3ZOQB

Structure of bsudg-p56 complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
48
structure length
48
Chain Sequence
DSYDVTMLLQDDDGKQYYEYHKGLSLSDFEVLYGNTADEIIKLRLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URACIL-DNA GLYCOSYLASE
publication title Crystal Structure and Functional Insights Into Uracil-DNA Glycosylase Inhibition by Phage Phi29 DNA Mimic Protein P56
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
molecule tags Hydrolase/viral protein
total genus 9
structure length 48
sequence length 48
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.520 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3zoqB00
4L5NC 2LE2A 3ZOQB
chains in the Genus database with same CATH superfamily
2UU9E 1XMOE 2GHFA 4R2QA 1DGCA 1PKPA 1EH7A 4NXNE 3T1HE 1B69A 4R2PA 2JYAA 4DKKA 4YHHE 4BS9A 1IBLE 2YTQA 4JI4E 2YTDA 2E1MA 2PRTA 4R2SA 2EM9A 4BC7A 2EPLX 3P1XA 2EMZA 1AAYA 2LO3A 4DR3E 2EM7A 2EORA 1JK1A 2V87A 3BIDA 3HXLA 2RS7A 3EPJA 2LT7A 4M0VA 2I9IA 1SR9A 4DV6E 2EMFA 2YU8A 2WBTA 2DLKA 2EMAA 2EOOA 2G7HA 4DV5E 1ZAAC 2DMIA 2RSIA 2UUCE 1T4LB 2EM4A 1XMQE 3DJWA 2V86A 1DQ3A 2EOJA 3T1YE 1N32E 1ZR9A 2EPKX 5LMUE 5DNYA 2YWQA 2V83A 1PJQA 4L8NA 3L00A 5IT9C 1GQEA 1UILA 2JR1A 3JAMC 2B3TB 4KZSA 2YTGA 1YSAC 1I94E 2M9AA 1BBOA 3FIGA 3ECRA 2KOUA 2EN2A 4X8WA 3C6MA 4N4RB 3HPSA 3LLHA 4RHBB 2EPOA 2YTJA 2EPAA 2FV4B 2MDRA 5AE1A 3UK3C 1GZ6A 1ZBQA 2EOIA 4ZYHA 2M4IA 4JI1E 3EPKA 3ADIA 2WZOA 2EN7A 4KWYA 3RMPA 4LF8E 2F4VE 2EQ0A 4BBYA 2YRKA 3VK6A 1X49A 4AQYE 2LTRA 2K4VA 4DUZE 1T4NA 3THOB 2LUPB 1HNZE 2DLQA 2MKNA 1N36E 2YU5A 4MLQA 4X62E 1QNTA 3MHHC 4B3RE 1FJGE 2JWOA 4GKJE 2DIXA 4JI8E 2E72A 2EMIA 4B3SE 2LBSB 4ZYDA 3F6HA 4WSPA 3HPZA 5KL7A 5KL2A 3JTZA 2VF1A 1UHZA 2LJUA 3J80C 3BBGA 3BGHA 2WBUA 4GZNC 4BC9A 2YTOA 2EWLA 4X64E 3K6QA 1ZU1A 2CSHA 3TQMA 2CT1A 4WSGA 4F9AB 4R2EA 4LFAE 1QU6A 2EE8A 2JOXA 3ZOQB 3IWBA 2LRSA 1WRJA 3MSWA 4F54A 1KYQA 1HNWE 3LMLA 2BBGA 3BF2A 2BB8A 2YTNA 4B3TE 4DMIA 4DR5E 1O0WA 2N3HA 2RTXA 2ZM6E 1A1IA 4ZYGA 2ODRD 2EL6A 3KZZA 4IS1C 2YT4A 2EPCA 4JI7E 4Q28A 2EPUA 1IMUA 3THNA 2VE7C 2RPCA 4FK5C 1X5WA 