3ZOQB

Structure of bsudg-p56 complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
48
structure length
48
Chain Sequence
DSYDVTMLLQDDDGKQYYEYHKGLSLSDFEVLYGNTADEIIKLRLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Functional Insights Into Uracil-DNA Glycosylase Inhibition by Phage Phi29 DNA Mimic Protein P56
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
molecule tags Hydrolase/viral protein
molecule keywords URACIL-DNA GLYCOSYLASE
total genus 9
structure length 48
sequence length 48
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.520 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3zoqB00
4L5NC 2LE2A 3ZOQB
chains in the Genus database with same CATH superfamily
2K7IA 2F8BA 2DSYA 2YTPA 2EN2A 2I13A 4FK5C 1ZBTA 5KL3A 1A1JA 2ADRA 2K4VA 4F6NA 3BBGA 1AH5A 3F6HA 2KOUA 4GKJE 3C4TA 4R2CA 2EM0A 4BS9A 4F9BB 2DLKA 1G2DC 4KHPE 2VQEE 2M4IA 4RHBB 5KL2A 5A6BD 1ZAAC 2VF1A 2NUGA 2CT1A 2EN8A 2L33A 3MHSC 1N33E 2EORA 5A69A 5LMNE 4ZYEA 2ENHA 1KJKA 2EOJA 1X48A 2YRHA 1EKZA 3ADJA 1PDAA 2UUBE 4YY3E 2JY9A 2FTXB 2EMGA 1BBGA 4MLQA 4DV5E 2LMZA 3JAMC 1HNZE 2YU5A 1J26A 5KL4A 2EMFA 4LFCE 2EN6A 2YU8A 5TSEA 4F6MA 1FKAE 1XNRE 2H36X 4R8OA 2YTNA 2YTGA 4DKKA 2EN7A 1IQSA 2EQ1A 3VYYA 3HQ1A 3VK6A 4KWYA 1UBDC 3VHTB 2HJJA 2JXPA 2L3JA 4DV2E 2EPPA 2DIXA 2GPIA 3MSWA 2V89A 4LFAE 4R03A 1HR0E 1N36E 2G7HA 5IV8B 4DR1E 2NUEA 2ENAA 2DMYA 1T38A 4BHBA 5AE2A 1DQ3A 4WXDA 4O24A 2LT7A 2EPMX 2V8QB 3KWRA 4X9JA 1BB8A 3DF6A 5ADZA 1N3GA 4HTGA 4JI2E 4X62E 2I9IA 2B3TB 2EQ3A 4DV0E 4TUGA 2FV4B 4R2DA 4JI3E 2EL5A 2EM8A 4KZSA 3T1YE 4P78A 1MEYC 1DI2A 3VYXA 3HPZA 1YYOA 1SR9A 2LUQA 4JI8E 4WX9A 2LJUA 2RQLA 4LF4E 2E1MA 2JOXA 1O0WA 1J5EE 1JK2A 3OTOE 2UU9E 2VE7C 4DUZE 2E5LE 4AQYE 2BB8A 3J81C 2M7QA 1QNTA 3TQMA 1YYWA 2YWQA 1X5WA 3C4BA 4GKKE 1A1FA 2EPUA 2EPOA 2RTXA 2CPNA 2MKNA 2LRSA 2V86A 4NZVA 5AC4A 4K0KE 4WPYA 2VRDA 2EMZA 3RMPA 3K6QA 2A25A 2EPKX 1MGTA 1G2FC 2RSIA 2DGCA 1UHZA 2FGGA 3THOB 2EMKA 4O43A 4ZYHA 2EMWA 2JP9A 1PKPA 2EMHA 4R2PA 5IT9C 1DGCA 2MDGA 4LTYA 1RC7A 2MC5A 3F6GA 2V88A 3ECRA 1XMOE 4LF5E 1T4LB 2YSPA 3EPHA 2YTFA 