4R2CA

Egr1/zif268 zinc fingers in complex with hydroxymethylated dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
86
structure length
86
Chain Sequence
ERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Early growth response protein 1
total genus 28
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4r2cA00
4IJDA 2EN6A 1A1IA 2EM7A 2EPCA 2EPUA 2LO3A 2EPPA 2EOXA 2EOIA 5KL4A 2EMCA 2ENHA 2I13A 2EOSA 1G2FC 2RSIA 2EMZA 2YTGA 1A1JA 4R2PA 3EPLA 2CTDA 5KL5A 4F6MA 2JP9A 2EMFA 2EQ3A 2EL4A 2WBSA 2YTNA 3MHSC 2LT7A 1YSAC 5KL6A 2ADRA 2YU8A 4R2DA 2E72A 1X6FA 2YTPA 1A1HA 1B69A 2YRMA 1X3CA 3EPHA 2EP3A 5KL2A 2EMGA 4X9JA 1ZAAC 2EOFA 2YTEA 2EM0A 2YTIA 2GLIA 1UN6B 2EN2A 1LLMC 2EMWA 2EM6A 2EM9A 2LVHA 2YTOA 2EMHA 2EM8A 5KL3A 4WSGA 4IS1C 2DLKA 2EMXA 2EN3A 2YTQA 1BBOA 4R2SA 2BB8A 2EN1A 1JK1A 2YSPA 1YUJA 4R2EA 1TF3A 2EE8A 1YUIA 2YTDA 4F2JC 1RMDA 2DLQA 2HGHA 2CSHA 4R2AA 1P47A 2EOHA 2EOEA 2EJ4A 2EM2A 1AAYA 2WBTA 2M9AA 4FK5C 2DMIA 2EQ1A 2EPZA 2EMAA 1TF6A 2EOMA 3UK3C 2NABA 2EM3A 2EN4A 2EOOA 1BB8A 1A1LA 1X5WA 2ELZA 2EOZA 2GHFA 3VHTB 2YU5A 1X6HA 2EMIA 2D9HA 1ZR9A 1NCSA 2ELYA 1TN9A 2WBUA 2EPRA 2EORA 2PRTA 2DRPA 2ENCA 1Z1BA 2EPAA 2YRKA 4GZNC 2EMLA 2RPCA 1ZU1A 2WCC3 2R1FA 1UBDC 2EQ0A 2EMYA 2EMKA 2YTFA 4R2RA 2EMBA 2CT1A 2EPXA 2YRHA 2EM5A 4F6NA 1A1FA 2LCEA 1F2IG 2A25A 2YSOA 2JPAA 3MHHC 1G2DC 1X6EA 2EOQA 1A1KA 5KL7A 2EM4A 1A1GA 1MEYC 2EN7A 2YTJA 2MDGA 4M9VC 1JK2A 1DGCA 2EOJA 2ENAA 1KJKA 1WJPA 4R2QA 3EPJA 2LV2A 2EN8A 2EOYA 3EPKA 2EL5A 2J7JA 2VRDA 2DGCA 2EL6A 3M99B 4R2CA 2MKNA 2MKDA
chains in the Genus database with same CATH superfamily
1YPNA 3VK6A 4RHBB 2EM7A 1IBLE 3JU0A 2EPPA 2EOIA 5KL4A 2ENHA 4MLQA 4DV2E 2F4VE 4JI4E 4M30A 3J7Yp 2L3JA 4TUGA 3H09A 2EQ3A 1AH5A 4YY3E 1YSAC 5LLQA 1X6FA 5AC4A 2V86A 4L5NC 4NZVA 1IQOA 3BGHA 4DV0E 2V88A 4X9JA 1ZAAC 2V83A 4DV4E 4LTYA 2EOFA 2YTEA 1PJSA 2RS6A 4DV5E 4OOGC 3ADJA 1UHZA 1EH6A 2EM9A 2LVHA 2EM8A 4JI8E 4WSGA 1QU6A 2MC5A 1FJGE 1BBOA 2V89A 2YSPA 3OTOE 