3ZOQB

Structure of bsudg-p56 complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
48
structure length
48
Chain Sequence
DSYDVTMLLQDDDGKQYYEYHKGLSLSDFEVLYGNTADEIIKLRLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Functional Insights Into Uracil-DNA Glycosylase Inhibition by Phage Phi29 DNA Mimic Protein P56
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
molecule tags Hydrolase/viral protein
molecule keywords URACIL-DNA GLYCOSYLASE
total genus 9
structure length 48
sequence length 48
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.520 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3zoqB00
2LE2A 3ZOQB 4L5NC
chains in the Genus database with same CATH superfamily
2J7JA 2V85A 4WFTA 4DMIA 2EOQA 2YTIA 2FTXB 2DGCA 4FK5C 1J5EE 1IBME 5AASA 1F2IG 4WPYA 3THOB 1J26A 2ODRD 1YYOA 2N3GA 2R76A 2CPNA 1SR9A 4JI0E 2NUGA 3IWDA 2ADRA 2H36X 2EPXA 2EM9A 2B7TA 2EPLX 4X62E 4ZYDA 1FKAE 2EOXA 2YTGA 1TN9A 1T4NA 2YWQA 1GQEA 1HNWE 2EN2A 2WCC3 3VYXA 2ODRC 1UHZA 2B7VA 4WSGA 4JI6E 4NXNE 5LMUE 4LF7E 1FJGE 1UBDC 1WRJA 1WXRA 4O24A 1HR0E 4LF6E 4IS1C 1YYWA 4X9JA 1GZ6A 2JOBA 2LRSA 1UN6B 1WHNA 3KWRA 4NHRA 1WJPA 2NA2A 4HEIA 2EPCA 3AUZA 2V8QB 4DR4E 2JYAA 4K0KE 4YHHE 3MHSC 3MSWA 1DQ3A 4L8NA 1N33E 2YU5A 4JI8E 3ADIA 4F9CB 2A25A 1YUJA 5AC4A 3K6QA 2EM4A 2EM7A 2Q8UA 2YPNA 2LCEA 4BHCA 2EPKX 3P1XA 5A6BD 3C6KA 1I94E 1X6EA 4DV4E 4JI1E 1NEIA 3ADLA 2EL5A 4AQYE 4JI7E 3ECRA 5KL4A 2M9AA 4DV2E 1YSAC 2YTEA 2YRHA 2L3CA 2BB8A 1X6HA 1N3GA 1YUIA 4HTGA 1NCSA 2YTQA 5AE3A 4GEQB 2EM0A 1EH8A 2EOFA 2EQ0A 5A69A 2D9HA 3JU0A 1G2DC 1ZAAC 2V89A 4P78A 2MC5A 2EPNA 4DV3E 2EMIA 2DB2A 4LFAE 2UUCE 3HPZA 2EN1A 4R2RA 2JR1A 2EM5A 4R2DA 4R2EA 4ZYEA 2ENHA 4LFCE 3EPHA 1X49A 3KZYA 1ZU1A 4JV5E 2V86A 2UXBE 1UILA 2L2NA 1A1KA 4BS9A 1HNXE 3L00A 5IXMB 5IWAE 4BCAA 2YRKA 4R2CA 5KL3A 4WX9A 4DV6E 3F6GA 2PRTA 2DMIA 2V87A 2WBTA 2RS6A 4DV0E 2LV2A 4JI5E 2MDGA 4NZVA 2VQFE 4OX9E 2EMAA 1A1FA 4OOGC 2EN7A 2EM3A 4LF5E 3JAMC 3BF2A 4DV1E 3J7AG 2YTJA 2YU8A 2VRDA 4DR1E 2M1SA 1X3CA 2VE7C 1T38A 1PJTA 2EPRA 2EN6A 1KJKA 4TUGA 2EMGA 3J80C 2LT7A 3OMLA 4X65E 