3ZOQB

Structure of bsudg-p56 complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
48
structure length
48
Chain Sequence
b'DSYDVTMLLQDDDGKQYYEYHKGLSLSDFEVLYGNTADEIIKLRLDKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URACIL-DNA GLYCOSYLASE
publication title Crystal Structure and Functional Insights Into Uracil-DNA Glycosylase Inhibition by Phage Phi29 DNA Mimic Protein P56
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
molecule tags Hydrolase/viral protein
total genus 9
structure length 48
sequence length 48
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.520 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3zoqB00
3ZOQB 4L5NC 2LE2A
chains in the Genus database with same CATH superfamily
5AE2A 2L8TA 2YU5A 4X9JA 5IT9C 3EPKA 1A1LA 4NXNE 2YTIA 1N33E 3J81C 2DMYA 2LJHA 2EMAA 4M0VA 4JI6E 2DB2A 1ZR9A 1A1GA 4GZNC 2EZ6A 1BBOA 1I94E 2JOBA 2RSIA 1UBDC 3M99B 4WSPA 5A6BD 2EOSA 4RHBB 5KL5A 1XNRE 2ZM6E 2EOHA 2YT4A 2CPNA 2YPNA 4R2AA 2L2KB 2VQEE 2EMIA 2CTDA 1IBKE 2EMGA 4WXCA 2MC5A 1WHQA 2EN4A 2YTNA 5AE1A 4ZYDA 2EL6A 1HNXE 2BBGA 2NA2A 2YSOA 1XMQE 1IMUA 1LLMC 2YSPA 1NCSA 2MC6A 2EN7A 1ZU1A 2M1SA 1YFHA 4LFAE 4JI3E 1ZAAC 2EPCA 2JP9A 2YTJA 1RMDA 4WSGA 1AH5A 5AC5A 1X6HA 4X65E 3ADJA 4DUZE 4LF6E 2EM6A 4BCAA 5A6KA 3BF2A 4KWYA 2EMZA 2E72A 3THOB 1MGTA 4B3ME 2HC5A 3HQ1A 4JV5E 2ENHA 2JR1A 2L2NA 2EOEA 2EP3A 4LF5E 2UXCE 2M9AA 1YUIA 5IV8B 2YTGA 2DSYA 2V85A 4B3RE 1MEYC 3KZYA 2LMZA 4BMJA 1T39A 4JI2E 4F6MA 1O0WA 4WPYA 2EORA 4L8NA 4ZYHA 1EH7A 3EPJA 2NUFA 1FJGE 2YRHA 1N36E 2EMXA 2JPAA 4NHRA 1UN6B 5DNYA 5KL7A 2N8XA 5T6JA 1BB8A 3ZOQB 2J7JA 2V8QB 2EN1A 1PJQA 1GZ6A 1TF6A 3C6MA 3KWRA 2UXBE 2RS6A 2LV2A 1BBGA 3J7Yp 5KL6A 4O5GA 2LTSA 2CT1A 3VYXA 1TN9A 1YYKA 4F9BB 5KL4A 2I13A 1PDAA 2BB8A 1TF3A 2JOXA 4JI1E 2EMHA 2RSMA 4DKKA 3EPHA 4DV3E 1UILA 3K6QA 1QU6A 4WYQB 4R2PA 2DLKA 1STUA 2R1FA 3BBGA 4RH8A 1J26A 3KZZA 2JWOA 1WRJA 2ADRA 2EM8A 2EMCA 5IXMB 2LUQA 5LL6R 1HNWE 3EQ1A 5LMUE 2YTDA 4DR5E 2EPPA 4DMIA 4IS1C 1PJTA 2N3GA 4B3SE 4X64E 4O43A 2UU9E 1F2IG 1HR0E 1JK1A 4KZSA 5A69A 4GKJE 3IWDA 3OMLA 3DF6A 4F54A 