2EE8A 1YUIA 3BF2A 4R2AA 2UU9E 4X64E 4O4KA 2EOHA 2EM2A 1X49A 4NXNE 2DMYA 4NHRA 1N34E 2WBTA 3IWCA 5AE1A 2L2KB 2DMIA 2LTSA 4X62E 2EPMX 2EPZA 2VF1A 2EOMA 2NABA 3ADLA 2EN4A 2RTXA 3C6KA 1BB8A 1DQ3A 2YU5A 5A6BA 1ZR9A 1TN9A 4LF7E 4NXME 4N4RB 2EORA 2PRTA 1Z1BA 4ZYHA 2EPAA 2EMLA 1ZU1A 2L33A 3J80C 2WCC3 4DV1E 2JR1A 2EZ6A 2EMKA 2GPIA 5TSEA 1N36E 4BC7A 4GKJE 3VYXA 2CT1A 2EM5A 5AE2A 1A1FA 2EPOA 2LCEA 1F2IG 2A25A 2YSOA 3F6HA 3T1YE 4LF6E 3C4TA 1YZ9A 2B9DA 2EM4A 2YTJA 3FIGA 4DV6E 3C6MA 3RMPA 2H36X 1WJPA 1QNTA 2E1MA 4R2QA 1PJQA 3M99B 2MKNA 4ZYDA 3T1HE 2M7QA 1PJTA 4IJDA 2V87A 2N3HA 4DR2E 4DR7E 3JAMC 4K0KE 2HHHE 4R2PA 2CTDA 5A6JA 4F6MA 4F9BB 2ODRD 2EMFA 2L8TA 3THNA 2ADRA 1A1HA 2L3CA 1B69A 1UILA 4B3RE 2EP3A 2EMGA 2N3GA 2B3TB 5A6KA 2EWLA 3ECRA 5F3WA 4LFCE 4WSPA 1LLMC 2FGGA 2EM6A 2F8BA 1YYKA 4X65E 5KL3A 2DLKA 4WYQB 2L2NA 4DV3E 2EN3A 4OX9E 2RSMA 1IBME 3BIDA 3QG5C 1FKAE 4KZSA 3ZOQB 3TQMA 4R2SA 2BB8A 2EN1A 1YUJA 4LF9E 4B3ME 4R2EA 1TF3A 1N3GA 2YTDA 4F2JC 4R03A 2MDRA 2LJHA 2EOEA 1WRJA 2EJ4A 2UUBE 4FK5C 3P1XA 2EQ1A 2EMAA 1DI2A 1J26A 2EM3A 2V8QB 4YHHE 2EOOA 2JWOA 1RQ0A 1YFHA 2LUQA 2YWQA 3JTZA 1WXRA 2GHFA 3VHTB 2D9HA 2DIXA 1HNWE 2ELYA 3J7AG 3DF6A 1STUA 3HQ1A 4BHCA 2LTRA 1ZBQA 4P7DA 3K6QA 4WPYA 2CPNA 2ODRC 2DRPA 1X47A 2UUAE 2R76A 4AQYE 2EMBA 3HTXA 2LBSB 5A6BD 1GZ6A 5IXMB 2VE7C 1T4LB 4JI1E 5KL7A 4DR5E 2EN7A 2LE2A 5IT9C 1ZBTA 2JY9A 3VYYA 2ENAA 4O24A 2MC6A 4JI6E 1XNQE 2YZTA 4J8ZA 4R2CA 4WFTA 5CFFE 1IBKE 2EN6A 1A1IA 4R8OA 1N32E 2RS7A 2EPCA 2LO3A 3LLHA 4BCAA 2EMCA 2I13A 2EOSA 2IHR1 3KZZA 1G2FC 2NUGA 3EPLA 4DUZE 4M0VA 5KL5A 2JP9A 2EL4A 1T38A 2LT7A 4WXCA 5KL6A 2UXCE 4R2DA 2NA2A 2E72A 1X3CA 2I9IA 4JI0E 4MLVA 5KL2A 3J81C 2EN2A 4O43A 1YYOA 2UUCE 1MGTA 3HPSA 2LRSA 3HPZA 4DR1E 2EMWA 2M4IA 1YYWA 2K4VA 2YTOA 4IS1C 1IMUA 2KONA 1SR9A 4JI7E 4BC9A 1WHQA 5DNYA 1EH7A 2L6MA 3C4BA 4X66E 5A6AA 4I8OA 5A69A 2JXPA 3KWRA 1AAYA 1L4SA 2M9AA 1X48A 5LL6R 2DB2A 4LF4E 4Q35B 4GEQB 1WHNA 3DJWA 4B3SE 2K7IA 1A1LA 2ELZA 2EOZA 