2EN1A 2V85A 4F9CB 3AV0A 4LF8E 3KZZA 2B7TA 3EPJA 2EMCA 2HC5A 2EP3A 4JI6E 1ZR9A 2EJ4A 4I8OA 2MKDA 1L4SA 3IWCA 2N3HA 4RH8A 4X65E 4ZYGA 2DRPA 3J80C 2DLQA 2EPNA 3BGHA 3JU0A 1B69A 2KHXA 4JI7E 2EWLA 4R2AA 4JI0E 2L2MA 2UXBE 3QG5C 2L2KB 2YRKA 4HEIA 2LJHA 2EOXA 2NUFA 4BCAA 2EMXA 4M30A 4LF7E 2JYAA 2JR1A 2MC6A 1SFEA 1AAYA 1N34E 2GLIA 5KL5A 3T1HE 2YSOA 4NHRA 4M9VC 2EQ0A 4LFBE 2HGHA 4DV1E 3C6MA 3THNA 2V83A 4WSPA 3LLHA 3MHHC 1WXRA 2L92A 1PJQA 2YPNA 5A6BA 4B3RE 1QU6A 3P1XA 2YTQA 5T6JA 2LBSB 4WSGA 4B3ME 4R2RA 4DV6E 2ENCA 2Q8UA 3H09A 4JI4E 3J7AG 2EOZA 4NXME 1X6FA 5BR8E 1GQEA 1YPNA 4LF6E 4X8WA 2JWOA 3IWBA 5A2QC 2EPAA 1TF6A 1T4OA 1EH8A 4JV5E 2YTOA 3C6KA 1X47A 2R1FA 3DJWA 2EOOA 4LF9E 2M9AA 2LV2A 2EMYA 4JI5E 5A6AA 3EPLA 2BBGA 2EM4A 2CTDA 2EOQA 5F3WA 1BBOA 2LO3A 2YT4A 3EQ1A 1IBLE 1TN9A 4JI1E 2EOSA 2PRTA 2ELYA 4IJDA 2UUCE 1XNQE 5KL6A 4DR5E 2N3GA 2EM6A 2DB2A 2EMLA 4J8ZA 2L2NA 4R2QA 2EMBA 4BBYA 5A6JA 3UK3C 4GEQB 1WRJA 3HTXA 4M2ZA 1X49A 2WBSA 2LTRA 2EM3A 3LMLA 4L8NA 1YFHA 4WXCA 1IQOA 4L5NC 4WFTA 2WZOA 2WBUA 2GHFA 2DMIA 1Z1BA 2LVHA 1XMQE 2IHR1 2LE2A 3ADLA 1YYKA 2RS7A 1WJPA 5LLQA 4N4RB 5AASA 2R76A 5AC5A 1YZ9A 1PJTA 1JK1A 3L00A 2EN3A 2EM7A 2M1SA 4YHHE 2V87A 4B3SE 1X3CA 3ADGA 2EOHA 2RS6A 1TF3A 2EE8A 2UUAE 4GZNC 2B9DA 1STUA 3BIDA 1YUJA 4OOGC 2EPCA 4O4KA 3KZYA 4DV4E 2YTEA 4P7DA 4DV3E 3BF2A 4F54A 2EOIA 2ELZA 1I94E 2EM9A 2EOEA 4DV7E 3EPKA 2EM2A 2EOFA 1ZBQA 2ODRC 4BMJA 2MDRA 1A1IA 2KONA 2EZ6A 2LTSA 5KL7A 2JPAA 2YRMA 1P47A 4LU9A 4OX9E 2ZM6E 2YTDA 4R2EA 5AE3A 2YZTA 1PJSA 2EL4A 1UN6B 1RQ0A 1WHQA 4DR6E 1N32E 2HHHE 3HXLA 1YUIA 2EN4A 3FIGA 4DR4E 3J7Yp 2L6MA 1EH6A 4DR2E 2J7JA 2JVAA 4F9AB 2EOMA 2UXCE 1X6HA 4DMIA 4Q35B 5DNYA 1FJGE 2NABA 4Q28A 4JYAE 2RSMA 5FLXC 5LL6R 1NEIA 2E72A 4TUIA 2L3CA 1YSAC 4M0VA 2EL6A 2N8XA 5AE1A 4X64E 1IBME 3JTZA 2EPLX 3HPSA 2UXDE 3AUZA 2B7VA 4ZYDA 4MLVA 1LLMC 1HNXE 2WBTA 4X66E 2YTJA 2EM5A 4DUYE 4IS1C 1T39A 1EH7A 5CFFE 2EPRA 2LUPB 1A1KA 1GZ6A 1ZU1A 2JOBA 3M99B 1A1GA 2L8TA 1KYQA 1WHNA 5IWAE 2WCC3 4NXNE 3IWDA 4BHCA 2EMAA 3ZOQB 1RMDA 1A1LA 1T4NA 2EOYA 4DR7E 4BC9A 2EMIA 4F2JC 2F4VE 2CSHA 1HNWE 1A1HA 3ADIA 2ODRD 4B3TE 1X6EA 2LCEA 3OMLA 1UILA 4O5GA 5IXMB 5A6KA 2EPXA 1IBKE 2NA2A 4BC7A 4R2SA 2RPCA 2VQFE 1GTKA 2YTIA 5LMUE 1NCSA 4DR3E 2D9HA 4WYQB 1IMUA 1F2IG 2EPZA