2E72A 4RHBB 5AE1A 2EE8A 5A6BA 4WYQB 5F3WA 4JYAE 2JOXA 4GKJE 2CSHA 2L92A 1STUA 2DLQA 1AAYA 1EKZA 2EZ6A 1BBOA 4DR7E 2RSIA 3MHHC 3EPLA 4B3TE 2UUAE 5LLQA 3DJWA 4ZYGA 2E1MA 2EMZA 1T4LB 2F4VE 3VHTB 1ZR9A 2EL6A 3EPKA 2K4VA 2HHHE 3BGHA 2EN4A 2EN3A 4JI3E 1IBKE 4BHBA 2MC6A 3UK3C 4J8ZA 2N3HA 4LU9A 2NABA 3HXLA 1O0WA 3QG5C 2EORA 1BB8A 5CFFE 1G2FC 2EQ3A 4WXCA 4M2ZA 2EMHA 4GZNC 4F6NA 4GKKE 4DR3E 3HTXA 1RMDA 3RMPA 2YT4A 1SFEA 4O43A 2GLIA 2GHFA 2L6MA 1B69A 2EL4A 1YZ9A 1A1LA 2EM2A 1N34E 3J7Yp 5KL5A 4DR6E 4DR2E 4F6MA 3IWBA 2EMCA 1ZBQA 2RQLA 2LJUA 4DV5E 2EPMX 2EOSA 2I9IA 4BMJA 2N8XA 2EWLA 4DUYE 4BBYA 2YSPA 2R1FA 3F6HA 2EPOA 2I13A 2EMXA 1A1IA 3J81C 1YFHA 2JPAA 2LUQA 4B3RE 2KHXA 2YSOA 2EOOA 4O4KA 4ZYHA 1DI2A 1RC7A 2EM8A 2LTRA 3IWCA 2VQEE 3FIGA 4MLQA 2MDRA 3EPJA 4WXDA 1JK1A 2L3JA 2L2KB 4B3SE 4X64E 2DRPA 2B3TB 5ADZA 1PDAA 2JY9A 2LVHA 2EPPA 3ZOQB 1IBLE 3HPSA 5A2QC 4X66E 2DLKA 5A6JA 4F9BB 3ADGA 3OTOE 4R03A 4DKKA 2KONA 4R2PA 4P7DA 1YYKA 2WBUA 3T1YE 5KL2A 1A1GA 2RS7A 2V83A 4Q28A 5IV8B 1EH7A 2YTDA 4M9VC 4LFBE 2EMYA 2JVAA 2M7QA 2HJJA 2RPCA 2EPUA 5A6AA 2WZOA 3HQ1A 2NUFA 2UXDE 1T4OA 2EM6A 1A1HA 1A1JA 2F8BA 2DSYA 1XNRE 4L5NC 4NXME 2JXPA 1EH6A 1BBGA 3C6MA 4YY3E 2EJ4A 2LUPB 2YTOA 2KOUA 2LBSB 5LMNE 5BR8E 2EOJA 2FV4B 3M99B 1MEYC 3THNA 2UXCE 1PJQA 3EQ1A 3VYYA 2EMKA 2V88A 1MGTA 3H09A 4KZSA 1HNZE 1X6FA 4MLVA 2RSMA 2EOEA 4IJDA 4R8OA 2EP3A 1XMQE 2EOHA 4DUZE 1IQOA 2EN8A 1YPNA 1L4SA 5A6KA 3AV0A 2LMZA 4BC7A 5AE2A 5LL6R 2EMWA 1DGCA 2GPIA 2ENCA 4LF4E 1GTKA 1QU6A 1X48A 2CT1A 2LE2A 2LJHA 4B3ME 2JWOA 2L33A 2VF1A 1LLMC 4R2SA 1N36E 3KZZA 2EOIA 2L2MA 4F2JC 4KHPE 4WSPA 4DR5E 2ELYA 2B9DA 4DV7E 4N4RB 3VK6A 3BBGA 2UU9E 4LF9E 2M4IA 2EPZA 2DMYA 2EMFA 4F54A 4TUIA 3ADJA 2EMBA 2DIXA 2CTDA 2YTPA 1X47A 1PJSA 2EMLA 5KL6A 1X5WA 2YRMA 2YTFA 4R2QA 5KL7A 1QNTA 4O5GA 2HGHA 2FGGA 1IQSA 2YZTA 4M0VA 2G7HA 2MKNA 2ENAA 2BBGA 1Z1BA 3DF6A 2IHR1 5IT9C 2UUBE 3TQMA 3C4BA 1XNQE 2YTNA 5T6JA 4KWYA 2HC5A 4JI4E 1N32E 1WHQA 1XMOE 1PKPA 1ZBTA 5FLXC 1RQ0A 1IMUA 4I8OA 3LLHA 2L8TA 4JI2E 2EQ1A 2ELZA 2MKDA 4BC9A 2E5LE 3C4TA 2LO3A 2NUEA 4R2AA 1JK2A 1TF6A 3T1HE 5DNYA 3JTZA 4LF8E 2EPAA 2LTSA 1P47A 2WBSA 2K7IA 2EOZA 2JP9A 1KYQA 1T39A 4Q35B 2ZM6E 2EOYA 3LMLA 1AH5A 5TSEA 4X8WA 1TF3A 2EOMA 4LTYA 3BIDA 4F9AB 4M30A 5AC5A 4RH8A 2RTXA