2VF1A 4R2DA 3T1HE 1N34E 4R2RA 2EOMA 4DR7E 2PRTA 4I8OA 1N32E 1GQEA 1IBME 2N3HA 2LT7A 1T4LB 2EM5A 2B7TA 3HPSA 2YTQA 1G2FC 2EOXA 2EMBA 1X48A 2F4VE 5A6AA 2FV4B 2E1MA 2RQLA 2KOUA 2RTXA 2VE7C 3L00A 2MKNA 2EOFA 5FLXC 1KJKA 2RS7A 4OX9E 2UUAE 2EL4A 2WZOA 4BC7A 3MSWA 5AC4A 4DV6E 2B3TB 3P1XA 3T1YE 4DV2E 2EN8A 2HHHE 2EE8A 4JI4E 4LU9A 2ENAA 3JU0A 3VHTB 2R76A 2LTRA 2K4VA 4F2JC 2I9IA 1X5WA 2EL5A 2MKDA 2EMYA 2EPKX 3HTXA 2EOOA 1T4OA 4YHHE 3JAMC 2DGCA 2WBSA 3JTZA 3J80C 4YY3E 5KL2A 3H09A 1A1IA 2EOYA 2LO3A 2V87A 4LFBE 4DV5E 4R2SA 2MDGA 2IHR1 2L3JA 1WHNA 4BS9A 1GTKA 2HGHA 3ADGA 2EPNA 2L92A 3J7AG 4DR4E 2LJUA 2YU8A 1A1KA 4BC9A 2V83A 3VK6A 2YWQA 1JK2A 4OOGC 1A1JA 2EM2A 4L5NC 4M9VC 4GKKE 2LRSA 1SFEA 2DRPA 1WJPA 1YZ9A 3C6KA 2M4IA 3IWBA 2YTOA 4WFTA 4KHPE 2NUEA 2YTFA 4F9AB 4LFCE 2GPIA 4HEIA 3C4BA 2MDRA 1NEIA 2YRMA 3TQMA 3ADLA 4R2CA 3LMLA 2WBTA 2NUGA 4J8ZA 2EN2A 1EH6A 5A6JA 4O24A 2GLIA 1YYWA 2WCC3 1YPNA 2EQ0A 4R03A 2M7QA 3BIDA 2EN3A 2FGGA 1KYQA 2YRKA 4BHBA 4JYAE 2ENCA 2VQFE 2EOIA 1X47A 1Z1BA 5CFFE 2EPZA 2EM9A 1L4SA 2B9DA 2EPOA 4NXME 5AE3A 4B3TE 4NZVA 3IWCA 2Q8UA 1J5EE 1SR9A 1G2DC 3THNA 2JY9A 3F6GA 1AAYA 1DGCA 1DI2A 4R8OA 2EM7A 1T38A 2EMLA 1IQOA 1T4NA 3MHSC 4M2ZA 2LCEA 4JI5E 2YTEA 5A6BA 4R2QA 3VYYA 2V88A 2LVHA 1YUJA 3UK3C 4ZYGA 2UUCE 2H36X 4DV4E 5LLQA 2EOZA 3OTOE 2YTPA 4BBYA 2DIXA 3RMPA 2EPXA 4M30A 2CSHA 5KL3A 2EPLX 2EWLA 2L6MA 4MLQA 2EPUA 4TUIA 2JXPA 4DV0E 1P47A 3AUZA 1B69A 4P78A 4DUYE 2EPRA 2EOQA 2WBUA 1X6FA 2UUBE 1XMOE 1ZBQA 1A1HA 3DJWA 1HNZE 2B7VA 2EOJA 2V89A 2EM3A 2EMWA 4JI7E 4LF4E 2JYAA 3BGHA 2ODRC 2EPAA 4ZYEA 3LLHA 2L2MA 4X62E 2G7HA 4R2EA 2EM0A 2F8BA 4Q28A 2VRDA 3FIGA 2DMIA 1EKZA 1UHZA 4GEQB 4DR3E 1X3CA 4JI8E 5ADZA 1IBLE 2D9HA 2NABA 4X8WA 4FK5C 2A25A 4DV1E 1A1FA 4WX9A 5IWAE 4MLVA 4LF9E 2RPCA 4TUGA 2L33A 1YSAC 2DLQA 1XNQE 2EPMX 2EQ1A 5AASA 2KONA 1RQ0A 1DQ3A 1PKPA 2JVAA 3F6HA 4LF8E 3C4TA 3QG5C 4AQYE 2ELZA 4BHCA 4LF7E 5BR8E 4DR2E 1PJSA 2YZTA 2EQ3A 3MHHC 4F9CB 4O4KA 2EM4A 4WXDA 4DV7E 3HXLA 1EH8A 2LBSB 1N3GA 1WXRA 1FKAE 3HPZA 4X66E 2EMKA 2HJJA 4P7DA 3EPLA 2V86A 1QNTA 1ZBTA 2ODRD 2LE2A 2K7IA 3ECRA 4HTGA 2L3CA 2EJ4A 2LUPB 2ELYA 1YYOA 4DR6E 2FTXB 2UXDE 2KHXA 4IJDA 2GHFA 3ADIA 5LMNE 4Q35B 1X49A 2E5LE 5TSEA 3AV0A 4F6NA 4N4RB 5A2QC 4LTYA 4DR1E 5F3WA 1RC7A 2EMFA 1IQSA 4K0KE 2EN6A 1X6EA 4JI0E