1HNZE 4GKKE 1X6HA 2EMIA 1NEIA 2LUPB 4Q28A 3HXLA 2EPRA 2ENCA 4P78A 1T4OA 2YRKA 3MSWA 1PDAA 2EMYA 4HEIA 5LMUE 2YTFA 5T6JA 1XNRE 2L92A 4LU9A 1O0WA 2V85A 1RC7A 4LFBE 4JV5E 2NUFA 4BS9A 2EPNA 1X6EA 1A1KA 1A1GA 2LMZA 2JOBA 4DR6E 2MDGA 3ADGA 4M9VC 1JK2A 4B3TE 4JI5E 2YT4A 4DV7E 1KJKA 5IV8B 1HNXE 2KHXA 3AUZA 2J7JA 5LMNE 4F9AB 4LFAE 4L8NA 2MKDA 1PKPA 4TUIA 2LJUA 2EPUA 2EOXA 2M1SA 1IQSA 4F9CB 4DUYE 2RSIA 4WX9A 2EMZA 2YTGA 4F54A 1A1JA 1XMQE 2E5LE 5AC5A 4LF8E 2WBSA 2YTNA 3MHSC 2YU8A 3BBGA 2YTPA 1J5EE 2YRMA 1GTKA 4JI3E 3AV0A 3OMLA 3EPHA 5IWAE 5AASA 2YTIA 5ADZA 2EM0A 1UN6B 2GLIA 1XMOE 1GQEA 1KYQA 3IWDA 2EMHA 2EMXA 4M2ZA 4X8WA 2VQEE 2YTQA 1T4NA 1BBGA 2JOXA 2L2MA 1JK1A 2JVAA 2KOUA 4KWYA 1RMDA 2DLQA 4RH8A 2HGHA 2CSHA 1P47A 4DR3E 2JYAA 4WXDA 2VQFE 2FTXB 1TF6A 2HJJA 5FLXC 3UK3C 1N33E 2UXBE 2EPKX 1SFEA 2EPLX 2G7HA 1X5WA 2B7VA 4LF5E 4O5GA 4JI2E 4DR4E 4ZYGA 2Q8UA 1NCSA 2WBUA 4ZYEA 2YPNA 4GZNC 4KHPE 4DKKA 2RPCA 2R1FA 2FV4B 1UBDC 2EQ0A 2ZM6E 4R2RA 2BBGA 2YRHA 2EPXA 2HC5A 4DMIA 4F6NA 3KZYA 3LMLA 2B7TA 3L00A 2JPAA 4BBYA 3THOB 3MHHC 3F6GA 1G2DC 2EOQA 4HTGA 4BHBA 1MEYC 2DSYA 4BMJA 3IWBA 2WZOA 1EKZA 1HR0E 2NUEA 1EH8A 1DGCA 2EOJA 2N8XA 3EPJA 2LV2A 2EN8A 5A2QC 2EOYA 3EPKA 2EL5A 4JYAE 2VRDA 2UXDE 1T39A 2DGCA 2EL6A 1I94E 3ADIA 5BR8E 2RQLA 3EQ1A 5AE3A
chains in the Genus database with same CATH topology
4IJDA 2EN6A 1A1IA 2EM7A 2EPCA 2EPUA 2LO3A 2EPPA 2EOXA 2EOIA 5KL4A 2EMCA 2ENHA 2I13A 2EOSA 1G2FC 2RSIA 2EMZA 2YTGA 1A1JA 4R2PA 3EPLA 2CTDA 5KL5A 4F6MA 2JP9A 2EMFA 2EQ3A 2EL4A 2WBSA 2YTNA 3MHSC 2LT7A 1YSAC 5KL6A 2ADRA 2YU8A 4R2DA 2E72A 1X6FA 2YTPA 1A1HA 1B69A 2YRMA 1X3CA 3EPHA 2EP3A 5KL2A 2EMGA 4X9JA 1ZAAC 2EOFA 2YTEA 2EM0A 2YTIA 2GLIA 1UN6B 2EN2A 1LLMC 2EMWA 2EM6A 2EM9A 2LVHA 2YTOA 2EMHA 2EM8A 5KL3A 4WSGA 4IS1C 2DLKA 2EMXA 2EN3A 2YTQA 1BBOA 4R2SA 2BB8A 2EN1A 1JK1A 2YSPA 1YUJA 4R2EA 1TF3A 2EE8A 1YUIA 2YTDA 4F2JC 1RMDA 2DLQA 2HGHA 2CSHA 4R2AA 1P47A 2EOHA 2EOEA 2EJ4A 2EM2A 1AAYA 2WBTA 2M9AA 4FK5C 2DMIA 