chains in the Genus database with same CATH topology
4M2ZA 5AE3A 4GEQB 2V85A 4WFTA 3AV0A 4DMIA 2LMZA 3JU0A 4GKKE 2V89A 4DR3E 3HTXA 3RMPA 2YT4A 4P78A 2FTXB 2MC5A 4BC7A 5AE2A 1J5EE 5LL6R 5AASA 4DV3E 1IBME 2DB2A 2L6MA 4LFAE 2UUCE 3HPZA 4WPYA 2JR1A 1YZ9A 1J26A 4LF9E 1N34E 3J7Yp 4DR6E 4DR2E 2ODRD 3IWBA 4LF4E 1ZBQA 4LFCE 1QU6A 1X48A 2LE2A 2LJHA 4DV5E 1YYOA 2VF1A 2JWOA 2L33A 1X49A 2CPNA 2N3GA 1SR9A 4BMJA 4JI0E 2EWLA 2NUGA 3IWDA 1N36E 4DUYE 4BBYA 2H36X 3F6HA 4JV5E 2V86A 2B7TA 2UXBE 2L2MA 4KHPE 1UILA 2L2NA 4BS9A 1HNXE 4X62E 3J81C 4WSPA 1FKAE 2LUQA 4DR5E 5IWAE 4B3RE 4BCAA 2B9DA 2KHXA 4DV7E 1DI2A 4DV6E 1T4NA 3F6GA 1RC7A 2LTRA 3IWCA 1GQEA 3VK6A 2VQEE 3FIGA 1HNWE 2MDRA 2V87A 2M4IA 2UU9E 2DMYA 2RS6A 4F54A 4TUIA 3ADJA 2L3JA 2ODRC 2L2KB 4DV0E 4X64E 2DIXA 4B3SE 1UHZA 2B7VA 4JI5E 4JI6E 4NXNE 2B3TB 5ADZA 5LMUE 1X47A 4LF7E 2JY9A 2VQFE 1FJGE 4OX9E 1WXRA 4OOGC 3ZOQB 4LF5E 3JAMC 4DV1E 1HR0E 4LF6E 3J7AG 1YYWA 1IBLE 3HPSA 1GZ6A 2JOBA 4X66E 2FGGA 2YZTA 4M0VA 5A2QC 2G7HA 2LRSA 4DR1E 2M1SA 4F9BB 3DF6A 2IHR1 3ADGA 2VE7C 3OTOE 4R03A 5IT9C 4DKKA 2KONA 2UUBE 4P7DA 3C4BA 1WHNA 1YYKA 1XNQE 3T1YE 3KWRA 2RS7A 2V83A 4TUGA 4Q28A 5T6JA 2NA2A 3J80C 3AUZA 4JI4E 1N32E 2V8QB 4DR4E 4LFBE 1WHQA 2JVAA 2M7QA 3OMLA 1XMOE 4K0KE 4X65E 4YHHE 3MSWA 1PKPA 5AE1A 1ZBTA 2WZOA 1DQ3A 4WYQB 5FLXC 3HQ1A 1RQ0A 4L8NA 5F3WA 2NUFA 2JOXA 4JYAE 2L92A 4GKJE 1STUA 4B3ME 4I8OA 4JI8E 3ADIA 1EKZA 1T4OA 3LLHA 2EZ6A 2UXDE 4F9CB 2L8TA 4JI2E 2F8BA 2DSYA 1XNRE 4DR7E 4L5NC 4BC9A 4NXME 3K6QA 4B3TE 2E5LE 2UUAE 3VYXA 3C4TA 3DJWA 2E1MA 1T4LB 3ADLA 2F4VE 4YY3E 3P1XA 2HHHE 2K4VA 2LUPB 2NUEA 1I94E 2KOUA 1N33E 4DV4E 2LBSB 5LMNE 5DNYA 3JTZA 5BR8E 3T1HE 2FV4B 4JI1E 4AQYE 4JI3E 4JI7E 2LTSA 1IBKE 4LF8E 2UXCE 3VYYA 2V88A 3H09A 4KZSA 4DV2E 1HNZE 2MC6A 2ZM6E 2L3CA 2RSMA 3LMLA 4J8ZA 2N3HA 4LU9A 4X8WA 3HXLA 1O0WA 4R8OA 1XMQE 4LTYA 4DUZE 4F9AB 5CFFE 4M30A 2RTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LE2 A;  3ZOQ B;  4L5N C; 
