A 5KL2A 2EN8A 4F6MA 4GZNC 1A1LA 2EOSA 2ELZA 2EN6A 3EPLA 1YUJA 3UK3C 2CTDA 2EMLA 2EMYA 5KL4A 2ADRA 2YSOA 1JK1A 1RMDA 3M99B 2YTGA 1TF3A 5KL6A 2EL6A 2EN1A 1A1FA 2YTJA 2EN3A 4M9VC 2EMCA 3EPHA 2JPAA 2WBTA 4IS1C 2EOYA 1DGCA 4R2DA 1G2DC 5KL3A 2PRTA 1X6FA 2YRKA 2EORA 2EMZA 3MHSC 2BB8A 2CSHA 1X3CA 2EOHA 2EL4A 1TN9A 2EMKA 2HGHA 3EPKA 1JK2A 1LLMC 2EPUA 2NABA 2EOOA 1WJPA 1ZR9A 2EOQA 2EMHA 2EM5A 2EMGA 2R1FA 3MHHC 1Z1BA 5KL5A 2YSPA 4R2EA 5KL7A 2EPPA 2EOIA 2EP3A 2YTIA 1A1GA 2EE8A 2YRHA 2WCC3 1TF6A 4X9JA 2EPXA 2YTDA 2LT7A 2YTQA 2LV2A 2DGCA 4F2JC 2EPCA 2EJ4A 2EL5A 2EN2A 2DLQA 2EOZA 1A1IA 1BB8A 2EPRA 2EMWA 2EM7A 1F2IG 2EM8A 1X6EA 2D9HA 2EOJA 4R2CA 4WSGA 4R2AA 2GHFA 2EM4A 1A1KA 2EOEA 2ENCA 2EPZA 2DRPA 2EOMA 2YTEA 2EM2A 2EM6A 1G2FC 3VHTB 1YUIA 2EM9A 1YSAC 4FK5C 2WBUA 2EQ1A 2EM3A 2YTPA 2ENHA 1MEYC 1A1JA 2EQ3A 2YTNA 2YU8A 2M9AA 2EMFA 2EPAA 2YRMA 1P47A 1B69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EM0 A;  2J7J A;  2GLI A;  4F6N A;  2YU5 A;  2LO3 A;  2WBS A;  1NCS A;  2ENA A;  1X6H A;  2RSI A;  2EQ0 A;  1ZU1 A;  2VRD A;  2A25 A;  1A1H A;  4R2P A;  2EMA A;  2EN4 A;  2JP9 A;  1UN6 B;  4R2R A;  2YTF A;  2EMX A;  1AAY A;  2RPC A;  1KJK A;  2EN7 A;  2EMB A;  3EPJ A;  2MKD A;  2LCE A;  2DLK A;  2EMI A;  2EOF A;  2LVH A;  4R2Q A;  2I13 A;  2MKN A;  4IJD A;  1BBO A;  2DMI A;  2ELY A;  2MDG A;  1UBD C;  2E72 A;  1X5W A;  2YTO A;  2EOX A;  4R2S A;  1ZAA C;  2CT1 A;  5KL2 A;  2EN8 A;  4F6M A;  4GZN C;  1A1L A;  2EOS A;  2ELZ A;  2EN6 A;  3EPL A;  1YUJ A;  3UK3 C;  2CTD A;  2EML A;  2EMY A;  5KL4 A;  2ADR A;  2YSO A;  1JK1 A;  1RMD A;  3M99 B;  2YTG A;  1TF3 A;  5KL6 A;  2EL6 A;  2EN1 A;  1A1F A;  2YTJ A;  2EN3 A;  4M9V C;  2EMC A;  3EPH A;  2JPA A;  2WBT A;  4IS1 C;  2EOY A;  1DGC A;  4R2D A;  1G2D C;  5KL3 A;  2PRT A;  1X6F A;  2YRK A;  2EOR A;  2EMZ A;  3MHS C;  2BB8 A;  2CSH A;  1X3C A;  2EOH A;  2EL4 A;  1TN9 A;  2EMK A;  2HGH A;  3EPK A;  1JK2 A;  1LLM C;  2EPU A;  2NAB A;  2EOO A;  1WJP A;  1ZR9 A;  2EOQ A;  2EMH A;  2EM5 A;  2EMG A;  