3ZOQB

Structure of bsudg-p56 complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
48
structure length
48
Chain Sequence
DSYDVTMLLQDDDGKQYYEYHKGLSLSDFEVLYGNTADEIIKLRLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/viral protein
molecule keywords URACIL-DNA GLYCOSYLASE
publication title Crystal Structure and Functional Insights Into Uracil-DNA Glycosylase Inhibition by Phage Phi29 DNA Mimic Protein P56
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
total genus 9
structure length 48
sequence length 48
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.520 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3zoqB00
2LE2A 3ZOQB 4L5NC
chains in the Genus database with same CATH superfamily
2EOOA 4DV5E 2B7TA 2RTXA 2UUCE 4DR2E 2KONA 5IT9C 2VE7C 4JI0E 2EMYA 1KJKA 2EM7A 2JOXA 2V86A 2EOIA 2RSIA 2VQEE 2DB2A 3J7Yp 4BS9A 1NCSA 2EOHA 3VYXA 3LMLA 4BMJA 3IWCA 2EN7A 5A6KA 2J7JA 4IJDA 1X6HA 2ODRD 2PRTA 3C4BA 4K0KE 3HPZA 4F9CB 3VYYA 3EPJA 2LVHA 2EMIA 1AAYA 2HGHA 4WXDA 2I9IA 4DR5E 5LL6R 4R2RA 1N36E 2V8QB 4LU9A 1A1KA 1EH7A 2EL6A 1MGTA 3VK6A 5KL6A 4DUYE 2M7QA 4NZVA 3EQ1A 4RH8A 3IWBA 5IV8B 1PJQA 5A2QC 2KHXA 3RMPA 1ZR9A 4HTGA 2CSHA 3ZOQB 4WYQB 2EM2A 2EMGA 5A6JA 2YU8A 1LLMC 4JI3E 2GLIA 1HR0E 2ADRA 1JK1A 4Q35B 2EPPA 4IS1C 1YYKA 2ODRC 2L3CA 2HC5A 2EL4A 4JI1E 2EOFA 1WJPA 2IHR1 5LMNE 3MSWA 4R2DA 2YTEA 4LFBE 4M0VA 2EMBA 4WX9A 4R2QA 2LCEA 1IQSA 1QNTA 1BBGA 1HNXE 4JI4E 1IQOA 2LRSA 2EN1A 5AE3A 1A1LA 4KHPE 3BGHA 2EOJA 2VRDA 2K7IA 3TQMA 4F6MA 1F2IG 4DR4E 4BHBA 4OOGC 5LMUE 3KWRA 1T38A 1DI2A 1DQ3A 4LF8E 2LBSB 2EM3A 4WFTA 1A1IA 2DMIA 1A1HA 2UUBE 4GKJE 2EPRA 5T6JA 2VQFE 1TF6A 4LFCE 4I8OA 2M1SA 5A6BA 2ZM6E 3ADGA 2HJJA 3L00A 4X66E 2DGCA 2DSYA 2EQ1A 2RPCA 3JTZA 2YRHA 4DV6E 3ECRA 4J8ZA 3F6GA 4B3SE 2EPKX 2YSOA 5KL2A 2MDRA 2JVAA 2RQLA 4WXCA 2YTGA 3HXLA 4L5NC 5AC4A 2MC6A 4FK5C 4JI7E 2EORA 1B69A 4LF4E 4NXME 1IBKE 4NHRA 5ADZA 2LO3A 2YU5A 2UU9E 3T1YE 1PJTA 3ADJA 2B9DA 4GEQB 1IMUA 1GTKA 1YFHA 2YRMA 2EN6A 2E1MA 2UUAE 2ELZA 4R03A 5FLXC 4X8WA 4OX9E 5AE2A 2EOXA 3ADIA 2YSPA 2JP9A 4F6NA 1YUJA 4R2SA 5TSEA 2LT7A 