chains in the Genus database with same CATH topology
2FV4B 4DV4E 4LFBE 4P7DA 4JI3E 4DV3E 4DV1E 2F8BA 4F54A 2DSYA 4KZSA 3T1YE 4P78A 4WSPA 2V83A 1WXRA 3LLHA 1I94E 3VYXA 2L92A 1DI2A 3HPZA 4B3RE 1ZBTA 1QU6A 4DV7E 3P1XA 5T6JA 1YYOA 1ZBQA 2ODRC 1SR9A 2LUQA 4BMJA 2LBSB 4B3ME 4DV6E 2MDRA 4JI8E 2KONA 3H09A 2EZ6A 4LF4E 4JI4E 3J7AG 2LTSA 4NXME 2E1MA 2K4VA 2JOXA 4LU9A 1O0WA 4OX9E 5BR8E 1J5EE 2ZM6E 1GQEA 5AE3A 3OTOE 2UU9E 2VE7C 2YZTA 4DUZE 3F6HA 2KOUA 2E5LE 4GKJE 4AQYE 3C4TA 4LF6E 1RQ0A 1WHQA 4X8WA 2JWOA 3IWBA 3J81C 4BS9A 1N32E 4DR6E 4F9BB 2HHHE 5A2QC 3HXLA 2M7QA 1T4OA 1YYWA 4KHPE 4JV5E 3C4BA 3FIGA 2VQEE 4GKKE 4DR4E 2RTXA 2M4IA 2CPNA 2L6MA 3J7Yp 2LRSA 2V86A 2VF1A 4DR2E 2JVAA 1X47A 4K0KE 4WPYA 2L33A 4F9AB 2NUGA 1N33E 3DJWA 5LMNE 2UXCE 4LF9E 4DMIA 3RMPA 5DNYA 3K6QA 1FJGE 4JI5E 4Q28A 4JYAE 1X48A 1EKZA 3ADJA 2RSMA 5F3WA 1UHZA 2FGGA 2JY9A 4YY3E 5FLXC 2FTXB 2UUBE 5LL6R 2YT4A 4TUGA 4TUIA 4DV5E 2LMZA 3JAMC 2L3CA 1IBLE 1PKPA 4M0VA 4JI1E 5AE1A 4X64E 1HNZE 1IBME 1J26A 3JTZA 5IT9C 4LFCE 3HPSA 4LTYA 2UXDE 3AUZA 1RC7A 2B7VA 2MC5A 2UUCE 1XNQE 4DR5E 2N3GA 1FKAE 1XNRE 2DB2A 4J8ZA 2L2NA 3F6GA 4BBYA 3HTXA 2H36X 4GEQB 1HNXE 4X66E 2V88A 4DUYE 1X49A 4R8OA 4M2ZA 4DKKA 2LTRA 1XMOE 4LF5E 3VYYA 5CFFE 1T4LB 3HQ1A 3VK6A 3LMLA 2LUPB 4L8NA 1GZ6A 2JOBA 2L8TA 2V85A 4F9CB 3AV0A 2L3JA 4LF8E 1WHNA 4DV2E 2B7TA 5IWAE 4L5NC 4WFTA 2DIXA 4NXNE 3IWDA 3MSWA 4JI6E 3ZOQB 2V89A 4LFAE 4I8OA 1T4NA 2WZOA 4R03A 1HR0E 1N36E 3IWCA 2N3HA 2G7HA 4X65E 4DR1E 1XMQE 4DR7E 2IHR1 2LE2A 4BC9A 2NUEA 3ADLA 2DMYA 3J80C 2RS7A 1YYKA 5AASA 5AE2A 1YZ9A 1DQ3A 3JU0A 2F4VE 2KHXA 4JI7E 1HNWE 2EWLA 2M1SA 4YHHE 4JI0E 2V8QB 2V87A 2L2MA 2ODRD 3KWRA 4B3TE 3ADIA 2L2KB 4B3SE 3DF6A 2UXBE 3OMLA 5ADZA 1UILA 1IBKE 2LJHA 3ADGA 2RS6A 4BCAA 2NUFA 4M30A 4LF7E 2NA2A 4BC7A 2JR1A 2MC6A 2UUAE 4JI2E 2VQFE 4X62E 2B9DA 5LMUE 4DR3E 2B3TB 1STUA 4WYQB 1N34E 4DV0E 4OOGC 3T1HE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L5N C;  2LE2 A;  3ZOQ B; 
