3ZOQB

Structure of bsudg-p56 complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
48
structure length
48
Chain Sequence
DSYDVTMLLQDDDGKQYYEYHKGLSLSDFEVLYGNTADEIIKLRLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URACIL-DNA GLYCOSYLASE
publication title Crystal Structure and Functional Insights Into Uracil-DNA Glycosylase Inhibition by Phage Phi29 DNA Mimic Protein P56
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
molecule tags Hydrolase/viral protein
total genus 9
structure length 48
sequence length 48
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.520 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3zoqB00
3ZOQB 2LE2A 4L5NC
chains in the Genus database with same CATH superfamily
3VK6A 2N3GA 5ADZA 4JI0E 4KHPE 2EN4A 3ECRA 2EQ3A 2ELZA 2RS6A 1HNXE 4NXNE 4KZSA 1BBOA 5AC5A 2DRPA 4BBYA 2EPKX 2YTIA 2MDGA 4R2SA 2EPZA 1HR0E 4I8OA 4M30A 4DV1E 1DGCA 4LTYA 1LLMC 3HPSA 3TQMA 3OTOE 1JK2A 2YU5A 2V86A 1A1KA 2LTRA 3MHSC 5DNYA 2EOJA 3IWCA 3AUZA 3JTZA 2V88A 1X47A 3IWDA 3FIGA 2LMZA 4N4RB 1FJGE 2L3JA 2HC5A 2YWQA 4IJDA 2LUPB 2FTXB 1UILA 5KL2A 4O24A 2V8QB 2L2NA 1UHZA 5AASA 1ZU1A 4BS9A 2L33A 2EMFA 4LU9A 2EN3A 1YUJA 2EQ1A 2EOQA 2EOZA 1MGTA 2UXBE 4R2QA 4DV0E 4L8NA 1X48A 2VF1A 2YRKA 2GPIA 2EPUA 4YHHE 3JU0A 4O4KA 3ADLA 2EL4A 4B3SE 2EPXA 3P1XA 2LJHA 1T4OA 2JXPA 4DR2E 2ZM6E 2NA2A 2UUAE 1IQOA 5A69A 2YTGA 1TF3A 1GQEA 2MDRA 3QG5C 1J5EE 4LF9E 2EWLA 2LBSB 1KJKA 1PJSA 3C6MA 5KL4A 1N36E 2E72A 4BHBA 2NUFA 1JK1A 2EPCA 2YPNA 1HNZE 2ADRA 2F8BA 2K4VA 2EN6A 4NZVA 2LTSA 4WPYA 2EPRA 1YYKA 2ENCA 4DV3E 4MLVA 1EH6A 2ODRC 4LF8E 2EN1A 3BF2A 2MC5A 1GZ6A 2B7VA 3DJWA 4RH8A 5T6JA 2L3CA 3T1YE 3LMLA 2E1MA 1A1GA 4WSGA 2FV4B 1YZ9A 2EMIA 4DUYE 1WHNA 2CPNA 4P7DA 2B9DA 1T4NA 2YTPA 3UK3C 3HQ1A 1AH5A 2M1SA 4O43A 4K0KE 1FKAE 1X49A 2EN8A 4OOGC 1UN6B 2KOUA 4X65E 2RPCA 4F2JC 4F6MA 2EMXA 4X64E 3J81C 4B3RE 4IS1C 4P78A 4R2CA 2JP9A 1G2FC 2YRMA 1GTKA 2I13A 2DGCA 3M99B 5KL6A 1X3CA 3MSWA 2N8XA 3VHTB 5LMUE 2EOMA 4R8OA 4DV7E 2EMZA 2B3TB 2EOXA 2EOSA 2YTNA 1N3GA 3HTXA 2EORA 4DR4E 3VYXA 1L4SA 2ELYA 2EPMX 1A1LA 2JY9A 2WCC3 