5AC5A 4RHBB 1YUIA 2N3HA 2EPUA 4GKKE 4O5GA 3J7AG 4LF9E 1EH6A 2YTJA 3EPKA 1UN6B 5F3WA 1YYOA 1XNRE 2JWOA 1O0WA 2EQ3A 2JR1A 2LTSA 2EOZA 1JK2A 1ZU1A 3HQ1A 1YZ9A 2YWQA 2EMHA 2EOQA 1EKZA 2N3GA 4NXNE 4BC7A 2HHHE 3IWDA 2EL5A 4M9VC 4JV5E 2EMXA 2EMLA 1X6EA 2Q8UA 2YPNA 2YTFA 4O24A 5LLQA 3JAMC 2EMAA 1L4SA 3FIGA 3HPSA 2R1FA 2EM4A 2WBUA 3BIDA 2EM8A 2GPIA 4MLQA 1J5EE 4WSPA 2CT1A 5IXMB 1NEIA 1WRJA 3T1HE 2EM6A 1TF3A 2EP3A 2V85A 2I13A 3C6KA 1T4LB 3H09A 3OMLA 3OTOE 2JY9A 1RMDA 4ZYHA 4X62E 3THNA 1A1FA 4TUGA 1N34E 2DIXA 1AH5A 2EPMX 2EN2A 2EPZA 4DMIA 4LTYA 1UBDC 3BBGA 2YRKA 3J80C 4M2ZA 2EE8A 1DGCA 2EMZA 1X49A 1TN9A 2JPAA 4JYAE 1FJGE 2NABA 2LTRA 4B3TE 2E5LE 2WBSA 4R2AA 2BBGA 2KOUA 3QG5C 2R76A 2EZ6A 1KYQA 3KZZA 4DV0E 5KL7A 1FKAE 2F8BA 2L2KB 4DV4E 1XNQE 3AV0A 1T39A 3JU0A 4P78A 1HNZE 2G7HA 1G2FC 2EQ0A 4R2PA 2MC5A 2EM9A 1J26A 5BR8E 2LUPB 4YY3E 2RS6A 2D9HA 1SR9A 1QU6A 3C6MA 4X9JA 4M30A 2L8TA 2ELYA 1UILA 1WHQA 2K4VA 2LMZA 4WSGA 2NA2A 2NUGA 3ADLA 2EOMA 2LJHA 1XMQE 1UHZA 2E72A 2B7VA 2EMCA 1N33E 3BF2A 4BBYA 4JI2E 4F2JC 2M4IA 2DRPA 2YZTA 5KL4A 5A6BD 2ENHA 1T4OA 2YTQA 2EM5A 2GHFA 3AUZA 4P7DA 4DR6E 2NUEA 3DJWA 2EPXA 1X48A 1ZAAC 3DF6A 1YPNA 1A1JA 2F4VE 2L2NA 2EOSA 2L92A 1N32E 1X3CA 5KL5A 2V89A 1BB8A 1BBOA 4R2EA 2LUQA 1ZBQA 1ZBTA 2YTPA 2ENCA 2EWLA 2YT4A 2EN3A 2LJUA 2DLQA 2EMWA 4BCAA 4F9BB 3C4TA 2JYAA 4LF6E 4LFAE 1XMOE 2CPNA 2LV2A 2ENAA 1YSAC 1PKPA 3LLHA 2L3JA 2DMYA 2FV4B 4B3RE 1T4NA 3THOB 1HNWE 4R2CA 3HTXA 1G2DC 4KZSA 5IWAE 4BC9A 2EN4A 2YTDA 4O4KA 4R8OA 4Q28A 4ZYEA 4DV2E 2FGGA 5KL3A 2EM0A 2H36X 4DR1E 1IBLE 1I94E 4DR3E 2V88A 2MKDA 3KZYA 4WPYA 3MHHC 2DLKA 3UK3C 2FTXB 2WCC3 2MDGA 4F9AB 4JI8E 1X5WA 2YTOA 2JXPA 2WZOA 4DR7E 3F6HA 2EPNA 2EPOA 1X47A 2RS7A 4BHCA 1IBME 1YYWA 4F54A 4TUIA 1EH8A 3MHSC 1RQ0A 5A6AA 3P1XA 1PJSA 1P47A 2V87A 4DV3E 2VF1A 3M99B 4YHHE 4N4RB 2YTIA 2UXCE 4ZYDA 2EN8A 4DV7E 2EJ4A 1GQEA 2L6MA 4DV1E 4GZNC 2V83A 4X65E 1X6FA 1SFEA 2M9AA 4X64E 1WHNA 4DKKA 3K6QA 1GZ6A 1WXRA 2EMFA 2L33A 2YTNA 1MEYC 4B3ME 4JI6E 3EPLA 2WBTA 2MKNA 1N3GA 3EPHA 2EPCA 2UXDE 2EOEA 2N8XA 1Z1BA 3VHTB 2RSMA 2CTDA 1PDAA 4L8NA 2L2MA 5CFFE 4ZYGA 4O43A 4HEIA 3J81C 2EPLX 5AASA 4DUZE 5DNYA 5AE1A 2LE2A 4JI5E 2JOBA 1A1GA 2BB8A 2NUFA 5A69A 4AQYE 4LF5E 2EMKA 2EOYA 4KWYA 2EPAA 2UXBE 1STUA 4MLVA 1RC7A 2A25A 2B3TB 4LF7E