#chains in the Genus database with same CATH topology
 2K7I A;  2F8B A;  2DSY A;  2YTP A;  2EN2 A;  2I13 A;  4FK5 C;  1ZBT A;  5KL3 A;  1A1J A;  2ADR A;  2K4V A;  4F6N A;  3BBG A;  1AH5 A;  3F6H A;  2KOU A;  4GKJ E;  3C4T A;  4R2C A;  2EM0 A;  4BS9 A;  4F9B B;  2DLK A;  1G2D C;  4KHP E;  2VQE E;  2M4I A;  4RHB B;  5KL2 A;  5A6B D;  1ZAA C;  2VF1 A;  2NUG A;  2CT1 A;  2EN8 A;  2L33 A;  3MHS C;  1N33 E;  2EOR A;  5A69 A;  5LMN E;  4ZYE A;  2ENH A;  1KJK A;  2EOJ A;  1X48 A;  2YRH A;  1EKZ A;  3ADJ A;  1PDA A;  2UUB E;  4YY3 E;  2JY9 A;  2FTX B;  2EMG A;  1BBG A;  4MLQ A;  4DV5 E;  2LMZ A;  3JAM C;  1HNZ E;  2YU5 A;  1J26 A;  5KL4 A;  2EMF A;  4LFC E;  2EN6 A;  2YU8 A;  5TSE A;  4F6M A;  1FKA E;  1XNR E;  2H36 X;  4R8O A;  2YTN A;  2YTG A;  4DKK A;  2EN7 A;  1IQS A;  2EQ1 A;  3VYY A;  3HQ1 A;  3VK6 A;  4KWY A;  1UBD C;  3VHT B;  2HJJ A;  2JXP A;  2L3J A;  4DV2 E;  2EPP A;  2DIX A;  2GPI A;  3MSW A;  2V89 A;  4LFA E;  4R03 A;  1HR0 E;  1N36 E;  2G7H A;  5IV8 B;  4DR1 E;  2NUE A;  2ENA A;  2DMY A;  1T38 A;  4BHB A;  5AE2 A;  1DQ3 A;  4WXD A;  4O24 A;  2LT7 A;  2EPM X;  2V8Q B;  3KWR A;  4X9J A;  1BB8 A;  3DF6 A;  5ADZ A;  1N3G A;  4HTG A;  4JI2 E;  4X62 E;  2I9I A;  2B3T B;  2EQ3 A;  4DV0 E;  4TUG A;  2FV4 B;  4R2D A;  4JI3 E;  2EL5 A;  2EM8 A;  4KZS A;  3T1Y E;  4P78 A;  1MEY C;  1DI2 A;  3VYX A;  3HPZ A;  1YYO A;  1SR9 A;  2LUQ A;  4JI8 E;  4WX9 A;  2LJU A;  2RQL A;  4LF4 E;  2E1M A;  2JOX A;  1O0W A;  1J5E E;  1JK2 A;  3OTO E;  2UU9 E;  2VE7 C;  4DUZ E;  2E5L E;  4AQY E;  2BB8 A;  3J81 C;  2M7Q A;  1QNT A;  3TQM A;  1YYW A;  2YWQ A;  1X5W A;  3C4B A;  4GKK E;  1A1F A;  2EPU A;  2EPO A;  2RTX A;  2CPN A;  2MKN A;  2LRS A;  2V86 A;  4NZV A;  5AC4 A;  4K0K E;  4WPY A;  2VRD A;  2EMZ A;  3RMP A;  3K6Q A;  2A25 A;  2EPK X;  1MGT A;  1G2F C;  2RSI A;  2DGC A;  1UHZ A;  2FGG A;  3THO B;  2EMK A;  4O43 A;  4ZYH A;  2EMW A;  2JP9 A;  1PKP A;  2EMH A;  4R2P A;  5IT9 C;  1DGC A;  2MDG A;  4LTY A;  1RC7 A;  2MC5 A;  3F6G A;  2V88 A;  3ECR A;  1XMO E;  4LF5 