2R1F A;  3MHH C;  1Z1B A;  5KL5 A;  2YSP A;  4R2E A;  5KL7 A;  2EPP A;  2EOI A;  2EP3 A;  2YTI A;  1A1G A;  2EE8 A;  2YRH A;  2WCC 3;  1TF6 A;  4X9J A;  2EPX A;  2YTD A;  2LT7 A;  2YTQ A;  2LV2 A;  2DGC A;  4F2J C;  2EPC A;  2EJ4 A;  2EL5 A;  2EN2 A;  2DLQ A;  2EOZ A;  1A1I A;  1BB8 A;  2EPR A;  2EMW A;  2EM7 A;  1F2I G;  2EM8 A;  1X6E A;  2D9H A;  2EOJ A;  4R2C A;  4WSG A;  4R2A A;  2GHF A;  2EM4 A;  1A1K A;  2EOE A;  2ENC A;  2EPZ A;  2DRP A;  2EOM A;  2YTE A;  2EM2 A;  2EM6 A;  1G2F C;  3VHT B;  1YUI A;  2EM9 A;  1YSA C;  4FK5 C;  2WBU A;  2EQ1 A;  2EM3 A;  2YTP A;  2ENH A;  1MEY C;  1A1J A;  2EQ3 A;  2YTN A;  2YU8 A;  2M9A A;  2EMF A;  2EPA A;  2YRM A;  1P47 A;  1B69 A; 
#chains in the Genus database with same CATH topology
 2J7J A;  4BBY A;  2MC5 A;  3KZZ A;  4R8O A;  2EPM X;  4F54 A;  2KOU A;  1A1H A;  1EH7 A;  4DR1 E;  1XNR E;  3DJW A;  2EPO A;  4HTG A;  4JI5 E;  1AAY A;  4F9B B;  2I13 A;  4IJD A;  5A69 A;  2ELY A;  4NHR A;  5AAS A;  2LJH A;  2RSM A;  4KZS A;  2E72 A;  4BCA A;  5A6A A;  4GZN C;  5IWA E;  4RHB B;  1UHZ A;  2ELZ A;  2L3C A;  1YUJ A;  2FTX B;  1YFH A;  2EML A;  2HC5 A;  2YSO A;  2YWQ A;  1N34 E;  2YTG A;  5A6B D;  2R76 A;  3ADL A;  3EPH A;  4MLV A;  4DV6 E;  4NZV A;  2WBT A;  2EOY A;  3RMP A;  1IMU A;  2B7V A;  2EOR A;  2EMZ A;  1YZ9 A;  5IXM B;  2LTS A;  2L2K B;  4B3T E;  2L3J A;  2DSY A;  3MSW A;  1LLM C;  2JOB A;  1HNX E;  4DR4 E;  2L6M A;  1XMQ E;  4WXC A;  1SFE A;  4ZYD A;  2EOI A;  4LF5 E;  3C6M A;  1X48 A;  4DV0 E;  2YPN A;  2RS7 A;  3ADJ A;  1KYQ A;  2VQF E;  2LUP B;  2EJ4 A;  1QNT A;  4HEI A;  3AUZ A;  1O0W A;  2N3H A;  3F6G A;  2ODR D;  5A2Q C;  1F2I G;  2EOJ A;  2D9H A;  4WXD A;  4R2A A;  1RC7 A;  4KWY A;  5AC4 A;  1A1K A;  1EH6 A;  4JYA E;  2ENC A;  2Q8U A;  2YZT A;  3T1Y E;  4WX9 A;  2LJU A;  4JI0 E;  2YTP A;  2EM3 A;  1MEY C;  2ENH A;  2EPL X;  4JI1 E;  4O24 A;  2YTN A;  3K6Q A;  4DR6 E;  2EMF A;  2EPA A;  2YRM A;  2NUF A;  4JI3 E;  4DKK A;  2EM0 A;  5IV8 B;  4F6N A;  4X66 E;  2WBS