2EQ1A 2EPZA 2EMAA 1TF6A 2EOMA 3UK3C 2NABA 2EM3A 2EN4A 2EOOA 1BB8A 1A1LA 1X5WA 2ELZA 2EOZA 2GHFA 3VHTB 2YU5A 1X6HA 2EMIA 2D9HA 1ZR9A 1NCSA 2ELYA 1TN9A 2WBUA 2EPRA 2EORA 2PRTA 2DRPA 2ENCA 1Z1BA 2EPAA 2YRKA 4GZNC 2EMLA 2RPCA 1ZU1A 2WCC3 2R1FA 1UBDC 2EQ0A 2EMYA 2EMKA 2YTFA 4R2RA 2EMBA 2CT1A 2EPXA 2YRHA 2EM5A 4F6NA 1A1FA 2LCEA 1F2IG 2A25A 2YSOA 2JPAA 3MHHC 1G2DC 1X6EA 2EOQA 1A1KA 5KL7A 2EM4A 1A1GA 1MEYC 2EN7A 2YTJA 2MDGA 4M9VC 1JK2A 1DGCA 2EOJA 2ENAA 1KJKA 1WJPA 4R2QA 3EPJA 2LV2A 2EN8A 2EOYA 3EPKA 2EL5A 2J7JA 2VRDA 2DGCA 2EL6A 3M99B 4R2CA 2MKNA 2MKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJD A;  2EN6 A;  1A1I A;  2EM7 A;  2EPC A;  2EPU A;  2LO3 A;  2EPP A;  2EOX A;  2EOI A;  5KL4 A;  2EMC A;  2ENH A;  2I13 A;  2EOS A;  1G2F C;  2RSI A;  2EMZ A;  2YTG A;  1A1J A;  4R2P A;  3EPL A;  2CTD A;  5KL5 A;  4F6M A;  2JP9 A;  2EMF A;  2EQ3 A;  2EL4 A;  2WBS A;  2YTN A;  3MHS C;  2LT7 A;  1YSA C;  5KL6 A;  2ADR A;  2YU8 A;  4R2D A;  2E72 A;  1X6F A;  2YTP A;  1A1H A;  1B69 A;  2YRM A;  1X3C A;  3EPH A;  2EP3 A;  5KL2 A;  2EMG A;  4X9J A;  1ZAA C;  2EOF A;  2YTE A;  2EM0 A;  2YTI A;  2GLI A;  1UN6 B;  2EN2 A;  1LLM C;  2EMW A;  2EM6 A;  2EM9 A;  2LVH A;  2YTO A;  2EMH A;  2EM8 A;  5KL3 A;  4WSG A;  4IS1 C;  2DLK A;  2EMX A;  2EN3 A;  2YTQ A;  1BBO A;  4R2S A;  2BB8 A;  2EN1 A;  1JK1 A;  2YSP A;  1YUJ A;  4R2E A;  1TF3 A;  2EE8 A;  1YUI A;  2YTD A;  4F2J C;  1RMD A;  2DLQ A;  2HGH A;  2CSH A;  4R2A A;  1P47 A;  2EOH A;  2EOE A;  2EJ4 A;  2EM2 A;  1AAY A;  2WBT A;  2M9A A;  4FK5 C;  2DMI A;  2EQ1 A;  2EPZ A;  2EMA A;  1TF6 A;  2EOM A;  3UK3 C;  2NAB A;  2EM3 A;  2EN4 A;  2EOO A;  1BB8 A;  1A1L A;  1X5W A;  2ELZ A;  2EOZ A;  2GHF A;  3VHT B;  2YU5 A;  1X6H A;  2EMI A;  2D9H A;  1ZR9 A;  1NCS A;  2ELY A;  1TN9 A;  2WBU A;  2EPR A;  2EOR A;  2PRT A;  2DRP A;  2ENC A;  1Z1B A;  2EPA A;  2YRK A;  4GZN C;  2EML A;  2RPC A;  1ZU1 A;  2WCC 3;  2R1F A;  1UBD C;  2EQ0 A;  