E;  1T4L B;  2YSP A;  3EPH A;  2YTF A;  2EN1 A;  2V85 A;  4F9C B;  3AV0 A;  4LF8 E;  3KZZ A;  2B7T A;  3EPJ A;  2EMC A;  2HC5 A;  2EP3 A;  4JI6 E;  1ZR9 A;  2EJ4 A;  4I8O A;  2MKD A;  1L4S A;  3IWC A;  2N3H A;  4RH8 A;  4X65 E;  4ZYG A;  2DRP A;  3J80 C;  2DLQ A;  2EPN A;  3BGH A;  3JU0 A;  1B69 A;  2KHX A;  4JI7 E;  2EWL A;  4R2A A;  4JI0 E;  2L2M A;  2UXB E;  3QG5 C;  2L2K B;  2YRK A;  4HEI A;  2LJH A;  2EOX A;  2NUF A;  4BCA A;  2EMX A;  4M30 A;  4LF7 E;  2JYA A;  2JR1 A;  2MC6 A;  1SFE A;  1AAY A;  1N34 E;  2GLI A;  5KL5 A;  3T1H E;  2YSO A;  4NHR A;  4M9V C;  2EQ0 A;  4LFB E;  2HGH A;  4DV1 E;  3C6M A;  3THN A;  2V83 A;  4WSP A;  3LLH A;  3MHH C;  1WXR A;  2L92 A;  1PJQ A;  2YPN A;  5A6B A;  4B3R E;  1QU6 A;  3P1X A;  2YTQ A;  5T6J A;  2LBS B;  4WSG A;  4B3M E;  4R2R A;  4DV6 E;  2ENC A;  2Q8U A;  3H09 A;  4JI4 E;  3J7A G;  2EOZ A;  4NXM E;  1X6F A;  5BR8 E;  1GQE A;  1YPN A;  4LF6 E;  4X8W A;  2JWO A;  3IWB A;  5A2Q C;  2EPA A;  1TF6 A;  1T4O A;  1EH8 A;  4JV5 E;  2YTO A;  3C6K A;  1X47 A;  2R1F A;  3DJW A;  2EOO A;  4LF9 E;  2M9A A;  2LV2 A;  2EMY A;  4JI5 E;  5A6A A;  3EPL A;  2BBG A;  2EM4 A;  2CTD A;  2EOQ A;  5F3W A;  1BBO A;  2LO3 A;  2YT4 A;  3EQ1 A;  1IBL E;  1TN9 A;  4JI1 E;  2EOS A;  2PRT A;  2ELY A;  4IJD A;  2UUC E;  1XNQ E;  5KL6 A;  4DR5 E;  2N3G A;  2EM6 A;  2DB2 A;  2EML A;  4J8Z A;  2L2N A;  4R2Q A;  2EMB A;  4BBY A;  5A6J A;  3UK3 C;  4GEQ B;  1WRJ A;  3HTX A;  4M2Z A;  1X49 A;  2WBS A;  2LTR A;  2EM3 A;  3LML A;  4L8N A;  1YFH A;  4WXC A;  1IQO A;  4L5N C;  4WFT A;  2WZO A;  2WBU A;  2GHF A;  2DMI A;  1Z1B A;  2LVH A;  1XMQ E;  2IHR 1;  2LE2 A;  3ADL A;  1YYK A;  2RS7 A;  1WJP A;  5LLQ A;  4N4R B;  5AAS A;  2R76 A;  5AC5 A;  1YZ9 A;  1PJT A;  1JK1 A;  3L00 A;  2EN3 A;  2EM7 A;  2M1S A;  4YHH E;  2V87 A;  4B3S E;  1X3C A;  3ADG A;  2EOH A;  2RS6 A;  1TF3 A;  2EE8 A;  2UUA E;  4GZN C;  2B9D A;  1STU A;  3BID A;  1YUJ A;  4OOG C;  2EPC A;  4O4K A;  3KZY A;  4DV4 E;  2YTE A;  4P7D A;  4DV3 E;  3BF2 A;  4F54 A;  2EOI A;  2ELZ A;  1I94 E;  2EM9 A;  2EOE