A;  3LLH A;  4O4K A;  4O43 A;  1ZU1 A;  2V86 A;  4BC7 A;  4F9A B;  4DMI A;  4R2P A;  2EN4 A;  3T1H E;  1GZ6 A;  4DV5 E;  3HPS A;  2EMX A;  1FKA E;  1KJK A;  4KHP E;  2JYA A;  3HTX A;  2MDR A;  1MGT A;  2DB2 A;  5TSE A;  3AV0 A;  3ZOQ B;  3J81 C;  1J26 A;  5AE2 A;  1ZAA C;  4F6M A;  1A1L A;  1YPN A;  2JOX A;  1BBG A;  2EN6 A;  2UU9 E;  2EMY A;  3OML A;  4LTY A;  4TUI A;  1JK1 A;  5KL6 A;  2EN1 A;  1PJQ A;  1A1F A;  4GKJ E;  2YTJ A;  2EN3 A;  2UXD E;  1GTK A;  4R2D A;  4P78 A;  2PRT A;  1T4L B;  5CFF E;  4JI4 E;  3MHS C;  2JXP A;  3FIG A;  2BB8 A;  2CSH A;  1X3C A;  3THO B;  2F8B A;  2IHR 1;  4BHC A;  4LF6 E;  3KZY A;  4NXN E;  3BBG A;  3JU0 A;  1XNQ E;  4I8O A;  4DUY E;  3J7A G;  4AQY E;  2EPU A;  3TQM A;  4JV5 E;  4J8Z A;  1WJP A;  1ZR9 A;  4ZYG A;  2EM5 A;  2K4V A;  1Z1B A;  4M0V A;  4GEQ B;  2YSP A;  4R2E A;  2EPP A;  5LLQ A;  4R03 A;  2CPN A;  1A1G A;  2EE8 A;  4RH8 A;  2WCC 3;  2JR1 A;  1TF6 A;  5LL6 R;  1WXR A;  2LT7 A;  2YTQ A;  2DGC A;  4F2J C;  2EPC A;  2EL5 A;  4X64 E;  2EOZ A;  4N4R B;  2VF1 A;  1EH8 A;  1BB8 A;  4F9C B;  5DNY A;  1IBL E;  5F3W A;  3THN A;  1X6E A;  2EM4 A;  2GHF A;  2I9I A;  2LBS B;  2DRP A;  4YY3 E;  2YTE A;  4JI7 E;  2EM9 A;  2B9D A;  2WBU A;  2FGG A;  2EQ1 A;  1A1J A;  4DV4 E;  2HHH E;  2YU8 A;  2K7I A;  3OTO E;  3IWD A;  1N33 E;  1RQ0 A;  2ENA A;  1HNZ E;  3J80 C;  1X6H A;  2RSI A;  2EQ0 A;  2VRD A;  5AE1 A;  5IT9 C;  2JP9 A;  4OOG C;  2YTF A;  2H36 X;  1WRJ A;  2RPC A;  2EN7 A;  1HR0 E;  2LCE A;  1T38 A;  4X65 E;  1XMO E;  2EOF A;  2LVH A;  1DI2 A;  4LF9 E;  2V87 A;  1X5W A;  2EOX A;  2L8T A;  4BS9 A;  2KON A;  2EOS A;  2G7H A;  3ADG A;  2V89 A;  2EPN A;  3BF2 A;  2ADR A;  1PJT A;  1RMD A;  1HNW E;  3JTZ A;  2EL6 A;  5A6B A;  5FLX C;  4ZYE A;  4K0K E;  4BMJ A;  4DR3 E;  2L33 A;  4IS1 C;  1DGC A;  1G2D C;  4LFB E;  1I94 E;  2YRK A;  4LF8 E;  1YYK A;  4Q35 B;  2YT4 A;  4LU9 A;  1N36 E;  2EL4 A;  1TN9 A;  3BGH A;  5AC5 A;  3EPK A;  4LF4 E;  2NAB A;  2M7Q A;  4X62 E;  3ADI A;  2V83 A;  4P7D