2EMY A;  2EMK A;  2YTF A;  4R2R A;  2EMB A;  2CT1 A;  2EPX A;  2YRH A;  2EM5 A;  4F6N A;  1A1F A;  2LCE A;  1F2I G;  2A25 A;  2YSO A;  2JPA A;  3MHH C;  1G2D C;  1X6E A;  2EOQ A;  1A1K A;  5KL7 A;  2EM4 A;  1A1G A;  1MEY C;  2EN7 A;  2YTJ A;  2MDG A;  4M9V C;  1JK2 A;  1DGC A;  2EOJ A;  2ENA A;  1KJK A;  1WJP A;  4R2Q A;  3EPJ A;  2LV2 A;  2EN8 A;  2EOY A;  3EPK A;  2EL5 A;  2J7J A;  2VRD A;  2DGC A;  2EL6 A;  3M99 B;  4R2C A;  2MKN A;  2MKD A; 
#chains in the Genus database with same CATH topology
 1YPN A;  3VK6 A;  4RHB B;  2EM7 A;  1IBL E;  3JU0 A;  2EPP A;  2EOI A;  5KL4 A;  2ENH A;  4MLQ A;  4DV2 E;  2F4V E;  4JI4 E;  4M30 A;  3J7Y p;  2L3J A;  4TUG A;  3H09 A;  2EQ3 A;  1AH5 A;  4YY3 E;  1YSA C;  5LLQ A;  1X6F A;  5AC4 A;  2V86 A;  4L5N C;  4NZV A;  1IQO A;  3BGH A;  4DV0 E;  2V88 A;  4X9J A;  1ZAA C;  2V83 A;  4DV4 E;  4LTY A;  2EOF A;  2YTE A;  1PJS A;  2RS6 A;  4DV5 E;  4OOG C;  3ADJ A;  1UHZ A;  1EH6 A;  2EM9 A;  2LVH A;  2EM8 A;  4JI8 E;  4WSG A;  1QU6 A;  2MC5 A;  1FJG E;  1BBO A;  2V89 A;  2YSP A;  3OTO E;  2EE8 A;  1YUI A;  3BF2 A;  4R2A A;  2UU9 E;  4X64 E;  4O4K A;  2EOH A;  2EM2 A;  1X49 A;  4NXN E;  2DMY A;  4NHR A;  1N34 E;  2WBT A;  3IWC A;  5AE1 A;  2L2K B;  2DMI A;  2LTS A;  4X62 E;  2EPM X;  2EPZ A;  2VF1 A;  2EOM A;  2NAB A;  3ADL A;  2EN4 A;  2RTX A;  3C6K A;  1BB8 A;  1DQ3 A;  2YU5 A;  5A6B A;  1ZR9 A;  1TN9 A;  4LF7 E;  4NXM E;  4N4R B;  2EOR A;  2PRT A;  1Z1B A;  4ZYH A;  2EPA A;  2EML A;  1ZU1 A;  2L33 A;  3J80 C;  2WCC 3;  4DV1 E;  2JR1 A;  2EZ6 A;  2EMK A;  2GPI A;  5TSE A;  1N36 E;  4BC7 A;  4GKJ E;  3VYX A;  2CT1 A;  2EM5 A;  5AE2 A;  1A1F A;  2EPO A;  2LCE A;  1F2I G;  2A25 A;  2YSO A;  3F6H A;  3T1Y E;  4LF6 E;  3C4T A;  1YZ9 A;  2B9D A;  2EM4 A;  2YTJ A;  3FIG A;  4DV6 E;  3C6M A;  3RMP A;  2H36 X;  1WJP A;  1QNT A;  2E1M A;  4R2Q A;  1PJQ A;  3M99 B;  2MKN A;  4ZYD A;  3T1H E;  2M7Q A;  1PJT A;  4IJD A;  2V87 A;  2N3H A;  4DR2 