4X66E 5KL4A 3J81C 2B7VA 2LCEA 2YRMA 4DR1E 2EMLA 4DV7E 2ENCA 1X6FA 2EMKA 2EN1A 4R8OA 4RH8A 2EN3A 1A1HA 2N3GA 1NCSA 1HNXE 4TUGA 2JY9A 2EL5A 4JV5E 2LTSA 2EMGA 1X48A 2J7JA 1WJPA 2YTPA 4DR7E 4DR6E 3AV0A 2LV2A 5A6JA 3HTXA 2KONA 5F3WA 3EPLA 1WHQA 4BHCA 2L2MA 4R2AA 2L6MA 1FKAE 5IXMB 1RC7A 1L4SA 5KL5A 2EOEA 2YTIA 3VYXA 4JI2E 1A1FA 5A69A 3MHSC 2EMBA 4X9JA 1F2IG 2EOXA 3DF6A 1KJKA 4LF5E 4F9BB 1A1GA 5A6BA 2CTDA 2L2KB 4BHBA 1X3CA 5CFFE 4R2RA 1PJSA 1YUIA 5A6AA 1A1KA 5AE3A 2EL4A 3M99B 2DRPA 1DI2A 2D9HA 4P7DA 4DR2E 5FLXC 4LF6E 2EPRA 1IQOA 1WHNA 1SFEA 2EP3A 4F9CB 2JPAA 5KL3A 3HQ1A 2UUAE 5IWAE 2UXDE 2EN8A 1BB8A 4JI5E 1EKZA 4WYQB 5AC5A 1UBDC 5AC4A 4DV3E 4DV4E 4OX9E 1A1JA 1JK2A 4Q35B 4M30A 2NUGA 2VRDA 2RSMA 2EOQA 3VYYA 2EMYA 2UUBE 1MEYC 4HTGA 2EM0A 2HHHE 4JI3E 4LF7E 2UXBE 3F6GA 4DV1E 1X47A 4F6NA 4BMJA 4M2ZA 1STUA 2V85A 2GLIA 1IQSA 2YRHA 2B9DA 2L8TA 4NHRA 2JVAA 2N8XA 1NEIA 3OMLA 2YSOA 2R1FA 4F6MA 5T6JA 1Z1BA 2JXPA 4O24A 3IWCA 1YPNA 2GPIA 3EQ1A 1N33E 5BR8E 5A6BD 1T4OA 3C6KA 2HGHA 3IWDA 1IBME 4KHPE 1J26A 1LLMC 2ELZA 1EH8A 2EMHA 5TSEA 4O5GA 1RQ0A 2V89A 2RS6A 4I8OA 2E5LE 1T38A 1HR0E 4YY3E 1PJTA 4GKKE 2EQ3A 2F8BA 2JOBA 4WXDA 3JU0A 2EN4A 5ADZA 3KZYA 2EOMA 2YTFA 3KWRA 2DGCA 1YYOA 2KHXA 2JP9A 2MC6A 2EM3A 2HJJA 2R76A 2MC5A 1N3GA 5LL6R 2MDGA 4NZVA 3C4TA 1UN6B 4R2DA 2L33A 2YPNA 2LE2A 1YZ9A 2L3JA 5AASA 2MKDA 2EQ1A 2EPNA 1YFHA 3VHTB 1MGTA 4ZYEA 4X65E 2YTEA 4DUYE 1YYKA 2FGGA 5A2QC 2EM5A 5A6KA 4LFBE 3H09A 3QG5C 2K7IA 4J8ZA 2YZTA 1AH5A 5LLQA 1G2DC 1PDAA 5KL6A 1TF6A 4IJDA 1EH6A 2EMXA 2HC5A 4JI0E 2EMWA 4M9VC 4DV0E 2ELYA 2VQEE 2EOHA 4WPYA 1ZBTA 5IV8B 4TUIA 2DSYA 2LJHA 3ADLA 2M1SA 2WCC3 1X6HA 4LTYA 3ADGA 4WX9A 2RQLA 4F2JC 4GEQB 4BCAA 4MLVA 2Q8UA 2UXCE 4JYAE 4WFTA 2EM2A 2L3CA 1XNQE 2I13A 2LMZA 2EN6A 2LVHA 4K0KE 2V8QB 4P78A 2B7TA 2DB2A 2EM6A 2YSPA 2ODRC 4R2CA 4LFCE 3OTOE 2VQFE 2DMYA 2EM8A 2NA2A 4O43A 2ENAA 2ENHA 2EPPA 3AUZA 4LU9A 1T39A 2FTXB 1P47A 5LMNE 1A1LA 3J7Yp 1X6EA 2EOZA 4R03A 2L2NA 4NXME 3ADJA 4JI6E 2EPXA 4LF4E 3EPHA 1YUJA 1N34E 2V88A 2L92A 2LUQA 1TF3A 2NUFA 2NABA 2EPMX 4B3ME 2EMCA 1WXRA 4LF9E 2A25A 1YYWA 2EPZA 3J7AG 4WXCA 1IBKE 3C4BA 1XNRE 2M7QA 2EOYA 4L5NC 2NUEA 2H36X 4OOGC 2EOFA 5AE2A 4O4KA 1GTKA 1G2FC 2ADRA 1BBGA 2CPNA 1TN9A 4DV2E 4DR4E 1RMDA 4HEIA 2WBSA 2EOSA 2IHR1 1J5EE 2EJ4A 2EZ6A