chains in the Genus database with same CATH topology
2YT4A 4DV5E 2B7TA 2RTXA 4BCAA 4F9BB 2UUCE 4X66E 4DR2E 3C4TA 2KONA 5IT9C 4LF6E 2DSYA 4LFAE 4X62E 4TUGA 1N34E 1XMOE 2DIXA 2CPNA 2VE7C 3JTZA 4JI0E 4DV6E 4DMIA 4LTYA 4J8ZA 3F6GA 4B3SE 2JOXA 2V86A 1PKPA 3LLHA 2MDRA 2L3JA 2DMYA 2FV4B 2VQEE 4B3RE 1T4NA 2DB2A 3J7Yp 2JVAA 4BS9A 3J80C 4M2ZA 1HNWE 1X49A 3HTXA 3VYXA 3HXLA 3LMLA 4BMJA 3IWCA 4L5NC 1FJGE 4JYAE 2LTRA 2MC6A 4KZSA 5IWAE 2ODRD 4BC9A 2E5LE 4B3TE 4JI7E 3C4BA 4K0KE 3HPZA 4F9CB 4R8OA 4Q28A 3VYYA 4DV2E 2FGGA 2KOUA 4LF4E 2H36X 4DR1E 1IBLE 4DR5E 5LL6R 4DR3E 1I94E 1N36E 4NXME 2V8QB 4LU9A 2EZ6A 1IBKE 5ADZA 4DV0E 2UU9E 3T1YE 1FKAE 2F8BA 2V88A 3ADJA 4WPYA 3VK6A 2B9DA 4GEQB 2L2KB 4DUYE 2M7QA 4DV4E 2FTXB 2E1MA 2UUAE 1XNQE 5FLXC 4R03A 3AV0A 4X8WA 3IWBA 5AE2A 4OX9E 3JU0A 2KHXA 4F9AB 5A2QC 3RMPA 4JI8E 3ADIA 4P78A 1HNZE 3ZOQB 2WZOA 2G7HA 4WYQB 4DR7E 2N3HA 3F6HA 2MC5A 2RS7A 1X47A 4JI3E 4GKKE 3J7AG 1IBME 1YYWA 1HR0E 4LF9E 1J26A 4F54A 4TUIA 5BR8E 5F3WA 1RQ0A 2LUPB 1YYOA 1YYKA 3P1XA 1XNRE 4YY3E 2ODRC 2L3CA 2RS6A 2JWOA 2V87A 1SR9A 1O0WA 1QU6A 2VF1A 3ADGA 4M30A 2L8TA 4YHHE 4DV3E 4JI1E 2JR1A 2LTSA 2IHR1 5LMNE 2UXCE 3MSWA 1UILA 4DV7E 2L6MA 1GQEA 1WHQA 3HQ1A 4DV1E 2K4VA 2LMZA 4M0VA 2NA2A 2V83A 1YZ9A 2NUGA 3ADLA 2LJHA 4X65E 1XMQE 1UHZA 4X64E 1EKZA 2B7VA 1WHNA 2N3GA 4DKKA 4NXNE 4BC7A 3K6QA 1N33E 1GZ6A 3IWDA 1WXRA 2HHHE 2L33A 4B3ME 4JI6E 1HNXE 4JI4E 4BBYA 4JI2E 4JV5E 2LRSA 2M4IA 2YZTA 5AE3A 4KHPE 3JAMC 1T4OA 3AUZA 4P7DA 4LFBE 2UXDE 4DR6E 3FIGA 3HPSA 2NUEA 4DR4E 3DJWA 2RSMA 1X48A 3DF6A 4OOGC 4L8NA 2L2MA 3KWRA 5CFFE 4WSPA 5LMUE 1J5EE 3J81C 1DI2A 1DQ3A 4LF8E 2LBSB 4WFTA 5AASA 4DUZE 2F4VE 2UUBE 2L2NA 5AE1A 2LE2A 5DNYA 2L92A 4JI5E 1N32E 3T1HE 2JOBA 2NUFA 4GKJE 2V89A 4AQYE 4LF5E 5T6JA 2VQFE 4LFCE 2V85A 2LUQA 2UXBE 1STUA 4I8OA 1ZBQA 3H09A 3OMLA 2M1SA 1ZBTA 3OTOE 2ZM6E 1T4LB 1RC7A 2JY9A 2B3TB 4LF7E 2EWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LE2 A;  3ZOQ B;  4L5N C; 