#chains in the Genus database with same CATH topology
 2J7J A;  2V85 A;  4WFT A;  4DMI A;  2EOQ A;  2YTI A;  2FTX B;  2DGC A;  4FK5 C;  1J5E E;  1IBM E;  5AAS A;  1F2I G;  4WPY A;  3THO B;  1J26 A;  2ODR D;  1YYO A;  2N3G A;  2R76 A;  2CPN A;  1SR9 A;  4JI0 E;  2NUG A;  3IWD A;  2ADR A;  2H36 X;  2EPX A;  2EM9 A;  2B7T A;  2EPL X;  4X62 E;  4ZYD A;  1FKA E;  2EOX A;  2YTG A;  1TN9 A;  1T4N A;  2YWQ A;  1GQE A;  1HNW E;  2EN2 A;  2WCC 3;  3VYX A;  2ODR C;  1UHZ A;  2B7V A;  4WSG A;  4JI6 E;  4NXN E;  5LMU E;  4LF7 E;  1FJG E;  1UBD C;  1WRJ A;  1WXR A;  4O24 A;  1HR0 E;  4LF6 E;  4IS1 C;  1YYW A;  4X9J A;  1GZ6 A;  2JOB A;  2LRS A;  1UN6 B;  1WHN A;  3KWR A;  4NHR A;  1WJP A;  2NA2 A;  4HEI A;  2EPC A;  3AUZ A;  2V8Q B;  4DR4 E;  2JYA A;  4K0K E;  4YHH E;  3MHS C;  3MSW A;  1DQ3 A;  4L8N A;  1N33 E;  2YU5 A;  4JI8 E;  3ADI A;  4F9C B;  2A25 A;  1YUJ A;  5AC4 A;  3K6Q A;  2EM4 A;  2EM7 A;  2Q8U A;  2YPN A;  2LCE A;  4BHC A;  2EPK X;  3P1X A;  5A6B D;  3C6K A;  1I94 E;  1X6E A;  4DV4 E;  4JI1 E;  1NEI A;  3ADL A;  2EL5 A;  4AQY E;  4JI7 E;  3ECR A;  5KL4 A;  2M9A A;  4DV2 E;  1YSA C;  2YTE A;  2YRH A;  2L3C A;  2BB8 A;  1X6H A;  1N3G A;  1YUI A;  4HTG A;  1NCS A;  2YTQ A;  5AE3 A;  4GEQ B;  2EM0 A;  1EH8 A;  2EOF A;  2EQ0 A;  5A69 A;  2D9H A;  3JU0 A;  1G2D C;  1ZAA C;  2V89 A;  4P78 A;  2MC5 A;  2EPN A;  4DV3 E;  2EMI A;  2DB2 A;  4LFA E;  2UUC E;  3HPZ A;  2EN1 A;  4R2R A;  2JR1 A;  2EM5 A;  4R2D A;  4R2E A;  4ZYE A;  2ENH A;  4LFC E;  3EPH A;  1X49 A;  3KZY A;  1ZU1 A;  4JV5 E;  2V86 A;  2UXB E;  1UIL A;  2L2N A;  1A1K A;  4BS9 A;  1HNX E;  3L00 A;  5IXM B;  5IWA E;  4BCA A;  2YRK A;  4R2C A;  5KL3 A;  4WX9 A;  4DV6 E;  3F6G A;  2PRT A;  2DMI A;  2V87 A;  2WBT A;  2RS6 A;  4DV0 E;  2LV2 A;  4JI5 E;  2MDG A;  4NZV A;  2VQF E;  4OX9 E;  2EMA A;  1A1F A;  4OOG C;  2EN7 A;  2EM3 A;  4LF5 E;  3JAM C;  3BF2 A;  4DV1 E;  3J7A G;  2YTJ A;  2YU8 A;  2VRD A;  4DR1 E;  2M1S A;  1X3C A;  2VE7 C;  1T38 A;  1PJT A;  2EPR A;  2EN6 A;  1KJK A;  4TUG A;  2EMG