chains in the Genus database with same CATH topology
4P7DA 3JTZA 4DR2E 2VF1A 5FLXC 2UU9E 1UHZA 1XMOE 4LF6E 3J80C 1PKPA 4NXNE 4X65E 3T1HE 4DUYE 1WHNA 4DKKA 4YHHE 1YYKA 4BS9A 2FGGA 4F9CB 5A2QC 1J5EE 4BC9A 1IBLE 3HQ1A 4LFBE 2UUAE 4JI4E 2EWLA 4X64E 3H09A 5IWAE 2E1MA 3K6QA 4J8ZA 4BC7A 2YZTA 2UXDE 3P1XA 4JI5E 1EKZA 4WYQB 4F9AB 4DR3E 4LFAE 4DV3E 1QU6A 2V87A 4DV4E 4JI0E 4DV0E 2JOXA 4OX9E 3ZOQB 3IWBA 2LRSA 4WSPA 1ZBTA 4WPYA 2VQEE 3HXLA 2RS7A 3MSWA 4F54A 4TUIA 2DSYA 4M30A 2LJHA 1HNWE 2NUGA 3ADLA 3LMLA 2M1SA 2RSMA 4LTYA 3VYYA 4B3TE 2UUBE 3ADGA 4DMIA 4M0VA 4DR5E 1O0WA 1SR9A 2N3HA 2RTXA 2ZM6E 4DV6E 2HHHE 4JI3E 2ODRD 4LF7E 2UXBE 4GEQB 4BCAA 2G7HA 3F6GA 2YT4A 1X47A 4DV1E 4DV5E 2UXCE 4JYAE 4BMJA 4JI7E 1STUA 2V85A 4M2ZA 4WFTA 2UUCE 1T4LB 2B9DA 4Q28A 2L8TA 1XMQE 2L3CA 1XNQE 2JVAA 3OMLA 2LMZA 4K0KE 2VE7C 2V8QB 4P78A 2B7TA 2DB2A 1DQ3A 2V86A 3DJWA 3T1YE 2ODRC 5T6JA 4X66E 1N32E 3IWCA 5LMUE 5DNYA 3J81C 2B7VA 4DR1E 1N33E 5BR8E 4LFCE 4DV7E 1T4OA 2V83A 4L8NA 3OTOE 2VQFE 2DMYA 5IT9C 1GQEA 1UILA 2JR1A 2NA2A 4R8OA 2B3TB 4KZSA 3JAMC 3IWDA 1I94E 2N3GA 3AUZA 4LU9A 1IBME 4KHPE 1J26A 1HNXE 3FIGA 4TUGA 2FTXB 2KOUA 2JY9A 1RQ0A 2V89A 5LMNE 2RS6A 4JV5E 2LTSA 4I8OA 1X48A 3J7Yp 4X8WA 2E5LE 3HPSA 1HR0E 4DR7E 3LLHA 4R03A 2L2NA 4YY3E 3AV0A 4NXME 2FV4B 3ADJA 4DR6E 4JI6E 3HTXA 2MDRA 2KONA 5AE1A 5F3WA 4LF4E 4GKKE 1GZ6A 1ZBQA 2F8BA 1N34E 2M4IA 1WHQA 2V88A 2JOBA 2L92A 2LUQA 2NUFA 2L2MA 1FKAE 2L6MA 3JU0A 4JI1E 3ADIA 1RC7A 2WZOA 5ADZA 3KWRA 3RMPA 4B3ME 1WXRA 4LF8E 2F4VE 3VYXA 4JI2E 4BBYA 4LF9E 1YYOA 2KHXA 1YYWA 2MC6A 3VK6A 1X49A 4AQYE 3J7AG 2LTRA 1IBKE 2K4VA 3DF6A 2MC5A 3C4BA 4LF5E 4F9BB 2M7QA 1T4NA 4DUZE 2LUPB 4L5NC 5LL6R 1HNZE 1XNRE 2NUEA 2H36X 3C4TA 4OOGC 1N36E 5AE2A 2L33A 4X62E 2L2KB 5CFFE 4B3RE 1FJGE 2CPNA 2JWOA 5AE3A 2LE2A 1YZ9A 4GKJE 2DIXA 4DV2E 4DR4E 2L3JA 4JI8E 5AASA 4B3SE 1DI2A 2LBSB 3F6HA 2IHR1 3HPZA 2EZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L5N C;  2LE2 A;  3ZOQ B; 