E;  4DR7 E;  3JAM C;  4K0K E;  2HHH E;  4R2P A;  2CTD A;  5A6J A;  4F6M A;  4F9B B;  2ODR D;  2EMF A;  2L8T A;  3THN A;  2ADR A;  1A1H A;  2L3C A;  1B69 A;  1UIL A;  4B3R E;  2EP3 A;  2EMG A;  2N3G A;  2B3T B;  5A6K A;  2EWL A;  3ECR A;  5F3W A;  4LFC E;  4WSP A;  1LLM C;  2FGG A;  2EM6 A;  2F8B A;  1YYK A;  4X65 E;  5KL3 A;  2DLK A;  4WYQ B;  2L2N A;  4DV3 E;  2EN3 A;  4OX9 E;  2RSM A;  1IBM E;  3BID A;  3QG5 C;  1FKA E;  4KZS A;  3ZOQ B;  3TQM A;  4R2S A;  2BB8 A;  2EN1 A;  1YUJ A;  4LF9 E;  4B3M E;  4R2E A;  1TF3 A;  1N3G A;  2YTD A;  4F2J C;  4R03 A;  2MDR A;  2LJH A;  2EOE A;  1WRJ A;  2EJ4 A;  2UUB E;  4FK5 C;  3P1X A;  2EQ1 A;  2EMA A;  1DI2 A;  1J26 A;  2EM3 A;  2V8Q B;  4YHH E;  2EOO A;  2JWO A;  1RQ0 A;  1YFH A;  2LUQ A;  2YWQ A;  3JTZ A;  1WXR A;  2GHF A;  3VHT B;  2D9H A;  2DIX A;  1HNW E;  2ELY A;  3J7A G;  3DF6 A;  1STU A;  3HQ1 A;  4BHC A;  2LTR A;  1ZBQ A;  4P7D A;  3K6Q A;  4WPY A;  2CPN A;  2ODR C;  2DRP A;  1X47 A;  2UUA E;  2R76 A;  4AQY E;  2EMB A;  3HTX A;  2LBS B;  5A6B D;  1GZ6 A;  5IXM B;  2VE7 C;  1T4L B;  4JI1 E;  5KL7 A;  4DR5 E;  2EN7 A;  2LE2 A;  5IT9 C;  1ZBT A;  2JY9 A;  3VYY A;  2ENA A;  4O24 A;  2MC6 A;  4JI6 E;  1XNQ E;  2YZT A;  4J8Z A;  4R2C A;  4WFT A;  5CFF E;  1IBK E;  2EN6 A;  1A1I A;  4R8O A;  1N32 E;  2RS7 A;  2EPC A;  2LO3 A;  3LLH A;  4BCA A;  2EMC A;  2I13 A;  2EOS A;  2IHR 1;  3KZZ A;  1G2F C;  2NUG A;  3EPL A;  4DUZ E;  4M0V A;  5KL5 A;  2JP9 A;  2EL4 A;  1T38 A;  2LT7 A;  4WXC A;  5KL6 A;  2UXC E;  4R2D A;  2NA2 A;  2E72 A;  1X3C A;  2I9I A;  4JI0 E;  4MLV A;  5KL2 A;  3J81 C;  2EN2 A;  4O43 A;  1YYO A;  2UUC E;  1MGT A;  3HPS A;  2LRS A;  3HPZ A;  4DR1 E;  2EMW A;  2M4I A;  1YYW A;  2K4V A;  2YTO A;  4IS1 C;  1IMU A;  2KON A;  1SR9 A;  4JI7 E;  4BC9 A;  1WHQ A;  5DNY A;  1EH7 A;  2L6M A;  3C4B A;  4X66 E;  5A6A A;  4I8O A;  5A69 A;  2JXP A;  3KWR A;  1AAY A;  1L4S A;  2M9A A;  1X48 A;  5LL6 R;  2DB2 A;  4LF4 