A;  3J80 C;  2LT7 A;  3OML A;  4X65 E;  2E72 A;  4RHB B;  5AE1 A;  2EE8 A;  5A6B A;  4WYQ B;  5F3W A;  4JYA E;  2JOX A;  4GKJ E;  2CSH A;  2L92 A;  1STU A;  2DLQ A;  1AAY A;  1EKZ A;  2EZ6 A;  1BBO A;  4DR7 E;  2RSI A;  3MHH C;  3EPL A;  4B3T E;  2UUA E;  5LLQ A;  3DJW A;  4ZYG A;  2E1M A;  2EMZ A;  1T4L B;  2F4V E;  3VHT B;  1ZR9 A;  2EL6 A;  3EPK A;  2K4V A;  2HHH E;  3BGH A;  2EN4 A;  2EN3 A;  4JI3 E;  1IBK E;  4BHB A;  2MC6 A;  3UK3 C;  4J8Z A;  2N3H A;  4LU9 A;  2NAB A;  3HXL A;  1O0W A;  3QG5 C;  2EOR A;  1BB8 A;  5CFF E;  1G2F C;  2EQ3 A;  4WXC A;  4M2Z A;  2EMH A;  4GZN C;  4F6N A;  4GKK E;  4DR3 E;  3HTX A;  1RMD A;  3RMP A;  2YT4 A;  1SFE A;  4O43 A;  2GLI A;  2GHF A;  2L6M A;  1B69 A;  2EL4 A;  1YZ9 A;  1A1L A;  2EM2 A;  1N34 E;  3J7Y p;  5KL5 A;  4DR6 E;  4DR2 E;  4F6M A;  3IWB A;  2EMC A;  1ZBQ A;  2RQL A;  2LJU A;  4DV5 E;  2EPM X;  2EOS A;  2I9I A;  4BMJ A;  2N8X A;  2EWL A;  4DUY E;  4BBY A;  2YSP A;  2R1F A;  3F6H A;  2EPO A;  2I13 A;  2EMX A;  1A1I A;  3J81 C;  1YFH A;  2JPA A;  2LUQ A;  4B3R E;  2KHX A;  2YSO A;  2EOO A;  4O4K A;  4ZYH A;  1DI2 A;  1RC7 A;  2EM8 A;  2LTR A;  3IWC A;  2VQE E;  3FIG A;  4MLQ A;  2MDR A;  3EPJ A;  4WXD A;  1JK1 A;  2L3J A;  2L2K B;  4B3S E;  4X64 E;  2DRP A;  2B3T B;  5ADZ A;  1PDA A;  2JY9 A;  2LVH A;  2EPP A;  3ZOQ B;  1IBL E;  3HPS A;  5A2Q C;  4X66 E;  2DLK A;  5A6J A;  4F9B B;  3ADG A;  3OTO E;  4R03 A;  4DKK A;  2KON A;  4R2P A;  4P7D A;  1YYK A;  2WBU A;  3T1Y E;  5KL2 A;  1A1G A;  2RS7 A;  2V83 A;  4Q28 A;  5IV8 B;  1EH7 A;  2YTD A;  4M9V C;  4LFB E;  2EMY A;  2JVA A;  2M7Q A;  2HJJ A;  2RPC A;  2EPU A;  5A6A A;  2WZO A;  3HQ1 A;  2NUF A;  2UXD E;  1T4O A;  2EM6 A;  1A1H A;  1A1J A;  2F8B A;  2DSY A;  1XNR E;  4L5N C;  4NXM E;  2JXP A;  1EH6 A;  1BBG A;  3C6M A;  4YY3 E;  2EJ4 A;  2LUP B;  2YTO A;  2KOU A;  2LBS B;  5LMN E;  5BR8 E;  2EOJ A;  2FV4 B;  3M99 B;  1MEY C;  3THN A;  2UXC E;  1PJQ A;  3EQ1 A;  3VYY A;  2EMK A;  2V88 A;  1MGT A;  3H09 A;  4KZS A;  1HNZ E;  1X6F A;  4MLV A;  2RSM A;  2EOE A;  4IJD A;  4R8O