#chains in the Genus database with same CATH topology
 2UU9 E;  1XMO E;  2GHF A;  4R2Q A;  1DGC A;  1PKP A;  1EH7 A;  4NXN E;  3T1H E;  1B69 A;  4R2P A;  2JYA A;  4DKK A;  4YHH E;  4BS9 A;  1IBL E;  2YTQ A;  4JI4 E;  2YTD A;  2E1M A;  2PRT A;  4R2S A;  2EM9 A;  4BC7 A;  2EPL X;  3P1X A;  2EMZ A;  1AAY A;  2LO3 A;  4DR3 E;  2EM7 A;  2EOR A;  1JK1 A;  2V87 A;  3BID A;  3HXL A;  2RS7 A;  3EPJ A;  2LT7 A;  4M0V A;  2I9I A;  1SR9 A;  4DV6 E;  2EMF A;  2YU8 A;  2WBT A;  2DLK A;  2EMA A;  2EOO A;  2G7H A;  4DV5 E;  1ZAA C;  2DMI A;  2RSI A;  2UUC E;  1T4L B;  2EM4 A;  1XMQ E;  3DJW A;  2V86 A;  1DQ3 A;  2EOJ A;  3T1Y E;  1N32 E;  1ZR9 A;  2EPK X;  5LMU E;  5DNY A;  2YWQ A;  2V83 A;  1PJQ A;  4L8N A;  3L00 A;  5IT9 C;  1GQE A;  1UIL A;  2JR1 A;  3JAM C;  2B3T B;  4KZS A;  2YTG A;  1YSA C;  1I94 E;  2M9A A;  1BBO A;  3FIG A;  3ECR A;  2KOU A;  2EN2 A;  4X8W A;  3C6M A;  4N4R B;  3HPS A;  3LLH A;  4RHB B;  2EPO A;  2YTJ A;  2EPA A;  2FV4 B;  2MDR A;  5AE1 A;  3UK3 C;  1GZ6 A;  1ZBQ A;  2EOI A;  4ZYH A;  2M4I A;  4JI1 E;  3EPK A;  3ADI A;  2WZO A;  2EN7 A;  4KWY A;  3RMP A;  4LF8 E;  2F4V E;  2EQ0 A;  4BBY A;  2YRK A;  3VK6 A;  1X49 A;  4AQY E;  2LTR A;  2K4V A;  4DUZ E;  1T4N A;  3THO B;  2LUP B;  1HNZ E;  2DLQ A;  2MKN A;  1N36 E;  2YU5 A;  4MLQ A;  4X62 E;  1QNT A;  3MHH C;  4B3R E;  1FJG E;  2JWO A;  4GKJ E;  2DIX A;  4JI8 E;  2E72 A;  2EMI A;  4B3S E;  2LBS B;  4ZYD A;  3F6H A;  4WSP A;  3HPZ A;  5KL7 A;  5KL2 A;  3JTZ A;  2VF1 A;  1UHZ A;  2LJU A;  3J80 C;  3BBG A;  3BGH A;  2WBU A;  4GZN C;  4BC9 A;  2YTO A;  2EWL A;  4X64 E;  3K6Q A;  1ZU1 A;  2CSH A;  3TQM A;  2CT1 A;  4WSG A;  4F9A B;  4R2E A;  4LFA E;  1QU6 A;  2EE8 A;  2JOX A;  3ZOQ B;  3IWB A;  2LRS A;  1WRJ A;  3MSW A;  4F54 A;  1KYQ A;  1HNW E;  3LML A;  2BBG A;  3BF2 A;  2BB8 A;  2YTN A;  4B3T E;  4DMI A;  4DR5 E;  1O0W A;  2N3H A;  2RTX A;  2ZM6 E;  1A1I A;  4ZYG A;  2ODR D;  2EL6 A;  3KZZ A;  4IS1 C;  2YT4 A;  2EPC A;  4JI7 E;  4Q28 A;  2EPU A;  1IMU A;  3THN A;  2VE7 C;  2RPC