E;  4Q35 B;  4GEQ B;  1WHN A;  3DJW A;  4B3S E;  2K7I A;  1A1L A;  2ELZ A;  2EOZ A;  1HNZ E;  4GKK E;  1X6H A;  2EMI A;  1NEI A;  2LUP B;  4Q28 A;  3HXL A;  2EPR A;  2ENC A;  4P78 A;  1T4O A;  2YRK A;  3MSW A;  1PDA A;  2EMY A;  4HEI A;  5LMU E;  2YTF A;  5T6J A;  1XNR E;  2L92 A;  4LU9 A;  1O0W A;  2V85 A;  1RC7 A;  4LFB E;  4JV5 E;  2NUF A;  4BS9 A;  2EPN A;  1X6E A;  1A1K A;  1A1G A;  2LMZ A;  2JOB A;  4DR6 E;  2MDG A;  3ADG A;  4M9V C;  1JK2 A;  4B3T E;  4JI5 E;  2YT4 A;  4DV7 E;  1KJK A;  5IV8 B;  1HNX E;  2KHX A;  3AUZ A;  2J7J A;  5LMN E;  4F9A B;  4LFA E;  4L8N A;  2MKD A;  1PKP A;  4TUI A;  2LJU A;  2EPU A;  2EOX A;  2M1S A;  1IQS A;  4F9C B;  4DUY E;  2RSI A;  4WX9 A;  2EMZ A;  2YTG A;  4F54 A;  1A1J A;  1XMQ E;  2E5L E;  5AC5 A;  4LF8 E;  2WBS A;  2YTN A;  3MHS C;  2YU8 A;  3BBG A;  2YTP A;  1J5E E;  2YRM A;  1GTK A;  4JI3 E;  3AV0 A;  3OML A;  3EPH A;  5IWA E;  5AAS A;  2YTI A;  5ADZ A;  2EM0 A;  1UN6 B;  2GLI A;  1XMO E;  1GQE A;  1KYQ A;  3IWD A;  2EMH A;  2EMX A;  4M2Z A;  4X8W A;  2VQE E;  2YTQ A;  1T4N A;  1BBG A;  2JOX A;  2L2M A;  1JK1 A;  2JVA A;  2KOU A;  4KWY A;  1RMD A;  2DLQ A;  4RH8 A;  2HGH A;  2CSH A;  1P47 A;  4DR3 E;  2JYA A;  4WXD A;  2VQF E;  2FTX B;  1TF6 A;  2HJJ A;  5FLX C;  3UK3 C;  1N33 E;  2UXB E;  2EPK X;  1SFE A;  2EPL X;  2G7H A;  1X5W A;  2B7V A;  4LF5 E;  4O5G A;  4JI2 E;  4DR4 E;  4ZYG A;  2Q8U A;  1NCS A;  2WBU A;  4ZYE A;  2YPN A;  4GZN C;  4KHP E;  4DKK A;  2RPC A;  2R1F A;  2FV4 B;  1UBD C;  2EQ0 A;  2ZM6 E;  4R2R A;  2BBG A;  2YRH A;  2EPX A;  2HC5 A;  4DMI A;  4F6N A;  3KZY A;  3LML A;  2B7T A;  3L00 A;  2JPA A;  4BBY A;  3THO B;  3MHH C;  3F6G A;  1G2D C;  2EOQ A;  4HTG A;  4BHB A;  1MEY C;  2DSY A;  4BMJ A;  3IWB A;  2WZO A;  1EKZ A;  1HR0 E;  2NUE A;  1EH8 A;  1DGC A;  2EOJ A;  2N8X A;  3EPJ A;  2LV2 A;  2EN8 A;  5A2Q C;  2EOY A;  3EPK A;  2EL5 A;  4JYA E;  2VRD A;  2UXD E;  1T39 A;  2DGC A;  2EL6 A;  1I94 E;  3ADI A;  5BR8 E;  2RQL A;  3EQ1 A;  5AE3 A; 