#chains in the Genus database with same CATH topology
 2EOO A;  4DV5 E;  2B7T A;  2RTX A;  2UUC E;  4DR2 E;  2KON A;  5IT9 C;  2VE7 C;  4JI0 E;  2EMY A;  1KJK A;  2EM7 A;  2JOX A;  2V86 A;  2EOI A;  2RSI A;  2VQE E;  2DB2 A;  3J7Y p;  4BS9 A;  1NCS A;  2EOH A;  3VYX A;  3LML A;  4BMJ A;  3IWC A;  2EN7 A;  5A6K A;  2J7J A;  4IJD A;  1X6H A;  2ODR D;  2PRT A;  3C4B A;  4K0K E;  3HPZ A;  4F9C B;  3VYY A;  3EPJ A;  2LVH A;  2EMI A;  1AAY A;  2HGH A;  4WXD A;  2I9I A;  4DR5 E;  5LL6 R;  4R2R A;  1N36 E;  2V8Q B;  4LU9 A;  1A1K A;  1EH7 A;  2EL6 A;  1MGT A;  3VK6 A;  5KL6 A;  4DUY E;  2M7Q A;  4NZV A;  3EQ1 A;  4RH8 A;  3IWB A;  5IV8 B;  1PJQ A;  5A2Q C;  2KHX A;  3RMP A;  1ZR9 A;  4HTG A;  2CSH A;  3ZOQ B;  4WYQ B;  2EM2 A;  2EMG A;  5A6J A;  2YU8 A;  1LLM C;  4JI3 E;  2GLI A;  1HR0 E;  2ADR A;  1JK1 A;  4Q35 B;  2EPP A;  4IS1 C;  1YYK A;  2ODR C;  2L3C A;  2HC5 A;  2EL4 A;  4JI1 E;  2EOF A;  1WJP A;  2IHR 1;  5LMN E;  3MSW A;  4R2D A;  2YTE A;  4LFB E;  4M0V A;  2EMB A;  4WX9 A;  4R2Q A;  2LCE A;  1IQS A;  1QNT A;  1BBG A;  1HNX E;  4JI4 E;  1IQO A;  2LRS A;  2EN1 A;  5AE3 A;  1A1L A;  4KHP E;  3BGH A;  2EOJ A;  2VRD A;  2K7I A;  3TQM A;  4F6M A;  1F2I G;  4DR4 E;  4BHB A;  4OOG C;  5LMU E;  3KWR A;  1T38 A;  1DI2 A;  1DQ3 A;  4LF8 E;  2LBS B;  2EM3 A;  4WFT A;  1A1I A;  2DMI A;  1A1H A;  2UUB E;  4GKJ E;  2EPR A;  5T6J A;  2VQF E;  1TF6 A;  4LFC E;  4I8O A;  2M1S A;  5A6B A;  2ZM6 E;  3ADG A;  2HJJ A;  3L00 A;  4X66 E;  2DGC A;  2DSY A;  2EQ1 A;  2RPC A;  3JTZ A;  2YRH A;  4DV6 E;  3ECR A;  4J8Z A;  3F6G A;  4B3S E;  2EPK X;  2YSO A;  5KL2 A;  2MDR A;  2JVA A;  2RQL A;  4WXC A;  2YTG A;  3HXL A;  4L5N C;  5AC4 A;  2MC6 A;  4FK5 C;  4JI7 E;  2EOR A;  1B69 A;  4LF4 E;  4NXM E;  1IBK E;  4NHR A;  5ADZ A;  2LO3 A;  2YU5 A;  2UU9 E;  3T1Y E;  1PJT A;  3ADJ A;  2B9D A;  4GEQ B;  1IMU A;  1GTK A;  1YFH A;  2YRM A;  2EN6 A;  2E1M A;  2UUA E;  2ELZ A;  4R03 A;  5FLX C;  4X8W A;  4OX9 E;  5AE2 A;  2EOX A;  3ADI A;  2YSP A;  2JP9 A;  4F6N A;  1YUJ A;  4R2S A;  5TSE A;  2LT7 A;  5AC5 A;  4RHB B;  1YUI A;  2N3H A;  2EPU A;  4GKK E;  4O5G A;  3J7A G;  4LF9 E;  1EH6 A;  2YTJ A;  3EPK A;  1UN6 B;  5F3W A;  1YYO A;  1XNR E;  2JWO A;  1O0W A;  2EQ3 A;  2JR1 A;  2LTS A;  2EOZ A;  1JK2 A;  1ZU1 A;  3HQ1 A;  1YZ9 A;  2YWQ A;  2EMH A;  2EOQ A;  1EKZ A;  2N3G A;  4NXN E;  4BC7 A;  2HHH E;  3IWD A;  2EL5 A;  4M9V C;  4JV5 E;  2EMX A;  2EML A;  1X6E A;  2Q8U A;  2YPN A;  2YTF A;  4O24 A;  5LLQ A;  3JAM C;  2EMA A;  1L4S A;  3FIG A;  3HPS A;  2R1F A;  2EM4 A;  2WBU A;  3BID A;  2EM8 A;  2GPI A;  4MLQ A;  1J5E E;  4WSP A;  2CT1 A;  5IXM B;  1NEI A;  1WRJ A;  3T1H E;  2EM6 A;  1TF3 A;  2EP3 A;  2V85 A;  2I13 A;  3C6K A;  1T4L B;  3H09 A;  3OML A;  3OTO E;  2JY9 A;  1RMD A;  4ZYH A;  4X62 E;  3THN A;  1A1F A;  4TUG A;  1N34 E;  2DIX A;  1AH5 A;  2EPM X;  2EN2 A;  2EPZ A;  4DMI A;  4LTY A;  1UBD C;  3BBG A;  2YRK A;  3J80 C;  4M2Z A;  2EE8 A;  1DGC A;  2EMZ A;  1X49 A;  1TN9 A;  2JPA A;  4JYA E;  1FJG E;  2NAB A;  2LTR A;  4B3T E;  2E5L E;  2WBS A;  4R2A A;  2BBG A;  2KOU A;  3QG5 C;  2R76 A;  2EZ6 A;  1KYQ A;  3KZZ A;  4DV0 E;  5KL7 A;  1FKA E;  2F8B A;  2L2K B;  4DV4 E;  1XNQ E;  3AV0 A;  1T39 A;  3JU0 A;  4P78 A;  1HNZ E;  2G7H A;  1G2F C;  2EQ0 A;  4R2P A;  2MC5 A;  2EM9 A;  1J26 A;  5BR8 E;  2LUP B;  4YY3 E;  2RS6 A;  2D9H A;  1SR9 A;  1QU6 A;  3C6M A;  4X9J A;  4M30 A;  2L8T A;  2ELY A;  1UIL A;  1WHQ A;  2K4V A;  2LMZ A;  4WSG A;  2NA2 A;  2NUG A;  3ADL A;  2EOM A;  2LJH A;  1XMQ E;  1UHZ A;  2E72 A;  2B7V A;  2EMC A;  1N33 E;  3BF2 A;  4BBY A;  4JI2 E;  4F2J C;  2M4I A;  2DRP A;  2YZT A;  5KL4 A;  5A6B D;  2ENH A;  1T4O A;  2YTQ A;  2EM5 A;  2GHF A;  3AUZ A;  4P7D A;  4DR6 E;  2NUE A;  3DJW A;  2EPX A;  1X48 A;  1ZAA C;  3DF6 A;  1YPN A;  1A1J A;  2F4V E;  2L2N A;  2EOS A;  2L92 A;  1N32 E;  1X3C A;  5KL5 A;  2V89 A;  1BB8 A;  1BBO A;  4R2E A;  2LUQ A;  1ZBQ A;  1ZBT A;  2YTP A;  2ENC A;  2EWL A;  2YT4 A;  2EN3 A;  2LJU A;  2DLQ A;  2EMW A;  4BCA A;  4F9B B;  3C4T A;  2JYA A;  4LF6 E;  4LFA E;  1XMO E;  2CPN A;  2LV2 A;  2ENA A;  