A;  4FK5 C;  1X5W A;  4X66 E;  5KL4 A;  3J81 C;  2B7V A;  2LCE A;  2YRM A;  4DR1 E;  2EML A;  4DV7 E;  2ENC A;  1X6F A;  2EMK A;  2EN1 A;  4R8O A;  4RH8 A;  2EN3 A;  1A1H A;  2N3G A;  1NCS A;  1HNX E;  4TUG A;  2JY9 A;  2EL5 A;  4JV5 E;  2LTS A;  2EMG A;  1X48 A;  2J7J A;  1WJP A;  2YTP A;  4DR7 E;  4DR6 E;  3AV0 A;  2LV2 A;  5A6J A;  3HTX A;  2KON A;  5F3W A;  3EPL A;  1WHQ A;  4BHC A;  2L2M A;  4R2A A;  2L6M A;  1FKA E;  5IXM B;  1RC7 A;  1L4S A;  5KL5 A;  2EOE A;  2YTI A;  3VYX A;  4JI2 E;  1A1F A;  5A69 A;  3MHS C;  2EMB A;  4X9J A;  1F2I G;  2EOX A;  3DF6 A;  1KJK A;  4LF5 E;  4F9B B;  1A1G A;  5A6B A;  2CTD A;  2L2K B;  4BHB A;  1X3C A;  5CFF E;  4R2R A;  1PJS A;  1YUI A;  5A6A A;  1A1K A;  5AE3 A;  2EL4 A;  3M99 B;  2DRP A;  1DI2 A;  2D9H A;  4P7D A;  4DR2 E;  5FLX C;  4LF6 E;  2EPR A;  1IQO A;  1WHN A;  1SFE A;  2EP3 A;  4F9C B;  2JPA A;  5KL3 A;  3HQ1 A;  2UUA E;  5IWA E;  2UXD E;  2EN8 A;  1BB8 A;  4JI5 E;  1EKZ A;  4WYQ B;  5AC5 A;  1UBD C;  5AC4 A;  4DV3 E;  4DV4 E;  4OX9 E;  1A1J A;  1JK2 A;  4Q35 B;  4M30 A;  2NUG A;  2VRD A;  2RSM A;  2EOQ A;  3VYY A;  2EMY A;  2UUB E;  1MEY C;  4HTG A;  2EM0 A;  2HHH E;  4JI3 E;  4LF7 E;  2UXB E;  3F6G A;  4DV1 E;  1X47 A;  4F6N A;  4BMJ A;  4M2Z A;  1STU A;  2V85 A;  2GLI A;  1IQS A;  2YRH A;  2B9D A;  2L8T A;  4NHR A;  2JVA A;  2N8X A;  1NEI A;  3OML A;  2YSO A;  2R1F A;  4F6M A;  5T6J A;  1Z1B A;  2JXP A;  4O24 A;  3IWC A;  1YPN A;  2GPI A;  3EQ1 A;  1N33 E;  5BR8 E;  5A6B D;  1T4O A;  3C6K A;  2HGH A;  3IWD A;  1IBM E;  4KHP E;  1J26 A;  1LLM C;  2ELZ A;  1EH8 A;  2EMH A;  5TSE A;  4O5G A;  1RQ0 A;  2V89 A;  2RS6 A;  4I8O A;  2E5L E;  1T38 A;  1HR0 E;  4YY3 E;  1PJT A;  4GKK E;  2EQ3 A;  2F8B A;  2JOB A;  4WXD A;  3JU0 A;  2EN4 A;  5ADZ A;  3KZY A;  2EOM A;  2YTF A;  3KWR A;  2DGC A;  1YYO A;  2KHX A;  2JP9 A;  2MC6 A;  2EM3 A;  2HJJ A;  2R76 A;  2MC5 A;  1N3G A;  5LL6 R;  2MDG A;  4NZV A;  3C4T A;  1UN6 B;  4R2D A;  2L33 A;  2YPN A;  2LE2 A;  1YZ9 A;  2L3J A;  5AAS A;  2MKD A;  2EQ1 A;  2EPN A;  1YFH A;  3VHT B;  1MGT A;  