4GZNC 2RTXA 4RHBB 4F9BB 4DV4E 2G7HA 2NUEA 2WBUA 1P47A 5CFFE 5IWAE 4JI8E 1B69A 1DI2A 2D9HA 1EH7A 1RQ0A 2EOOA 4X62E 4TUGA 2UU9E 2EPLX 4B3ME 2EJ4A 1KYQA 5IV8B 4WSPA 2EMCA 4DR6E 4JI7E 2ODRD 2L6MA 1HNWE 1EH8A 4FK5C 2B7TA 2EPNA 3J7AG 2EMLA 5KL7A 2EMKA 1MEYC 2JWOA 5AE1A 5AC4A 2EM4A 1QNTA 4LF5E 2YU8A 3KWRA 2VE7C 1TF6A 2KONA 1A1IA 2L92A 2Q8UA 4WFTA 3BGHA 4LFCE 2V87A 4R2RA 4JYAE 5A2QC 4JI1E 2VRDA 4HTGA 2EP3A 2BBGA 3EQ1A 3MHHC 1I94E 2YTDA 2IHR1 1O0WA 2MKNA 4R2AA 2YTEA 4DR1E 2KHXA 1ZBTA 1WHQA 1YYOA 4DV5E 4TUIA 4GKJE 2N3HA 4X8WA 2RS7A 4ZYEA 1ZAAC 2BB8A 2L8TA 2MC6A 4B3TE 1YSAC 4Q28A 4Q35B 3THOB 4M2ZA 1QU6A 2LV2A 1N34E 4BC7A 2EOHA 2EM8A 3EPLA 1IBME 4JI3E 4LF7E 2DIXA 2J7JA 2JYAA 1EKZA 2EQ0A 4DV2E 1YPNA 1YFHA 5A6KA 4X66E 3F6HA 4F6NA 4GEQB 2EMGA 4L5NC 5A6AA 2A25A 4AQYE 5F3WA 2V85A 3LLHA 2EOYA 4LFBE 2LJUA 4X9JA 2JOBA 1Z1BA 2RSMA 5IT9C 2YTOA 4JI6E 1IMUA 2WBTA 4F9CB 2M7QA 5KL3A 2V83A 5A6BA 2EM3A 2CTDA 2VQFE 1NCSA 3IWBA 2RQLA 3ADGA 4M0VA 2EOFA 2ENHA 4BC9A 3EPHA 2R76A 2EPOA 2ENAA 2WBSA 1N33E 1DQ3A 2HHHE 1ZBQA 2EM0A 5A6JA 2LCEA 2YT4A 2EOEA 4BCAA 3HPZA 3T1HE 3ADIA 2DMIA 2EN7A 4JI2E 4JI5E 2EZ6A 2EM7A 1F2IG 2VQEE 2JOXA 4WXCA 1IQSA 4R2PA 2CT1A 3DF6A 2YZTA 1WJPA 1SFEA 3VYYA 1IBLE 1X6FA 2NUGA 3KZZA 4O5GA 3EPKA 4NXME 1J26A 2E5LE 5TSEA 1IBKE 1UBDC 1XMOE 2LE2A 4J8ZA 2HJJA 1AAYA 2YTQA 3EPJA 3BBGA 2GHFA 4DV6E 2F4VE 1A1FA 2UXDE 3H09A 2R1FA 2EM5A 3J7Yp 3C4TA 2M4IA 5LLQA 4MLQA 1A1JA 2NABA 2EMYA 2LT7A 4M9VC 4LF6E 4WXDA 3THNA 1XMQE 2EM9A 1PDAA 3KZYA 2EN2A 1YYWA 4DR5E 3BIDA 4DMIA 2JR1A 5KL5A 1X6EA 1XNQE 5BR8E 3JAMC 1SR9A 3RMPA 1YUIA 2YSPA 2EMBA 4DR3E 2HGHA 4R03A 3OMLA 2YSOA 1X5WA 3HXLA 4DUZE 2WZOA 1STUA 4GKKE 2YTFA 1G2DC 1TN9A 2YTJA 2DLKA 2RSIA 2V89A 4NHRA 4WYQB 2LO3A 2MKDA 4ZYGA 1PKPA 2EPPA 1NEIA 3K6QA 4F9AB 5LMNE 2CSHA 1PJTA 3C6KA 2UUCE 1WXRA 3ZOQB 1T4LB 1A1HA 4OX9E 2H36X 5A6BD 4BMJA 1RMDA 3AV0A 3ADJA 2I9IA 2EL5A 1X6HA 2LRSA 5AE2A 1XNRE 1N32E 2LVHA 2UUBE 3L00A 4ZYDA 2DSYA 4BHCA 4YY3E 5IXMB 2K7IA 4DKKA 3C4BA 2PRTA 4WX9A 1BBGA 1ZR9A 1T39A 2DMYA 4F54A 4DR7E 4JV5E 2M9AA 2L2KB 2YRHA 4KWYA 2EE8A 2UXCE 4LFAE 3F6GA 1RC7A 2EL6A 4R2DA 4LF4E 5LL6R 4HEIA 2JPAA 3J80C 2EMAA 5AE3A 4JI4E 1BB8A 2EMHA 2DB2A 4R2EA 1T38A 2L2MA 2EM2A 2EMWA 2LUQA 2GLIA 2EPAA 2EOIA 2FGGA 2DLQA 2EM6A 2JVAA 1WRJA 5FLXC 1PJQA 4ZYHA