1YSA C;  1PKP A;  3LLH A;  2L3J A;  2DMY A;  2FV4 B;  4B3R E;  1T4N A;  3THO B;  1HNW E;  4R2C A;  3HTX A;  1G2D C;  4KZS A;  5IWA E;  4BC9 A;  2EN4 A;  2YTD A;  4O4K A;  4R8O A;  4Q28 A;  4ZYE A;  4DV2 E;  2FGG A;  5KL3 A;  2EM0 A;  2H36 X;  4DR1 E;  1IBL E;  1I94 E;  4DR3 E;  2V88 A;  2MKD A;  3KZY A;  4WPY A;  3MHH C;  2DLK A;  3UK3 C;  2FTX B;  2WCC 3;  2MDG A;  4F9A B;  4JI8 E;  1X5W A;  2YTO A;  2JXP A;  2WZO A;  4DR7 E;  3F6H A;  2EPN A;  2EPO A;  1X47 A;  2RS7 A;  4BHC A;  1IBM E;  1YYW A;  4F54 A;  4TUI A;  1EH8 A;  3MHS C;  1RQ0 A;  5A6A A;  3P1X A;  1PJS A;  1P47 A;  2V87 A;  4DV3 E;  2VF1 A;  3M99 B;  4YHH E;  4N4R B;  2YTI A;  2UXC E;  4ZYD A;  2EN8 A;  4DV7 E;  2EJ4 A;  1GQE A;  2L6M A;  4DV1 E;  4GZN C;  2V83 A;  4X65 E;  1X6F A;  1SFE A;  2M9A A;  4X64 E;  1WHN A;  4DKK A;  3K6Q A;  1GZ6 A;  1WXR A;  2EMF A;  2L33 A;  2YTN A;  1MEY C;  4B3M E;  4JI6 E;  3EPL A;  2WBT A;  2MKN A;  1N3G A;  3EPH A;  2EPC A;  2UXD E;  2EOE A;  2N8X A;  1Z1B A;  3VHT B;  2RSM A;  2CTD A;  1PDA A;  4L8N A;  2L2M A;  5CFF E;  4ZYG A;  4O43 A;  4HEI A;  3J81 C;  2EPL X;  5AAS A;  4DUZ E;  5DNY A;  5AE1 A;  2LE2 A;  4JI5 E;  2JOB A;  1A1G A;  2BB8 A;  2NUF A;  5A69 A;  4AQY E;  4LF5 E;  2EMK A;  2EOY A;  4KWY A;  2EPA A;  2UXB E;  1STU A;  4MLV A;  1RC7 A;  2A25 A;  2B3T B;  4LF7 E; 
#chains in the Genus database with same CATH homology
 2YT4 A;  4DV5 E;  2B7T A;  2RTX A;  4BCA A;  4F9B B;  2UUC E;  4X66 E;  4DR2 E;  3C4T A;  2KON A;  5IT9 C;  4LF6 E;  2DSY A;  4LFA E;  4X62 E;  4TUG A;  1N34 E;  1XMO E;  2DIX A;  2CPN A;  2VE7 C;  3JTZ A;  4JI0 E;  4DV6 E;  4DMI A;  4LTY A;  4J8Z A;  3F6G A;  4B3S E;  2JOX A;  2V86 A;  1PKP A;  3LLH A;  2MDR A;  2L3J A;  2DMY A;  2FV4 B;  2VQE E;  4B3R E;  1T4N A;  2DB2 A;  3J7Y p;  2JVA A;  4BS9 A;  3J80 C;  4M2Z A;  1HNW E;  1X49 A;  3HTX A;  3VYX A;  3HXL A;  3LML A;  4BMJ A;  3IWC A;  4L5N C;  1FJG E;  4JYA E;  2LTR A;  2MC6 A;  4KZS A;  5IWA E;  2ODR D;  4BC9 A;  2E5L E;  4B3T E;  4JI7 E;  3C4B A;  4K0K E;  3HPZ A;  4F9C B;  4R8O A;  4Q28 A;  