4ZYE A;  4X65 E;  2YTE A;  4DUY E;  1YYK A;  2FGG A;  5A2Q C;  2EM5 A;  5A6K A;  4LFB E;  3H09 A;  3QG5 C;  2K7I A;  4J8Z A;  2YZT A;  1AH5 A;  5LLQ A;  1G2D C;  1PDA A;  5KL6 A;  1TF6 A;  4IJD A;  1EH6 A;  2EMX A;  2HC5 A;  4JI0 E;  2EMW A;  4M9V C;  4DV0 E;  2ELY A;  2VQE E;  2EOH A;  4WPY A;  1ZBT A;  5IV8 B;  4TUI A;  2DSY A;  2LJH A;  3ADL A;  2M1S A;  2WCC 3;  1X6H A;  4LTY A;  3ADG A;  4WX9 A;  2RQL A;  4F2J C;  4GEQ B;  4BCA A;  4MLV A;  2Q8U A;  2UXC E;  4JYA E;  4WFT A;  2EM2 A;  2L3C A;  1XNQ E;  2I13 A;  2LMZ A;  2EN6 A;  2LVH A;  4K0K E;  2V8Q B;  4P78 A;  2B7T A;  2DB2 A;  2EM6 A;  2YSP A;  2ODR C;  4R2C A;  4LFC E;  3OTO E;  2VQF E;  2DMY A;  2EM8 A;  2NA2 A;  4O43 A;  2ENA A;  2ENH A;  2EPP A;  3AUZ A;  4LU9 A;  1T39 A;  2FTX B;  1P47 A;  5LMN E;  1A1L A;  3J7Y p;  1X6E A;  2EOZ A;  4R03 A;  2L2N A;  4NXM E;  3ADJ A;  4JI6 E;  2EPX A;  4LF4 E;  3EPH A;  1YUJ A;  1N34 E;  2V88 A;  2L92 A;  2LUQ A;  1TF3 A;  2NUF A;  2NAB A;  2EPM X;  4B3M E;  2EMC A;  1WXR A;  4LF9 E;  2A25 A;  1YYW A;  2EPZ A;  3J7A G;  4WXC A;  1IBK E;  3C4B A;  1XNR E;  2M7Q A;  2EOY A;  4L5N C;  2NUE A;  2H36 X;  4OOG C;  2EOF A;  5AE2 A;  4O4K A;  1GTK A;  1G2F C;  2ADR A;  1BBG A;  2CPN A;  1TN9 A;  4DV2 E;  4DR4 E;  1RMD A;  4HEI A;  2WBS A;  2EOS A;  2IHR 1;  1J5E E;  2EJ4 A;  2EZ6 A; 
#chains in the Genus database with same CATH homology
 4P7D A;  3JTZ A;  4DR2 E;  2VF1 A;  5FLX C;  2UU9 E;  1UHZ A;  1XMO E;  4LF6 E;  3J80 C;  1PKP A;  4NXN E;  4X65 E;  3T1H E;  4DUY E;  1WHN A;  4DKK A;  4YHH E;  1YYK A;  4BS9 A;  2FGG A;  4F9C B;  5A2Q C;  1J5E E;  4BC9 A;  1IBL E;  3HQ1 A;  4LFB E;  2UUA E;  4JI4 E;  2EWL A;  4X64 E;  3H09 A;  5IWA E;  2E1M A;  3K6Q A;  4J8Z A;  4BC7 A;  2YZT A;  2UXD E;  3P1X A;  4JI5 E;  1EKZ A;  4WYQ B;  4F9A B;  4DR3 E;  4LFA E;  4DV3 E;  1QU6 A;  2V87 A;  4DV4 E;  4JI0 E;  4DV0 E;  2JOX A;  4OX9 E;  3ZOQ B;  3IWB A;  2LRS A;  4WSP A;  1ZBT A;  4WPY A;  2VQE E;  3HXL A;  2RS7 A;  3MSW A;  4F54 A;  4TUI A;  2DSY A;  4M30 A;  2LJH A;  1HNW E;  2NUG A;  3ADL A;  