chains in the Genus database with same CATH topology
5AE2A 2V87A 4M30A 3J7Yp 4LFBE 4DV5E 2L8TA 5IT9C 2IHR1 2L3JA 2EWLA 2L6MA 2LTSA 1WHNA 4NXNE 4TUIA 1N33E 4BS9A 3VYXA 3ADGA 3J81C 4F9BB 2DMYA 2LJHA 4DV0E 1YYKA 4M0VA 4JI6E 2L92A 2JOXA 3AUZA 2DB2A 2EZ6A 4JI1E 2RSMA 4DKKA 3J7AG 1I94E 4DV3E 2JOBA 4P78A 4DUYE 4DR4E 1UILA 4WSPA 3K6QA 1QU6A 4BC9A 4WYQB 2UUBE 2V83A 1XNRE 3VK6A 2ZM6E 1XMOE 1ZBQA 1STUA 2YT4A 3DJWA 2CPNA 1HNZE 1J26A 2L2KB 2B7VA 2V89A 2JWOA 2VQEE 4OOGC 4JI7E 4LF4E 1IBKE 2ODRC 2LUQA 4L5NC 3LLHA 5LL6R 4GKKE 1HNWE 2LRSA 2L2MA 1YZ9A 2MC5A 4X62E 1WHQA 5AE1A 5LMUE 4DR5E 2G7HA 2M4IA 3IWBA 2F8BA 4DMIA 2NA2A 4WFTA 1HNXE 2N3GA 1XMQE 4KHPE 4Q28A 2NUEA 3FIGA 4X64E 4B3SE 1EKZA 2UU9E 1UHZA 4GEQB 4F9AB 4DR3E 4LFCE 4JI8E 5ADZA 1HR0E 2MC6A 4KZSA 1IBLE 3C4BA 3IWDA 4GKJE 2MDRA 2M1SA 3OMLA 4X8WA 4LFAE 3DF6A 4JI3E 3ADLA 4F54A 2VF1A 4DV1E 3T1HE 1N34E 5IWAE 3LMLA 4LF9E 4DR7E 4X65E 4TUGA 2L33A 4J8ZA 2NUGA 3ADJA 4I8OA 1N32E 1XNQE 4DUZE 1GQEA 1IBME 4LF6E 2N3HA 5AASA 1T4LB 2KONA 2B7TA 1RQ0A 1DQ3A 1PKPA 1YYWA 4BCAA 2JVAA 3F6HA 4LF8E 3HPSA 4R03A 3C4TA 2M7QA 2FGGA 4B3ME 4AQYE 1X48A 2F4VE 4JYAE 2FV4B 2VQFE 4LF7E 2E1MA 3HQ1A 4JV5E 2KOUA 5BR8E 2RTXA 2VE7C 1X47A 5CFFE 2JR1A 5FLXC 2L2NA 2RS7A 4DR2E 2YZTA 4OX9E 2UUAE 4F9CB 4LF5E 2B9DA 2WZOA 4BC7A 4DV6E 3MSWA 2UXCE 4DV7E 3HXLA 2B3TB 5AE3A 3P1XA 3T1YE 2LBSB 4B3TE 4NXME 1WXRA 3IWCA 4DV2E 1FKAE 3HPZA 2DSYA 4X66E 2V85A 4B3RE 1J5EE 2HHHE 1SR9A 4JI4E 2LMZA 4LU9A 3JU0A 4BMJA 4JI2E 2JY9A 1O0WA 3F6GA 4P7DA 2V86A 4WPYA 4L8NA 1DI2A 1ZBTA 2ODRD 4R8OA 2NUFA 2LTRA 1FJGE 2LE2A 1T4NA 2L3CA 4M2ZA 2LUPB 1YYOA 1N36E 2FTXB 2K4VA 4DR6E 4JI5E 2UXDE 5DNYA 2KHXA 3VYYA 2V88A 5T6JA 3ADIA 3ZOQB 5LMNE 2V8QB 1X49A 2E5LE 2UUCE 2H36X 3HTXA 1T4OA 4DV4E 3AV0A 1GZ6A 4YHHE 3JAMC 4LTYA 5A2QC 4DR1E 3OTOE 3JTZA 5F3WA 3J80C 4YY3E 1RC7A 3H09A 3KWRA 4BBYA 2DIXA 2RS6A 4K0KE 3RMPA 2UXBE 4JI0E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZOQ B;  4L5N C;  2LE2 A; 
#chains in the Genus database with same CATH topology
 5AE2 A;  2L8T A;  2YU5 A;  4X9J A;  5IT9 C;  3EPK A;  1A1L A;  4NXN E;  2YTI A;  1N33 E;  3J81 C;  2DMY A;  2LJH A;  2EMA A;  4M0V A;  4JI6 E;  2DB2 A;  1ZR9 A;  1A1G A;  4GZN C;  2EZ6 A;  1BBO A;  1I94 E;  2JOB A;  2RSI A;  1UBD C;  3M99 B;  4WSP A;  5A6B D;  2EOS A;  4RHB B;  5KL5 A;  1XNR E;  2ZM6 E;  2EOH A;  2YT4 A;  2CPN A;  2YPN A;  4R2A A;  2L2K B;  2VQE E;  2EMI A;  2CTD A;  1IBK E;  2EMG A;  4WXC A;  2MC5 A;  1WHQ A;  2EN4 A;  2YTN A;  5AE1 A;  4ZYD A;  2EL6 A;  1HNX E;  2BBG A;  2NA2 A;  2YSO A;  1XMQ E;  1IMU A;  1LLM C;  2YSP A;  1NCS A;  2MC6 A;  2EN7 A;  1ZU1 A;  2M1S A;  1YFH A;  4LFA E;  4JI3 E;  1ZAA C;  2EPC A;  2JP9 A;  2YTJ A;  1RMD A;  4WSG A;  1AH5 A;  5AC5 A;  1X6H A;  4X65 E;  3ADJ A;  4DUZ E;  4LF6 E;  2EM6 A;  4BCA A;  5A6K A;  3BF2 A;  4KWY A;  2EMZ A;  2E72 A;  3THO B;  1MGT A;  4B3M E;  2HC5 A;  3HQ1 A;  4JV5 E;  2ENH A;  2JR1 A;  2L2N A;  2EOE A;  2EP3 A;  4LF5 E;  2UXC E;  2M9A A;  1YUI A;  5IV8 B;  2YTG A;  2DSY A;  2V85 A;  4B3R E;  1MEY C;  3KZY A;  2LMZ A;  4BMJ A;  1T39 A;  4JI2 E;  4F6M A;  1O0W A;  4WPY A;  2EOR A;  4L8N A;  4ZYH A;  1EH7 A;  3EPJ A;  2NUF A;  1FJG E;  2YRH A;  1N36 E;  2EMX A;  2JPA A;  4NHR A;  1UN6 B;  5DNY A;  5KL7 A;  2N8X A;  5T6J A;  1BB8 A;  3ZOQ B;  2J7J A;  2V8Q B;  2EN1 A;  1PJQ A;  1GZ6 A;  1TF6 A;  3C6M A;  3KWR A;  2UXB E;  2RS6 A;  2LV2 A;  1BBG A;  3J7Y p;  5KL6 A;  4O5G A;  2LTS A;  2CT1 A;  3VYX A;  1TN9 A;  1YYK A;  4F9B B;  5KL4 A;  2I13 A;  1PDA A;  2BB8 A;  1TF3 A;  2JOX A;  4JI1 E;  2EMH A;  2RSM A;  4DKK A;  3EPH A;  4DV3 E;  1UIL A;  3K6Q A;  1QU6 A;  4WYQ B;  4R2P A;  2DLK A;  1STU A;  2R1F A;  3BBG A;  4RH8 A;  1J26 A;  3KZZ A;  2JWO A;  1WRJ A;  2ADR A;  2EM8 A;  2EMC A;  5IXM B;  2LUQ A;  5LL6 R;  1HNW E;  3EQ1 A;  5LMU E;  2YTD A;  4DR5 E;  2EPP A;  4DMI A;  4IS1 C;  1PJT A;  2N3G A;  4B3S E;  4X64 E;  4O43 A;  2UU9 E;  1F2I G;  1HR0 E;  1JK1 A;  4KZS A;  5A69 A;  4GKJ E;  3IWD A;  3OML A;  