A;  2EOQ A;  2EMH A;  5KL7 A;  2EP3 A;  2VQE E;  4B3S E;  2UUB E;  2YTI A;  5LMN E;  2V88 A;  1SR9 A;  1L4S A;  5A6K A;  2LV2 A;  4OX9 E;  2KHX A;  2UUA E;  1NEI A;  2DLQ A;  2RQL A;  1IQO A;  2EPR A;  1WHN A;  2EMW A;  2B3T B;  2EM7 A;  2NA2 A;  2LTR A;  3F6H A;  4R2C A;  2EZ6 A;  1X49 A;  3IWC A;  1PKP A;  2L2N A;  5LMU E;  3JAM C;  2EOE A;  4ZYH A;  2EOM A;  3QG5 C;  2UUC E;  2EM2 A;  2EM6 A;  4X8W A;  3VHT B;  3VK6 A;  1G2F C;  3C6K A;  1J5E E;  5T6J A;  1YSA C;  1AH5 A;  1T4O A;  2N3G A;  3IWB A;  2EQ3 A;  4Q28 A;  4DV2 E;  2DMY A;  2UXC E;  1STU A;  4BHB A;  1N3G A;  2GLI A;  2GPI A;  3LML A;  1DQ3 A;  2V85 A;  2YU5 A;  2RTX A;  2LO3 A;  2E5L E;  1NCS A;  4JI6 E;  2JVA A;  2A25 A;  2EMA A;  2VE7 C;  1IBM E;  1UN6 B;  4R2R A;  2EMB A;  3EPJ A;  2MKD A;  2DLK A;  2EMI A;  3P1X A;  4R2Q A;  2MKN A;  2WZO A;  5AE3 A;  1BBO A;  2DMI A;  3C4B A;  2MDG A;  1T39 A;  1UBD C;  2V8Q B;  2NUG A;  4YHH E;  3VYX A;  2JY9 A;  2YTO A;  4R2S A;  3HQ1 A;  3L00 A;  3VYY A;  2CT1 A;  2EPK X;  5KL2 A;  2EN8 A;  2M4I A;  1IQS A;  1ZBT A;  4B3R E;  2LRS A;  3EPL A;  2ODR C;  3UK3 C;  2JWO A;  1YYO A;  3J7Y p;  2CTD A;  5KL4 A;  4DR2 E;  5ADZ A;  4DR7 E;  3M99 B;  4DUZ E;  2L92 A;  1TF3 A;  5BR8 E;  2FV4 B;  2B7T A;  2MC6 A;  2RS6 A;  2UXB E;  1GQE A;  4M9V C;  2EMC A;  2NUE A;  2JPA A;  2BBG A;  5KL3 A;  1X6F A;  2LMZ A;  2M1S A;  1PDA A;  4B3M E;  4TUG A;  2EOH A;  2EMK A;  2HGH A;  4JI2 E;  1JK2 A;  3EQ1 A;  2EOO A;  4L8N A;  4LFC E;  2F4V E;  1UIL A;  2EWL A;  2EMG A;  2R1F A;  3MHH C;  1IBK E;  1N32 E;  5KL5 A;  2ZM6 E;  3KWR A;  2LUQ A;  2HJJ A;  3H09 A;  5A6J A;  4WSP A;  4L5N C;  4DV7 E;  2YRH A;  4X9J A;  2EPX A;  2YTD A;  4GKK E;  3HXL A;  1QU6 A;  4M2Z A;  2EN2 A;  1A1I A;  2E1M A;  4JI8 E;  3C4T A;  3DF6 A;  1X47 A;  4WFT A;  1EKZ A;  2EM8 A;  1YYW A;  4DV1 E;  1WHQ A;  4WSG A;  4BC9 A;  1PJS A;  4NXM E;  3HPZ A;  2EPZ A;  4O5G A;  4WYQ B;  3BID A;  4DR5 E;  4MLQ A;  2LE2 A;  2L2M A;  4WPY A;  4LFA E;  1ZBQ A;  1YUI A;  4FK5 C;  4M30 A;  1FJG E;  2N8X A;  1T4N A;  2M9A A;  4DV3 E;  3ECR A;  4LF7 E;  2DIX A;  1P47 A;  1B69 A; 