3LML A;  2M1S A;  2RSM A;  4LTY A;  3VYY A;  4B3T E;  2UUB E;  3ADG A;  4DMI A;  4M0V A;  4DR5 E;  1O0W A;  1SR9 A;  2N3H A;  2RTX A;  2ZM6 E;  4DV6 E;  2HHH E;  4JI3 E;  2ODR D;  4LF7 E;  2UXB E;  4GEQ B;  4BCA A;  2G7H A;  3F6G A;  2YT4 A;  1X47 A;  4DV1 E;  4DV5 E;  2UXC E;  4JYA E;  4BMJ A;  4JI7 E;  1STU A;  2V85 A;  4M2Z A;  4WFT A;  2UUC E;  1T4L B;  2B9D A;  4Q28 A;  2L8T A;  1XMQ E;  2L3C A;  1XNQ E;  2JVA A;  3OML A;  2LMZ A;  4K0K E;  2VE7 C;  2V8Q B;  4P78 A;  2B7T A;  2DB2 A;  1DQ3 A;  2V86 A;  3DJW A;  3T1Y E;  2ODR C;  5T6J A;  4X66 E;  1N32 E;  3IWC A;  5LMU E;  5DNY A;  3J81 C;  2B7V A;  4DR1 E;  1N33 E;  5BR8 E;  4LFC E;  4DV7 E;  1T4O A;  2V83 A;  4L8N A;  3OTO E;  2VQF E;  2DMY A;  5IT9 C;  1GQE A;  1UIL A;  2JR1 A;  2NA2 A;  4R8O A;  2B3T B;  4KZS A;  3JAM C;  3IWD A;  1I94 E;  2N3G A;  3AUZ A;  4LU9 A;  1IBM E;  4KHP E;  1J26 A;  1HNX E;  3FIG A;  4TUG A;  2FTX B;  2KOU A;  2JY9 A;  1RQ0 A;  2V89 A;  5LMN E;  2RS6 A;  4JV5 E;  2LTS A;  4I8O A;  1X48 A;  3J7Y p;  4X8W A;  2E5L E;  3HPS A;  1HR0 E;  4DR7 E;  3LLH A;  4R03 A;  2L2N A;  4YY3 E;  3AV0 A;  4NXM E;  2FV4 B;  3ADJ A;  4DR6 E;  4JI6 E;  3HTX A;  2MDR A;  2KON A;  5AE1 A;  5F3W A;  4LF4 E;  4GKK E;  1GZ6 A;  1ZBQ A;  2F8B A;  1N34 E;  2M4I A;  1WHQ A;  2V88 A;  2JOB A;  2L92 A;  2LUQ A;  2NUF A;  2L2M A;  1FKA E;  2L6M A;  3JU0 A;  4JI1 E;  3ADI A;  1RC7 A;  2WZO A;  5ADZ A;  3KWR A;  3RMP A;  4B3M E;  1WXR A;  4LF8 E;  2F4V E;  3VYX A;  4JI2 E;  4BBY A;  4LF9 E;  1YYO A;  2KHX A;  1YYW A;  2MC6 A;  3VK6 A;  1X49 A;  4AQY E;  3J7A G;  2LTR A;  1IBK E;  2K4V A;  3DF6 A;  2MC5 A;  3C4B A;  4LF5 E;  4F9B B;  2M7Q A;  1T4N A;  4DUZ E;  2LUP B;  4L5N C;  5LL6 R;  1HNZ E;  1XNR E;  2NUE A;  2H36 X;  3C4T A;  4OOG C;  1N36 E;  5AE2 A;  2L33 A;  4X62 E;  2L2K B;  5CFF E;  4B3R E;  1FJG E;  2CPN A;  2JWO A;  5AE3 A;  2LE2 A;  1YZ9 A;  4GKJ E;  2DIX A;  4DV2 E;  4DR4 E;  2L3J A;  4JI8 E;  5AAS A;  4B3S E;  1DI2 A;  2LBS B;  3F6H A;  2IHR 1;  3HPZ A;  2EZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...