A;  2EP3 A;  1XMQ E;  2EOH A;  4DUZ E;  1IQO A;  2EN8 A;  1YPN A;  1L4S A;  5A6K A;  3AV0 A;  2LMZ A;  4BC7 A;  5AE2 A;  5LL6 R;  2EMW A;  1DGC A;  2GPI A;  2ENC A;  4LF4 E;  1GTK A;  1QU6 A;  1X48 A;  2CT1 A;  2LE2 A;  2LJH A;  4B3M E;  2JWO A;  2L33 A;  2VF1 A;  1LLM C;  4R2S A;  1N36 E;  3KZZ A;  2EOI A;  2L2M A;  4F2J C;  4KHP E;  4WSP A;  4DR5 E;  2ELY A;  2B9D A;  4DV7 E;  4N4R B;  3VK6 A;  3BBG A;  2UU9 E;  4LF9 E;  2M4I A;  2EPZ A;  2DMY A;  2EMF A;  4F54 A;  4TUI A;  3ADJ A;  2EMB A;  2DIX A;  2CTD A;  2YTP A;  1X47 A;  1PJS A;  2EML A;  5KL6 A;  1X5W A;  2YRM A;  2YTF A;  4R2Q A;  5KL7 A;  1QNT A;  4O5G A;  2HGH A;  2FGG A;  1IQS A;  2YZT A;  4M0V A;  2G7H A;  2MKN A;  2ENA A;  2BBG A;  1Z1B A;  3DF6 A;  2IHR 1;  5IT9 C;  2UUB E;  3TQM A;  3C4B A;  1XNQ E;  2YTN A;  5T6J A;  4KWY A;  2HC5 A;  4JI4 E;  1N32 E;  1WHQ A;  1XMO E;  1PKP A;  1ZBT A;  5FLX C;  1RQ0 A;  1IMU A;  4I8O A;  3LLH A;  2L8T A;  4JI2 E;  2EQ1 A;  2ELZ A;  2MKD A;  4BC9 A;  2E5L E;  3C4T A;  2LO3 A;  2NUE A;  4R2A A;  1JK2 A;  1TF6 A;  3T1H E;  5DNY A;  3JTZ A;  4LF8 E;  2EPA A;  2LTS A;  1P47 A;  2WBS A;  2K7I A;  2EOZ A;  2JP9 A;  1KYQ A;  1T39 A;  4Q35 B;  2ZM6 E;  2EOY A;  3LML A;  1AH5 A;  5TSE A;  4X8W A;  1TF3 A;  2EOM A;  4LTY A;  3BID A;  4F9A B;  4M30 A;  5AC5 A;  4RH8 A;  2RTX A; 
#chains in the Genus database with same CATH homology
 4M2Z A;  5AE3 A;  4GEQ B;  2V85 A;  4WFT A;  3AV0 A;  4DMI A;  2LMZ A;  3JU0 A;  4GKK E;  2V89 A;  4DR3 E;  3HTX A;  3RMP A;  2YT4 A;  4P78 A;  2FTX B;  2MC5 A;  4BC7 A;  5AE2 A;  1J5E E;  5LL6 R;  5AAS A;  4DV3 E;  1IBM E;  2DB2 A;  2L6M A;  4LFA E;  2UUC E;  3HPZ A;  4WPY A;  2JR1 A;  1YZ9 A;  1J26 A;  4LF9 E;  1N34 E;  3J7Y p;  4DR6 E;  4DR2 E;  2ODR D;  3IWB A;  4LF4 E;  1ZBQ A;  4LFC E;  1QU6 A;  1X48 A;  2LE2 A;  2LJH A;  4DV5 E;  1YYO A;  2VF1 A;  2JWO A;  2L33 A;  1X49 A;  2CPN A;  2N3G A;  1SR9 A;  4BMJ A;  4JI0 E;  2EWL A;  2NUG A;  3IWD A;  1N36 E;  4DUY E;  4BBY A;  2H36 X;  3F6H A;  4JV5 E;  2V86 A;  2B7T A;  2UXB E;  2L2M A;  4KHP E;  1UIL