chains in the Genus database with same CATH topology
3VK6A 1GZ6A 2N3GA 5ADZA 4TUIA 2L3CA 4DV5E 3T1YE 4JI0E 4KHPE 3LMLA 4GKJE 2N3HA 2E1MA 2RS7A 4X8WA 4DV6E 2F4VE 2UXDE 2RS6A 3H09A 2FV4B 1HNXE 2MC6A 2L8TA 1YYOA 4B3TE 4NXNE 1YZ9A 4DUYE 3J7Yp 4KZSA 1WHNA 4Q28A 3C4TA 2M4IA 4M2ZA 2CPNA 4P7DA 1QU6A 1T4NA 2B9DA 4BBYA 1N34E 4BC7A 4JI3E 1IBME 3HQ1A 1HR0E 2M1SA 4K0KE 4I8OA 4M30A 1FKAE 1X49A 4DV1E 4OOGC 4LF6E 1XMQE 4LF7E 2DIXA 2KOUA 4LTYA 4X65E 1YYWA 4DR5E 4DMIA 4X64E 2JR1A 1EKZA 3J81C 4B3RE 3HPSA 3OTOE 1XNQE 4DV2E 4P78A 2V86A 5BR8E 3JAMC 1SR9A 2LTRA 3RMPA 5T6JA 4X66E 3F6HA 5DNYA 4GEQB 4DR3E 3IWCA 3MSWA 4L5NC 4R03A 4AQYE 3OMLA 5F3WA 3AUZA 2V85A 5LMUE 4R8OA 3HXLA 3JTZA 3LLHA 4DUZE 2V88A 2WZOA 4DV7E 4LFBE 1X47A 1STUA 2B3TB 3IWDA 4GKKE 3HTXA 3FIGA 2LMZA 1FJGE 4DR4E 2L3JA 2LUPB 4WYQB 2FTXB 1UILA 2V89A 1PKPA 2JOBA 3VYXA 3K6QA 4F9AB 2V8QB 5LMNE 2L2NA 2JY9A 2RSMA 5IT9C 1UHZA 5AASA 2RTXA 4F9BB 4DV4E 4BS9A 2G7HA 4JI6E 2NUEA 2UUCE 2L33A 4LU9A 4F9CB 1WXRA 2M7QA 3ZOQB 5CFFE 1T4LB 4OX9E 2V83A 5IWAE 4JI8E 2H36X 2VQFE 4BMJA 1DI2A 2UXBE 3AV0A 1RQ0A 3IWBA 3ADJA 4X62E 3ADGA 4DV0E 4L8NA 4TUGA 4M0VA 2UU9E 1X48A 2VF1A 4B3ME 2LRSA 5AE2A 1XNRE 4BC9A 1N32E 4YHHE 2UUBE 4WSPA 3JU0A 4JI7E 2ODRD 3ADLA 4DR6E 2DSYA 2L6MA 1HNWE 4J8ZA 4YY3E 1N33E 2B7TA 4DKKA 1DQ3A 2HHHE 1ZBQA 4B3SE 3C4BA 2LJHA 3P1XA 3J7AG 1T4OA 4DR2E 2ZM6E 2NA2A 2JWOA 2DMYA 2YT4A 2UUAE 4F54A 5AE1A 4BCAA 4DR7E 1GQEA 3HPZA 4JV5E 2MDRA 2L2KB 3T1HE 1J5EE 3ADIA 4LF9E 2UXCE 2EWLA 4LF5E 4LFAE 2LBSB 3F6GA 1RC7A 3KWRA 4JI2E 4JI5E 2EZ6A 1N36E 2VE7C 2VQEE 2JOXA 2NUFA 5LL6R 2KONA 4LF4E 3J80C 2L92A 4WFTA 5AE3A 4JI4E 1HNZE 2V87A 2DB2A 4LFCE 3DF6A 4JYAE 2F8BA 2L2MA 2YZTA 2K4VA 5A2QC 2LTSA 2LUQA 3VYYA 4WPYA 4JI1E 1IBLE 1YYKA 2FGGA 5FLXC 2JVAA 2NUGA 1I94E 2IHR1 4DV3E 4NXME 1O0WA 1J26A 2ODRC 2E5LE 1IBKE 4LF8E 1XMOE 2LE2A 4DR1E 2KHXA 2MC5A 1ZBTA 2B7VA 3DJWA 1WHQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZOQ B;  2LE2 A;  4L5N C; 