3DF6 A;  4F54 A;  2VF1 A;  4R2D A;  3T1H E;  1N34 E;  4R2R A;  2EOM A;  4DR7 E;  2PRT A;  4I8O A;  1N32 E;  1GQE A;  1IBM E;  2N3H A;  2LT7 A;  1T4L B;  2EM5 A;  2B7T A;  3HPS A;  2YTQ A;  1G2F C;  2EOX A;  2EMB A;  1X48 A;  2F4V E;  5A6A A;  2FV4 B;  2E1M A;  2RQL A;  2KOU A;  2RTX A;  2VE7 C;  3L00 A;  2MKN A;  2EOF A;  5FLX C;  1KJK A;  2RS7 A;  4OX9 E;  2UUA E;  2EL4 A;  2WZO A;  4BC7 A;  3MSW A;  5AC4 A;  4DV6 E;  2B3T B;  3P1X A;  3T1Y E;  4DV2 E;  2EN8 A;  2HHH E;  2EE8 A;  4JI4 E;  4LU9 A;  2ENA A;  3JU0 A;  3VHT B;  2R76 A;  2LTR A;  2K4V A;  4F2J C;  2I9I A;  1X5W A;  2EL5 A;  2MKD A;  2EMY A;  2EPK X;  3HTX A;  2EOO A;  1T4O A;  4YHH E;  3JAM C;  2DGC A;  2WBS A;  3JTZ A;  3J80 C;  4YY3 E;  5KL2 A;  3H09 A;  1A1I A;  2EOY A;  2LO3 A;  2V87 A;  4LFB E;  4DV5 E;  4R2S A;  2MDG A;  2IHR 1;  2L3J A;  1WHN A;  4BS9 A;  1GTK A;  2HGH A;  3ADG A;  2EPN A;  2L92 A;  3J7A G;  4DR4 E;  2LJU A;  2YU8 A;  1A1K A;  4BC9 A;  2V83 A;  3VK6 A;  2YWQ A;  1JK2 A;  4OOG C;  1A1J A;  2EM2 A;  4L5N C;  4M9V C;  4GKK E;  2LRS A;  1SFE A;  2DRP A;  1WJP A;  1YZ9 A;  3C6K A;  2M4I A;  3IWB A;  2YTO A;  4WFT A;  4KHP E;  2NUE A;  2YTF A;  4F9A B;  4LFC E;  2GPI A;  4HEI A;  3C4B A;  2MDR A;  1NEI A;  2YRM A;  3TQM A;  3ADL A;  4R2C A;  3LML A;  2WBT A;  2NUG A;  4J8Z A;  2EN2 A;  1EH6 A;  5A6J A;  4O24 A;  2GLI A;  1YYW A;  2WCC 3;  1YPN A;  2EQ0 A;  4R03 A;  2M7Q A;  3BID A;  2EN3 A;  2FGG A;  1KYQ A;  2YRK A;  4BHB A;  4JYA E;  2ENC A;  2VQF E;  2EOI A;  1X47 A;  1Z1B A;  5CFF E;  2EPZ A;  2EM9 A;  1L4S A;  2B9D A;  2EPO A;  4NXM E;  5AE3 A;  4B3T E;  4NZV A;  3IWC A;  2Q8U A;  1J5E E;  1SR9 A;  1G2D C;  3THN A;  2JY9 A;  3F6G A;  1AAY A;  1DGC A;  1DI2 A;  4R8O A;  2EM7 A;  1T38 A;  2EML A;  1IQO A;  1T4N A;  3MHS C;  4M2Z A;  2LCE A;  4JI5 E;  2YTE A;  5A6B A;  4R2Q A;  3VYY A;  2V88 A;  2LVH A;  1YUJ A;  3UK3 C;  4ZYG A;  2UUC E;  2H36 X;  4DV4 E;  5LLQ A;  2EOZ A;  3OTO E;  2YTP A;  4BBY A;  2DIX A;  3RMP A;  2EPX A;  4M30 A;  2CSH A;  5KL3 A;  2EPL X;  2EWL A;  2L6M A;  4MLQ A;  2EPU