A;  2L2N A;  4BS9 A;  1HNX E;  4X62 E;  3J81 C;  4WSP A;  1FKA E;  2LUQ A;  4DR5 E;  5IWA E;  4B3R E;  4BCA A;  2B9D A;  2KHX A;  4DV7 E;  1DI2 A;  4DV6 E;  1T4N A;  3F6G A;  1RC7 A;  2LTR A;  3IWC A;  1GQE A;  3VK6 A;  2VQE E;  3FIG A;  1HNW E;  2MDR A;  2V87 A;  2M4I A;  2UU9 E;  2DMY A;  2RS6 A;  4F54 A;  4TUI A;  3ADJ A;  2L3J A;  2ODR C;  2L2K B;  4DV0 E;  4X64 E;  2DIX A;  4B3S E;  1UHZ A;  2B7V A;  4JI5 E;  4JI6 E;  4NXN E;  2B3T B;  5ADZ A;  5LMU E;  1X47 A;  4LF7 E;  2JY9 A;  2VQF E;  1FJG E;  4OX9 E;  1WXR A;  4OOG C;  3ZOQ B;  4LF5 E;  3JAM C;  4DV1 E;  1HR0 E;  4LF6 E;  3J7A G;  1YYW A;  1IBL E;  3HPS A;  1GZ6 A;  2JOB A;  4X66 E;  2FGG A;  2YZT A;  4M0V A;  5A2Q C;  2G7H A;  2LRS A;  4DR1 E;  2M1S A;  4F9B B;  3DF6 A;  2IHR 1;  3ADG A;  2VE7 C;  3OTO E;  4R03 A;  5IT9 C;  4DKK A;  2KON A;  2UUB E;  4P7D A;  3C4B A;  1WHN A;  1YYK A;  1XNQ E;  3T1Y E;  3KWR A;  2RS7 A;  2V83 A;  4TUG A;  4Q28 A;  5T6J A;  2NA2 A;  3J80 C;  3AUZ A;  4JI4 E;  1N32 E;  2V8Q B;  4DR4 E;  4LFB E;  1WHQ A;  2JVA A;  2M7Q A;  3OML A;  1XMO E;  4K0K E;  4X65 E;  4YHH E;  3MSW A;  1PKP A;  5AE1 A;  1ZBT A;  2WZO A;  1DQ3 A;  4WYQ B;  5FLX C;  3HQ1 A;  1RQ0 A;  4L8N A;  5F3W A;  2NUF A;  2JOX A;  4JYA E;  2L92 A;  4GKJ E;  1STU A;  4B3M E;  4I8O A;  4JI8 E;  3ADI A;  1EKZ A;  1T4O A;  3LLH A;  2EZ6 A;  2UXD E;  4F9C B;  2L8T A;  4JI2 E;  2F8B A;  2DSY A;  1XNR E;  4DR7 E;  4L5N C;  4BC9 A;  4NXM E;  3K6Q A;  4B3T E;  2E5L E;  2UUA E;  3VYX A;  3C4T A;  3DJW A;  2E1M A;  1T4L B;  3ADL A;  2F4V E;  4YY3 E;  3P1X A;  2HHH E;  2K4V A;  2LUP B;  2NUE A;  1I94 E;  2KOU A;  1N33 E;  4DV4 E;  2LBS B;  5LMN E;  5DNY A;  3JTZ A;  5BR8 E;  3T1H E;  2FV4 B;  4JI1 E;  4AQY E;  4JI3 E;  4JI7 E;  2LTS A;  1IBK E;  4LF8 E;  2UXC E;  3VYY A;  2V88 A;  3H09 A;  4KZS A;  4DV2 E;  1HNZ E;  2MC6 A;  2ZM6 E;  2L3C A;  2RSM A;  3LML A;  4J8Z A;  2N3H A;  4LU9 A;  4X8W A;  3HXL A;  1O0W A;  4R8O A;  1XMQ E;  4LTY A;  4DUZ E;  4F9A B;  5CFF E;  4M30 A;  2RTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...