#chains in the Genus database with same CATH homology
 4IJD A;  2EN6 A;  1A1I A;  2EM7 A;  2EPC A;  2EPU A;  2LO3 A;  2EPP A;  2EOX A;  2EOI A;  5KL4 A;  2EMC A;  2ENH A;  2I13 A;  2EOS A;  1G2F C;  2RSI A;  2EMZ A;  2YTG A;  1A1J A;  4R2P A;  3EPL A;  2CTD A;  5KL5 A;  4F6M A;  2JP9 A;  2EMF A;  2EQ3 A;  2EL4 A;  2WBS A;  2YTN A;  3MHS C;  2LT7 A;  1YSA C;  5KL6 A;  2ADR A;  2YU8 A;  4R2D A;  2E72 A;  1X6F A;  2YTP A;  1A1H A;  1B69 A;  2YRM A;  1X3C A;  3EPH A;  2EP3 A;  5KL2 A;  2EMG A;  4X9J A;  1ZAA C;  2EOF A;  2YTE A;  2EM0 A;  2YTI A;  2GLI A;  1UN6 B;  2EN2 A;  1LLM C;  2EMW A;  2EM6 A;  2EM9 A;  2LVH A;  2YTO A;  2EMH A;  2EM8 A;  5KL3 A;  4WSG A;  4IS1 C;  2DLK A;  2EMX A;  2EN3 A;  2YTQ A;  1BBO A;  4R2S A;  2BB8 A;  2EN1 A;  1JK1 A;  2YSP A;  1YUJ A;  4R2E A;  1TF3 A;  2EE8 A;  1YUI A;  2YTD A;  4F2J C;  1RMD A;  2DLQ A;  2HGH A;  2CSH A;  4R2A A;  1P47 A;  2EOH A;  2EOE A;  2EJ4 A;  2EM2 A;  1AAY A;  2WBT A;  2M9A A;  4FK5 C;  2DMI A;  2EQ1 A;  2EPZ A;  2EMA A;  1TF6 A;  2EOM A;  3UK3 C;  2NAB A;  2EM3 A;  2EN4 A;  2EOO A;  1BB8 A;  1A1L A;  1X5W A;  2ELZ A;  2EOZ A;  2GHF A;  3VHT B;  2YU5 A;  1X6H A;  2EMI A;  2D9H A;  1ZR9 A;  1NCS A;  2ELY A;  1TN9 A;  2WBU A;  2EPR A;  2EOR A;  2PRT A;  2DRP A;  2ENC A;  1Z1B A;  2EPA A;  2YRK A;  4GZN C;  2EML A;  2RPC A;  1ZU1 A;  2WCC 3;  2R1F A;  1UBD C;  2EQ0 A;  2EMY A;  2EMK A;  2YTF A;  4R2R A;  2EMB A;  2CT1 A;  2EPX A;  2YRH A;  2EM5 A;  4F6N A;  1A1F A;  2LCE A;  1F2I G;  2A25 A;  2YSO A;  2JPA A;  3MHH C;  1G2D C;  1X6E A;  2EOQ A;  1A1K A;  5KL7 A;  2EM4 A;  1A1G A;  1MEY C;  2EN7 A;  2YTJ A;  2MDG A;  4M9V C;  1JK2 A;  1DGC A;  2EOJ A;  2ENA A;  1KJK A;  1WJP A;  4R2Q A;  3EPJ A;  2LV2 A;  2EN8 A;  2EOY A;  3EPK A;  2EL5 A;  2J7J A;  2VRD A;  2DGC A;  2EL6 A;  3M99 B;  4R2C A;  2MKN A;  2MKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...