3VYY A;  4DV2 E;  2FGG A;  2KOU A;  4LF4 E;  2H36 X;  4DR1 E;  1IBL E;  4DR5 E;  5LL6 R;  4DR3 E;  1I94 E;  1N36 E;  4NXM E;  2V8Q B;  4LU9 A;  2EZ6 A;  1IBK E;  5ADZ A;  4DV0 E;  2UU9 E;  3T1Y E;  1FKA E;  2F8B A;  2V88 A;  3ADJ A;  4WPY A;  3VK6 A;  2B9D A;  4GEQ B;  2L2K B;  4DUY E;  2M7Q A;  4DV4 E;  2FTX B;  2E1M A;  2UUA E;  1XNQ E;  5FLX C;  4R03 A;  3AV0 A;  4X8W A;  3IWB A;  5AE2 A;  4OX9 E;  3JU0 A;  2KHX A;  4F9A B;  5A2Q C;  3RMP A;  4JI8 E;  3ADI A;  4P78 A;  1HNZ E;  3ZOQ B;  2WZO A;  2G7H A;  4WYQ B;  4DR7 E;  2N3H A;  3F6H A;  2MC5 A;  2RS7 A;  1X47 A;  4JI3 E;  4GKK E;  3J7A G;  1IBM E;  1YYW A;  1HR0 E;  4LF9 E;  1J26 A;  4F54 A;  4TUI A;  5BR8 E;  5F3W A;  1RQ0 A;  2LUP B;  1YYO A;  1YYK A;  3P1X A;  1XNR E;  4YY3 E;  2ODR C;  2L3C A;  2RS6 A;  2JWO A;  2V87 A;  1SR9 A;  1O0W A;  1QU6 A;  2VF1 A;  3ADG A;  4M30 A;  2L8T A;  4YHH E;  4DV3 E;  4JI1 E;  2JR1 A;  2LTS A;  2IHR 1;  5LMN E;  2UXC E;  3MSW A;  1UIL A;  4DV7 E;  2L6M A;  1GQE A;  1WHQ A;  3HQ1 A;  4DV1 E;  2K4V A;  2LMZ A;  4M0V A;  2NA2 A;  2V83 A;  1YZ9 A;  2NUG A;  3ADL A;  2LJH A;  4X65 E;  1XMQ E;  1UHZ A;  4X64 E;  1EKZ A;  2B7V A;  1WHN A;  2N3G A;  4DKK A;  4NXN E;  4BC7 A;  3K6Q A;  1N33 E;  1GZ6 A;  3IWD A;  1WXR A;  2HHH E;  2L33 A;  4B3M E;  4JI6 E;  1HNX E;  4JI4 E;  4BBY A;  4JI2 E;  4JV5 E;  2LRS A;  2M4I A;  2YZT A;  5AE3 A;  4KHP E;  3JAM C;  1T4O A;  3AUZ A;  4P7D A;  4LFB E;  2UXD E;  4DR6 E;  3FIG A;  3HPS A;  2NUE A;  4DR4 E;  3DJW A;  2RSM A;  1X48 A;  3DF6 A;  4OOG C;  4L8N A;  2L2M A;  3KWR A;  5CFF E;  4WSP A;  5LMU E;  1J5E E;  3J81 C;  1DI2 A;  1DQ3 A;  4LF8 E;  2LBS B;  4WFT A;  5AAS A;  4DUZ E;  2F4V E;  2UUB E;  2L2N A;  5AE1 A;  2LE2 A;  5DNY A;  2L92 A;  4JI5 E;  1N32 E;  3T1H E;  2JOB A;  2NUF A;  4GKJ E;  2V89 A;  4AQY E;  4LF5 E;  5T6J A;  2VQF E;  4LFC E;  2V85 A;  2LUQ A;  2UXB E;  1STU A;  4I8O A;  1ZBQ A;  3H09 A;  3OML A;  2M1S A;  1ZBT A;  3OTO E;  2ZM6 E;  1T4L B;  1RC7 A;  2JY9 A;  2B3T B;  4LF7 E;  2EWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...