#chains in the Genus database with same CATH topology
 3VK6 A;  2N3G A;  5ADZ A;  4JI0 E;  4KHP E;  2EN4 A;  3ECR A;  2EQ3 A;  2ELZ A;  2RS6 A;  1HNX E;  4NXN E;  4KZS A;  1BBO A;  5AC5 A;  2DRP A;  4BBY A;  2EPK X;  2YTI A;  2MDG A;  4R2S A;  2EPZ A;  1HR0 E;  4I8O A;  4M30 A;  4DV1 E;  1DGC A;  4LTY A;  1LLM C;  3HPS A;  3TQM A;  3OTO E;  1JK2 A;  2YU5 A;  2V86 A;  1A1K A;  2LTR A;  3MHS C;  5DNY A;  2EOJ A;  3IWC A;  3AUZ A;  3JTZ A;  2V88 A;  1X47 A;  3IWD A;  3FIG A;  2LMZ A;  4N4R B;  1FJG E;  2L3J A;  2HC5 A;  2YWQ A;  4IJD A;  2LUP B;  2FTX B;  1UIL A;  5KL2 A;  4O24 A;  2V8Q B;  2L2N A;  1UHZ A;  5AAS A;  1ZU1 A;  4BS9 A;  2L33 A;  2EMF A;  4LU9 A;  2EN3 A;  1YUJ A;  2EQ1 A;  2EOQ A;  2EOZ A;  1MGT A;  2UXB E;  4R2Q A;  4DV0 E;  4L8N A;  1X48 A;  2VF1 A;  2YRK A;  2GPI A;  2EPU A;  4YHH E;  3JU0 A;  4O4K A;  3ADL A;  2EL4 A;  4B3S E;  2EPX A;  3P1X A;  2LJH A;  1T4O A;  2JXP A;  4DR2 E;  2ZM6 E;  2NA2 A;  2UUA E;  1IQO A;  5A69 A;  2YTG A;  1TF3 A;  1GQE A;  2MDR A;  3QG5 C;  1J5E E;  4LF9 E;  2EWL A;  2LBS B;  1KJK A;  1PJS A;  3C6M A;  5KL4 A;  1N36 E;  2E72 A;  4BHB A;  2NUF A;  1JK1 A;  2EPC A;  2YPN A;  1HNZ E;  2ADR A;  2F8B A;  2K4V A;  2EN6 A;  4NZV A;  2LTS A;  4WPY A;  2EPR A;  1YYK A;  2ENC A;  4DV3 E;  4MLV A;  1EH6 A;  2ODR C;  4LF8 E;  2EN1 A;  3BF2 A;  2MC5 A;  1GZ6 A;  2B7V A;  3DJW A;  4RH8 A;  5T6J A;  2L3C A;  3T1Y E;  3LML A;  2E1M A;  1A1G A;  4WSG A;  2FV4 B;  1YZ9 A;  2EMI A;  4DUY E;  1WHN A;  2CPN A;  4P7D A;  2B9D A;  1T4N A;  2YTP A;  3UK3 C;  3HQ1 A;  1AH5 A;  2M1S A;  4O43 A;  4K0K E;  1FKA E;  1X49 A;  2EN8 A;  4OOG C;  1UN6 B;  2KOU A;  4X65 E;  2RPC A;  4F2J C;  4F6M A;  2EMX A;  4X64 E;  3J81 C;  4B3R E;  4IS1 C;  4P78 A;  4R2C A;  2JP9 A;  1G2F C;  2YRM A;  1GTK A;  2I13 A;  2DGC A;  3M99 B;  5KL6 A;  1X3C A;  3MSW A;  2N8X A;  3VHT B;  5LMU E;  2EOM A;  4R8O A;  4DV7 E;  2EMZ A;  2B3T B;  2EOX A;  2EOS A;  2YTN A;  1N3G A;  3HTX A;  2EOR A;  4DR4 E;  3VYX A;  1L4S A;  2ELY A;  2EPM X;  1A1L