A;  4DV7 E;  3EPK A;  2EM2 A;  2EOF A;  1ZBQ A;  2ODR C;  4BMJ A;  2MDR A;  1A1I A;  2KON A;  2EZ6 A;  2LTS A;  5KL7 A;  2JPA A;  2YRM A;  1P47 A;  4LU9 A;  4OX9 E;  2ZM6 E;  2YTD A;  4R2E A;  5AE3 A;  2YZT A;  1PJS A;  2EL4 A;  1UN6 B;  1RQ0 A;  1WHQ A;  4DR6 E;  1N32 E;  2HHH E;  3HXL A;  1YUI A;  2EN4 A;  3FIG A;  4DR4 E;  3J7Y p;  2L6M A;  1EH6 A;  4DR2 E;  2J7J A;  2JVA A;  4F9A B;  2EOM A;  2UXC E;  1X6H A;  4DMI A;  4Q35 B;  5DNY A;  1FJG E;  2NAB A;  4Q28 A;  4JYA E;  2RSM A;  5FLX C;  5LL6 R;  1NEI A;  2E72 A;  4TUI A;  2L3C A;  1YSA C;  4M0V A;  2EL6 A;  2N8X A;  5AE1 A;  4X64 E;  1IBM E;  3JTZ A;  2EPL X;  3HPS A;  2UXD E;  3AUZ A;  2B7V A;  4ZYD A;  4MLV A;  1LLM C;  1HNX E;  2WBT A;  4X66 E;  2YTJ A;  2EM5 A;  4DUY E;  4IS1 C;  1T39 A;  1EH7 A;  5CFF E;  2EPR A;  2LUP B;  1A1K A;  1GZ6 A;  1ZU1 A;  2JOB A;  3M99 B;  1A1G A;  2L8T A;  1KYQ A;  1WHN A;  5IWA E;  2WCC 3;  4NXN E;  3IWD A;  4BHC A;  2EMA A;  3ZOQ B;  1RMD A;  1A1L A;  1T4N A;  2EOY A;  4DR7 E;  4BC9 A;  2EMI A;  4F2J C;  2F4V E;  2CSH A;  1HNW E;  1A1H A;  3ADI A;  2ODR D;  4B3T E;  1X6E A;  2LCE A;  3OML A;  1UIL A;  4O5G A;  5IXM B;  5A6K A;  2EPX A;  1IBK E;  2NA2 A;  4BC7 A;  4R2S A;  2RPC A;  2VQF E;  1GTK A;  2YTI A;  5LMU E;  1NCS A;  4DR3 E;  2D9H A;  4WYQ B;  1IMU A;  1F2I G;  2EPZ A; 
#chains in the Genus database with same CATH homology
 2FV4 B;  4DV4 E;  4LFB E;  4P7D A;  4JI3 E;  4DV3 E;  4DV1 E;  2F8B A;  4F54 A;  2DSY A;  4KZS A;  3T1Y E;  4P78 A;  4WSP A;  2V83 A;  1WXR A;  3LLH A;  1I94 E;  3VYX A;  2L92 A;  1DI2 A;  3HPZ A;  4B3R E;  1ZBT A;  1QU6 A;  4DV7 E;  3P1X A;  5T6J A;  1YYO A;  1ZBQ A;  2ODR C;  1SR9 A;  2LUQ A;  4BMJ A;  2LBS B;  4B3M E;  4DV6 E;  2MDR A;  4JI8 E;  2KON A;  3H09 A;  2EZ6 A;  4LF4 E;  4JI4 E;  3J7A G;  2LTS A;  4NXM E;  2E1M A;  2K4V A;  2JOX A;  4LU9 A;  1O0W A;  4OX9 E;  5BR8 E;  1J5E E;  2ZM6 E;  1GQE A;  5AE3 A;  3OTO E;  2UU9 E;  2VE7 C;  2YZT A;  4DUZ E;  3F6H A;  2KOU A;  2E5L E;  4GKJ E;  4AQY E;  3C4T A;  4LF6 E;  1RQ0 A;  1WHQ A;  4X8W A;  2JWO