A;  4TUI A;  2JXP A;  4DV0 E;  1P47 A;  3AUZ A;  1B69 A;  4P78 A;  4DUY E;  2EPR A;  2EOQ A;  2WBU A;  1X6F A;  2UUB E;  1XMO E;  1ZBQ A;  1A1H A;  3DJW A;  1HNZ E;  2B7V A;  2EOJ A;  2V89 A;  2EM3 A;  2EMW A;  4JI7 E;  4LF4 E;  2JYA A;  3BGH A;  2ODR C;  2EPA A;  4ZYE A;  3LLH A;  2L2M A;  4X62 E;  2G7H A;  4R2E A;  2EM0 A;  2F8B A;  4Q28 A;  2VRD A;  3FIG A;  2DMI A;  1EKZ A;  1UHZ A;  4GEQ B;  4DR3 E;  1X3C A;  4JI8 E;  5ADZ A;  1IBL E;  2D9H A;  2NAB A;  4X8W A;  4FK5 C;  2A25 A;  4DV1 E;  1A1F A;  4WX9 A;  5IWA E;  4MLV A;  4LF9 E;  2RPC A;  4TUG A;  2L33 A;  1YSA C;  2DLQ A;  1XNQ E;  2EPM X;  2EQ1 A;  5AAS A;  2KON A;  1RQ0 A;  1DQ3 A;  1PKP A;  2JVA A;  3F6H A;  4LF8 E;  3C4T A;  3QG5 C;  4AQY E;  2ELZ A;  4BHC A;  4LF7 E;  5BR8 E;  4DR2 E;  1PJS A;  2YZT A;  2EQ3 A;  3MHH C;  4F9C B;  4O4K A;  2EM4 A;  4WXD A;  4DV7 E;  3HXL A;  1EH8 A;  2LBS B;  1N3G A;  1WXR A;  1FKA E;  3HPZ A;  4X66 E;  2EMK A;  2HJJ A;  4P7D A;  3EPL A;  2V86 A;  1QNT A;  1ZBT A;  2ODR D;  2LE2 A;  2K7I A;  3ECR A;  4HTG A;  2L3C A;  2EJ4 A;  2LUP B;  2ELY A;  1YYO A;  4DR6 E;  2FTX B;  2UXD E;  2KHX A;  4IJD A;  2GHF A;  3ADI A;  5LMN E;  4Q35 B;  1X49 A;  2E5L E;  5TSE A;  3AV0 A;  4F6N A;  4N4R B;  5A2Q C;  4LTY A;  4DR1 E;  5F3W A;  1RC7 A;  2EMF A;  1IQS A;  4K0K E;  2EN6 A;  1X6E A;  4JI0 E; 
#chains in the Genus database with same CATH homology
 5AE2 A;  2V87 A;  4M30 A;  3J7Y p;  4LFB E;  4DV5 E;  2L8T A;  5IT9 C;  2IHR 1;  2L3J A;  2EWL A;  2L6M A;  2LTS A;  1WHN A;  4NXN E;  4TUI A;  1N33 E;  4BS9 A;  3VYX A;  3ADG A;  3J81 C;  4F9B B;  2DMY A;  2LJH A;  4DV0 E;  1YYK A;  4M0V A;  4JI6 E;  2L92 A;  2JOX A;  3AUZ A;  2DB2 A;  2EZ6 A;  4JI1 E;  2RSM A;  4DKK A;  3J7A G;  1I94 E;  4DV3 E;  2JOB A;  4P78 A;  4DUY E;  4DR4 E;  1UIL A;  4WSP A;  3K6Q A;  1QU6 A;  4BC9 A;  4WYQ B;  2UUB E;  2V83 A;  1XNR E;  3VK6 A;  2ZM6 E;  1XMO E;  1ZBQ A;  1STU A;  2YT4 A;  3DJW A;  2CPN A;  1HNZ E;  1J26 A;  2L2K B;  2B7V A;  2V89 A;  2JWO A;  2VQE E;  4OOG C;  4JI7 E;  4LF4 E;  1IBK E;  2ODR C;  2LUQ A;  