A;  2JY9 A;  2WCC 3;  4GZN C;  2RTX A;  4RHB B;  4F9B B;  4DV4 E;  2G7H A;  2NUE A;  2WBU A;  1P47 A;  5CFF E;  5IWA E;  4JI8 E;  1B69 A;  1DI2 A;  2D9H A;  1EH7 A;  1RQ0 A;  2EOO A;  4X62 E;  4TUG A;  2UU9 E;  2EPL X;  4B3M E;  2EJ4 A;  1KYQ A;  5IV8 B;  4WSP A;  2EMC A;  4DR6 E;  4JI7 E;  2ODR D;  2L6M A;  1HNW E;  1EH8 A;  4FK5 C;  2B7T A;  2EPN A;  3J7A G;  2EML A;  5KL7 A;  2EMK A;  1MEY C;  2JWO A;  5AE1 A;  5AC4 A;  2EM4 A;  1QNT A;  4LF5 E;  2YU8 A;  3KWR A;  2VE7 C;  1TF6 A;  2KON A;  1A1I A;  2L92 A;  2Q8U A;  4WFT A;  3BGH A;  4LFC E;  2V87 A;  4R2R A;  4JYA E;  5A2Q C;  4JI1 E;  2VRD A;  4HTG A;  2EP3 A;  2BBG A;  3EQ1 A;  3MHH C;  1I94 E;  2YTD A;  2IHR 1;  1O0W A;  2MKN A;  4R2A A;  2YTE A;  4DR1 E;  2KHX A;  1ZBT A;  1WHQ A;  1YYO A;  4DV5 E;  4TUI A;  4GKJ E;  2N3H A;  4X8W A;  2RS7 A;  4ZYE A;  1ZAA C;  2BB8 A;  2L8T A;  2MC6 A;  4B3T E;  1YSA C;  4Q28 A;  4Q35 B;  3THO B;  4M2Z A;  1QU6 A;  2LV2 A;  1N34 E;  4BC7 A;  2EOH A;  2EM8 A;  3EPL A;  1IBM E;  4JI3 E;  4LF7 E;  2DIX A;  2J7J A;  2JYA A;  1EKZ A;  2EQ0 A;  4DV2 E;  1YPN A;  1YFH A;  5A6K A;  4X66 E;  3F6H A;  4F6N A;  4GEQ B;  2EMG A;  4L5N C;  5A6A A;  2A25 A;  4AQY E;  5F3W A;  2V85 A;  3LLH A;  2EOY A;  4LFB E;  2LJU A;  4X9J A;  2JOB A;  1Z1B A;  2RSM A;  5IT9 C;  2YTO A;  4JI6 E;  1IMU A;  2WBT A;  4F9C B;  2M7Q A;  5KL3 A;  2V83 A;  5A6B A;  2EM3 A;  2CTD A;  2VQF E;  1NCS A;  3IWB A;  2RQL A;  3ADG A;  4M0V A;  2EOF A;  2ENH A;  4BC9 A;  3EPH A;  2R76 A;  2EPO A;  2ENA A;  2WBS A;  1N33 E;  1DQ3 A;  2HHH E;  1ZBQ A;  2EM0 A;  5A6J A;  2LCE A;  2YT4 A;  2EOE A;  4BCA A;  3HPZ A;  3T1H E;  3ADI A;  2DMI A;  2EN7 A;  4JI2 E;  4JI5 E;  2EZ6 A;  2EM7 A;  1F2I G;  2VQE E;  2JOX A;  4WXC A;  1IQS A;  4R2P A;  2CT1 A;  3DF6 A;  2YZT A;  1WJP A;  1SFE A;  3VYY A;  1IBL E;  1X6F A;  2NUG A;  3KZZ A;  4O5G A;  3EPK A;  4NXM E;  1J26 A;  2E5L E;  5TSE A;  1IBK E;  1UBD C;  1XMO E;  2LE2 A;  4J8Z A;  2HJJ A;  1AAY A;  2YTQ A;  3EPJ A;  3BBG A;  2GHF A;  4DV6 E;  2F4V E;  1A1F A;  2UXD E;  3H09 A;  2R1F A;  