#chains in the Genus database with same CATH homology
 2EM0 A;  2J7J A;  2GLI A;  4F6N A;  2YU5 A;  2LO3 A;  2WBS A;  1NCS A;  2ENA A;  1X6H A;  2RSI A;  2EQ0 A;  1ZU1 A;  2VRD A;  2A25 A;  1A1H A;  4R2P A;  2EMA A;  2EN4 A;  2JP9 A;  1UN6 B;  4R2R A;  2YTF A;  2EMX A;  1AAY A;  2RPC A;  1KJK A;  2EN7 A;  2EMB A;  3EPJ A;  2MKD A;  2LCE A;  2DLK A;  2EMI A;  2EOF A;  2LVH A;  4R2Q A;  2I13 A;  2MKN A;  4IJD A;  1BBO A;  2DMI A;  2ELY A;  2MDG A;  1UBD C;  2E72 A;  1X5W A;  2YTO A;  2EOX A;  4R2S A;  1ZAA C;  2CT1 A;  5KL2 A;  2EN8 A;  4F6M A;  4GZN C;  1A1L A;  2EOS A;  2ELZ A;  2EN6 A;  3EPL A;  1YUJ A;  3UK3 C;  2CTD A;  2EML A;  2EMY A;  5KL4 A;  2ADR A;  2YSO A;  1JK1 A;  1RMD A;  3M99 B;  2YTG A;  1TF3 A;  5KL6 A;  2EL6 A;  2EN1 A;  1A1F A;  2YTJ A;  2EN3 A;  4M9V C;  2EMC A;  3EPH A;  2JPA A;  2WBT A;  4IS1 C;  2EOY A;  1DGC A;  4R2D A;  1G2D C;  5KL3 A;  2PRT A;  1X6F A;  2YRK A;  2EOR A;  2EMZ A;  3MHS C;  2BB8 A;  2CSH A;  1X3C A;  2EOH A;  2EL4 A;  1TN9 A;  2EMK A;  2HGH A;  3EPK A;  1JK2 A;  1LLM C;  2EPU A;  2NAB A;  2EOO A;  1WJP A;  1ZR9 A;  2EOQ A;  2EMH A;  2EM5 A;  2EMG A;  2R1F A;  3MHH C;  1Z1B A;  5KL5 A;  2YSP A;  4R2E A;  5KL7 A;  2EPP A;  2EOI A;  2EP3 A;  2YTI A;  1A1G A;  2EE8 A;  2YRH A;  2WCC 3;  1TF6 A;  4X9J A;  2EPX A;  2YTD A;  2LT7 A;  2YTQ A;  2LV2 A;  2DGC A;  4F2J C;  2EPC A;  2EJ4 A;  2EL5 A;  2EN2 A;  2DLQ A;  2EOZ A;  1A1I A;  1BB8 A;  2EPR A;  2EMW A;  2EM7 A;  1F2I G;  2EM8 A;  1X6E A;  2D9H A;  2EOJ A;  4R2C A;  4WSG A;  4R2A A;  2GHF A;  2EM4 A;  1A1K A;  2EOE A;  2ENC A;  2EPZ A;  2DRP A;  2EOM A;  2YTE A;  2EM2 A;  2EM6 A;  1G2F C;  3VHT B;  1YUI A;  2EM9 A;  1YSA C;  4FK5 C;  2WBU A;  2EQ1 A;  2EM3 A;  2YTP A;  2ENH A;  1MEY C;  1A1J A;  2EQ3 A;  2YTN A;  2YU8 A;  2M9A A;  2EMF A;  2EPA A;  2YRM A;  1P47 A;  1B69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...