4L5N C;  3LLH A;  5LL6 R;  4GKK E;  1HNW E;  2LRS A;  2L2M A;  1YZ9 A;  2MC5 A;  4X62 E;  1WHQ A;  5AE1 A;  5LMU E;  4DR5 E;  2G7H A;  2M4I A;  3IWB A;  2F8B A;  4DMI A;  2NA2 A;  4WFT A;  1HNX E;  2N3G A;  1XMQ E;  4KHP E;  4Q28 A;  2NUE A;  3FIG A;  4X64 E;  4B3S E;  1EKZ A;  2UU9 E;  1UHZ A;  4GEQ B;  4F9A B;  4DR3 E;  4LFC E;  4JI8 E;  5ADZ A;  1HR0 E;  2MC6 A;  4KZS A;  1IBL E;  3C4B A;  3IWD A;  4GKJ E;  2MDR A;  2M1S A;  3OML A;  4X8W A;  4LFA E;  3DF6 A;  4JI3 E;  3ADL A;  4F54 A;  2VF1 A;  4DV1 E;  3T1H E;  1N34 E;  5IWA E;  3LML A;  4LF9 E;  4DR7 E;  4X65 E;  4TUG A;  2L33 A;  4J8Z A;  2NUG A;  3ADJ A;  4I8O A;  1N32 E;  1XNQ E;  4DUZ E;  1GQE A;  1IBM E;  4LF6 E;  2N3H A;  5AAS A;  1T4L B;  2KON A;  2B7T A;  1RQ0 A;  1DQ3 A;  1PKP A;  1YYW A;  4BCA A;  2JVA A;  3F6H A;  4LF8 E;  3HPS A;  4R03 A;  3C4T A;  2M7Q A;  2FGG A;  4B3M E;  4AQY E;  1X48 A;  2F4V E;  4JYA E;  2FV4 B;  2VQF E;  4LF7 E;  2E1M A;  3HQ1 A;  4JV5 E;  2KOU A;  5BR8 E;  2RTX A;  2VE7 C;  1X47 A;  5CFF E;  2JR1 A;  5FLX C;  2L2N A;  2RS7 A;  4DR2 E;  2YZT A;  4OX9 E;  2UUA E;  4F9C B;  4LF5 E;  2B9D A;  2WZO A;  4BC7 A;  4DV6 E;  3MSW A;  2UXC E;  4DV7 E;  3HXL A;  2B3T B;  5AE3 A;  3P1X A;  3T1Y E;  2LBS B;  4B3T E;  4NXM E;  1WXR A;  3IWC A;  4DV2 E;  1FKA E;  3HPZ A;  2DSY A;  4X66 E;  2V85 A;  4B3R E;  1J5E E;  2HHH E;  1SR9 A;  4JI4 E;  2LMZ A;  4LU9 A;  3JU0 A;  4BMJ A;  4JI2 E;  2JY9 A;  1O0W A;  3F6G A;  4P7D A;  2V86 A;  4WPY A;  4L8N A;  1DI2 A;  1ZBT A;  2ODR D;  4R8O A;  2NUF A;  2LTR A;  1FJG E;  2LE2 A;  1T4N A;  2L3C A;  4M2Z A;  2LUP B;  1YYO A;  1N36 E;  2FTX B;  2K4V A;  4DR6 E;  4JI5 E;  2UXD E;  5DNY A;  2KHX A;  3VYY A;  2V88 A;  5T6J A;  3ADI A;  3ZOQ B;  5LMN E;  2V8Q B;  1X49 A;  2E5L E;  2UUC E;  2H36 X;  3HTX A;  1T4O A;  4DV4 E;  3AV0 A;  1GZ6 A;  4YHH E;  3JAM C;  4LTY A;  5A2Q C;  4DR1 E;  3OTO E;  3JTZ A;  5F3W A;  3J80 C;  4YY3 E;  1RC7 A;  3H09 A;  3KWR A;  4BBY A;  2DIX A;  2RS6 A;  4K0K E;  3RMP A;  2UXB E;  4JI0 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...