2EM5 A;  3J7Y p;  3C4T A;  2M4I A;  5LLQ A;  4MLQ A;  1A1J A;  2NAB A;  2EMY A;  2LT7 A;  4M9V C;  4LF6 E;  4WXD A;  3THN A;  1XMQ E;  2EM9 A;  1PDA A;  3KZY A;  2EN2 A;  1YYW A;  4DR5 E;  3BID A;  4DMI A;  2JR1 A;  5KL5 A;  1X6E A;  1XNQ E;  5BR8 E;  3JAM C;  1SR9 A;  3RMP A;  1YUI A;  2YSP A;  2EMB A;  4DR3 E;  2HGH A;  4R03 A;  3OML A;  2YSO A;  1X5W A;  3HXL A;  4DUZ E;  2WZO A;  1STU A;  4GKK E;  2YTF A;  1G2D C;  1TN9 A;  2YTJ A;  2DLK A;  2RSI A;  2V89 A;  4NHR A;  4WYQ B;  2LO3 A;  2MKD A;  4ZYG A;  1PKP A;  2EPP A;  1NEI A;  3K6Q A;  4F9A B;  5LMN E;  2CSH A;  1PJT A;  3C6K A;  2UUC E;  1WXR A;  3ZOQ B;  1T4L B;  1A1H A;  4OX9 E;  2H36 X;  5A6B D;  4BMJ A;  1RMD A;  3AV0 A;  3ADJ A;  2I9I A;  2EL5 A;  1X6H A;  2LRS A;  5AE2 A;  1XNR E;  1N32 E;  2LVH A;  2UUB E;  3L00 A;  4ZYD A;  2DSY A;  4BHC A;  4YY3 E;  5IXM B;  2K7I A;  4DKK A;  3C4B A;  2PRT A;  4WX9 A;  1BBG A;  1ZR9 A;  1T39 A;  2DMY A;  4F54 A;  4DR7 E;  4JV5 E;  2M9A A;  2L2K B;  2YRH A;  4KWY A;  2EE8 A;  2UXC E;  4LFA E;  3F6G A;  1RC7 A;  2EL6 A;  4R2D A;  4LF4 E;  5LL6 R;  4HEI A;  2JPA A;  3J80 C;  2EMA A;  5AE3 A;  4JI4 E;  1BB8 A;  2EMH A;  2DB2 A;  4R2E A;  1T38 A;  2L2M A;  2EM2 A;  2EMW A;  2LUQ A;  2GLI A;  2EPA A;  2EOI A;  2FGG A;  2DLQ A;  2EM6 A;  2JVA A;  1WRJ A;  5FLX C;  1PJQ A;  4ZYH A; 
#chains in the Genus database with same CATH homology
 3VK6 A;  1GZ6 A;  2N3G A;  5ADZ A;  4TUI A;  2L3C A;  4DV5 E;  3T1Y E;  4JI0 E;  4KHP E;  3LML A;  4GKJ E;  2N3H A;  2E1M A;  2RS7 A;  4X8W A;  4DV6 E;  2F4V E;  2UXD E;  2RS6 A;  3H09 A;  2FV4 B;  1HNX E;  2MC6 A;  2L8T A;  1YYO A;  4B3T E;  4NXN E;  1YZ9 A;  4DUY E;  3J7Y p;  4KZS A;  1WHN A;  4Q28 A;  3C4T A;  2M4I A;  4M2Z A;  2CPN A;  4P7D A;  1QU6 A;  1T4N A;  2B9D A;  4BBY A;  1N34 E;  4BC7 A;  4JI3 E;  1IBM E;  3HQ1 A;  1HR0 E;  2M1S A;  4K0K E;  4I8O A;  4M30 A;  1FKA E;  1X49 A;  4DV1 E;  4OOG C;  4LF6 E;  1XMQ E;  4LF7 E;  2DIX A;  2KOU A;  4LTY A;  4X65 E;  1YYW A;  4DR5 E;  4DMI A;  4X64 E;  2JR1 A;  1EKZ A;  3J81 C;  4B3R E;  3HPS A;  