A;  3IWB A;  3J81 C;  4BS9 A;  1N32 E;  4DR6 E;  4F9B B;  2HHH E;  5A2Q C;  3HXL A;  2M7Q A;  1T4O A;  1YYW A;  4KHP E;  4JV5 E;  3C4B A;  3FIG A;  2VQE E;  4GKK E;  4DR4 E;  2RTX A;  2M4I A;  2CPN A;  2L6M A;  3J7Y p;  2LRS A;  2V86 A;  2VF1 A;  4DR2 E;  2JVA A;  1X47 A;  4K0K E;  4WPY A;  2L33 A;  4F9A B;  2NUG A;  1N33 E;  3DJW A;  5LMN E;  2UXC E;  4LF9 E;  4DMI A;  3RMP A;  5DNY A;  3K6Q A;  1FJG E;  4JI5 E;  4Q28 A;  4JYA E;  1X48 A;  1EKZ A;  3ADJ A;  2RSM A;  5F3W A;  1UHZ A;  2FGG A;  2JY9 A;  4YY3 E;  5FLX C;  2FTX B;  2UUB E;  5LL6 R;  2YT4 A;  4TUG A;  4TUI A;  4DV5 E;  2LMZ A;  3JAM C;  2L3C A;  1IBL E;  1PKP A;  4M0V A;  4JI1 E;  5AE1 A;  4X64 E;  1HNZ E;  1IBM E;  1J26 A;  3JTZ A;  5IT9 C;  4LFC E;  3HPS A;  4LTY A;  2UXD E;  3AUZ A;  1RC7 A;  2B7V A;  2MC5 A;  2UUC E;  1XNQ E;  4DR5 E;  2N3G A;  1FKA E;  1XNR E;  2DB2 A;  4J8Z A;  2L2N A;  3F6G A;  4BBY A;  3HTX A;  2H36 X;  4GEQ B;  1HNX E;  4X66 E;  2V88 A;  4DUY E;  1X49 A;  4R8O A;  4M2Z A;  4DKK A;  2LTR A;  1XMO E;  4LF5 E;  3VYY A;  5CFF E;  1T4L B;  3HQ1 A;  3VK6 A;  3LML A;  2LUP B;  4L8N A;  1GZ6 A;  2JOB A;  2L8T A;  2V85 A;  4F9C B;  3AV0 A;  2L3J A;  4LF8 E;  1WHN A;  4DV2 E;  2B7T A;  5IWA E;  4L5N C;  4WFT A;  2DIX A;  4NXN E;  3IWD A;  3MSW A;  4JI6 E;  3ZOQ B;  2V89 A;  4LFA E;  4I8O A;  1T4N A;  2WZO A;  4R03 A;  1HR0 E;  1N36 E;  3IWC A;  2N3H A;  2G7H A;  4X65 E;  4DR1 E;  1XMQ E;  4DR7 E;  2IHR 1;  2LE2 A;  4BC9 A;  2NUE A;  3ADL A;  2DMY A;  3J80 C;  2RS7 A;  1YYK A;  5AAS A;  5AE2 A;  1YZ9 A;  1DQ3 A;  3JU0 A;  2F4V E;  2KHX A;  4JI7 E;  1HNW E;  2EWL A;  2M1S A;  4YHH E;  4JI0 E;  2V8Q B;  2V87 A;  2L2M A;  2ODR D;  3KWR A;  4B3T E;  3ADI A;  2L2K B;  4B3S E;  3DF6 A;  2UXB E;  3OML A;  5ADZ A;  1UIL A;  1IBK E;  2LJH A;  3ADG A;  2RS6 A;  4BCA A;  2NUF A;  4M30 A;  4LF7 E;  2NA2 A;  4BC7 A;  2JR1 A;  2MC6 A;  2UUA E;  4JI2 E;  2VQF E;  4X62 E;  2B9D A;  5LMU E;  4DR3 E;  2B3T B;  1STU A;  4WYQ B;  1N34 E;  4DV0 E;  4OOG C;  3T1H E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...