3OTO E;  1XNQ E;  4DV2 E;  4P78 A;  2V86 A;  5BR8 E;  3JAM C;  1SR9 A;  2LTR A;  3RMP A;  5T6J A;  4X66 E;  3F6H A;  5DNY A;  4GEQ B;  4DR3 E;  3IWC A;  3MSW A;  4L5N C;  4R03 A;  4AQY E;  3OML A;  5F3W A;  3AUZ A;  2V85 A;  5LMU E;  4R8O A;  3HXL A;  3JTZ A;  3LLH A;  4DUZ E;  2V88 A;  2WZO A;  4DV7 E;  4LFB E;  1X47 A;  1STU A;  2B3T B;  3IWD A;  4GKK E;  3HTX A;  3FIG A;  2LMZ A;  1FJG E;  4DR4 E;  2L3J A;  2LUP B;  4WYQ B;  2FTX B;  1UIL A;  2V89 A;  1PKP A;  2JOB A;  3VYX A;  3K6Q A;  4F9A B;  2V8Q B;  5LMN E;  2L2N A;  2JY9 A;  2RSM A;  5IT9 C;  1UHZ A;  5AAS A;  2RTX A;  4F9B B;  4DV4 E;  4BS9 A;  2G7H A;  4JI6 E;  2NUE A;  2UUC E;  2L33 A;  4LU9 A;  4F9C B;  1WXR A;  2M7Q A;  3ZOQ B;  5CFF E;  1T4L B;  4OX9 E;  2V83 A;  5IWA E;  4JI8 E;  2H36 X;  2VQF E;  4BMJ A;  1DI2 A;  2UXB E;  3AV0 A;  1RQ0 A;  3IWB A;  3ADJ A;  4X62 E;  3ADG A;  4DV0 E;  4L8N A;  4TUG A;  4M0V A;  2UU9 E;  1X48 A;  2VF1 A;  4B3M E;  2LRS A;  5AE2 A;  1XNR E;  4BC9 A;  1N32 E;  4YHH E;  2UUB E;  4WSP A;  3JU0 A;  4JI7 E;  2ODR D;  3ADL A;  4DR6 E;  2DSY A;  2L6M A;  1HNW E;  4J8Z A;  4YY3 E;  1N33 E;  2B7T A;  4DKK A;  1DQ3 A;  2HHH E;  1ZBQ A;  4B3S E;  3C4B A;  2LJH A;  3P1X A;  3J7A G;  1T4O A;  4DR2 E;  2ZM6 E;  2NA2 A;  2JWO A;  2DMY A;  2YT4 A;  2UUA E;  4F54 A;  5AE1 A;  4BCA A;  4DR7 E;  1GQE A;  3HPZ A;  4JV5 E;  2MDR A;  2L2K B;  3T1H E;  1J5E E;  3ADI A;  4LF9 E;  2UXC E;  2EWL A;  4LF5 E;  4LFA E;  2LBS B;  3F6G A;  1RC7 A;  3KWR A;  4JI2 E;  4JI5 E;  2EZ6 A;  1N36 E;  2VE7 C;  2VQE E;  2JOX A;  2NUF A;  5LL6 R;  2KON A;  4LF4 E;  3J80 C;  2L92 A;  4WFT A;  5AE3 A;  4JI4 E;  1HNZ E;  2V87 A;  2DB2 A;  4LFC E;  3DF6 A;  4JYA E;  2F8B A;  2L2M A;  2YZT A;  2K4V A;  5A2Q C;  2LTS A;  2LUQ A;  3VYY A;  4WPY A;  4JI1 E;  1IBL E;  1YYK A;  2FGG A;  5FLX C;  2JVA A;  2NUG A;  1I94 E;  2IHR 1;  4DV3 E;  4NXM E;  1O0W A;  1J26 A;  2ODR C;  2E5L E;  1IBK E;  4LF8 E;  1XMO E;  2LE2 A;  4DR1 E;  2KHX A;  2MC5 A;  1ZBT A;  2B7V A;  3DJW A;  1WHQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...