2EOEA

Solution structure of the c2h2 type zinc finger (region 508-540) of human zinc finger protein 347
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
b'GSSGSSGTGEKPYKCNECGKVFTQNSHLANHQRIHTGVKPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 347
publication title Solution structure of the C2H2 type zinc finger (region 508-540) of human Zinc finger protein 347
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eoeA01
5KL5A 1BBOA 1X5WA 1X6HA 3EPKA 2EMIA 2RPCA 2YRKA 2EN1A 2EOQA 2LT7A 1X3CA 2CTDA 2EJ4A 2EOEA 2LV2A 2YTQA 2YRHA 2YU5A 1Z1BA 2EQ1A 3EPHA 4IJDA 2ELYA 2M9AA 2YTPA 2EM4A 1UN6B 2A25A 2YU8A 2EN6A 1A1HA 2CT1A 1LLMC 2DLQA 2EN2A 2J7JA 2BB8A 2EOIA 4R2EA 1TF3A 2WBUA 2EN8A 1JK2A 4IS1C 2EMZA 1X6FA 2EOHA 5KL4A 2LVHA 2EOSA 1G2FC 2DRPA 2WBTA 2EMHA 1B69A 1X6EA 2EPAA 1A1JA 4R2PA 1DGCA 3MHHC 2ELZA 2YSOA 4R2QA 2EL4A 2YTEA 1TF6A 1G2DC 2EPRA 2LO3A 3VHTB 1NCSA 2EMWA 5KL7A 2EM3A 2EP3A 2YTFA 4R2DA 2MKNA 2EOJA 2D9HA 2EMBA 1KJKA 2ENCA 2GLIA 2EOMA 2MKDA 4R2RA 1MEYC 1JK1A 2EPCA 2EL6A 2EQ3A 1AAYA 1YUJA 1P47A 4R2CA 2EPZA 1RMDA 1ZAAC 2PRTA 4F6NA 2YSPA 5KL2A 2EM0A 1A1GA 4R2AA 2YTIA 2ENAA 4F2JC 3MHSC 1A1FA 2EOOA 2NABA 2EORA 2JPAA 1TN9A 2CSHA 4WSGA 2EMGA 2E72A 2HGHA 2I13A 1A1KA 2EPUA 2EM6A 2VRDA 1A1IA 1WJPA 2EM9A 2YTOA 1ZU1A 3EPJA 2MDGA 2WBSA 2EMLA 2EPXA 2JP9A 1UBDC 5KL6A 2EN4A 2RSIA 3UK3C 4F6MA 2ADRA 2YTDA 2ENHA 2DLKA 2YTNA 1YUIA 4M9VC 4X9JA 4GZNC 2EOYA 2YRMA 1ZR9A 2EQ0A 2EM7A 3M99B 2EMKA 2EPPA 2EOZA 2R1FA 2EMCA 1BB8A 2EM2A 2WCC3 1YSAC 3EPLA 2EM8A 2EN3A 2EOXA 2GHFA 2LCEA 2EE8A 1F2IG 2YTGA 2EN7A 2EMFA 5KL3A 1A1LA 4R2SA 2EMYA 2EMXA 4FK5C 2DMIA 2DGCA 2EM5A 2EL5A 2EOFA 2YTJA 2EMAA
chains in the Genus database with same CATH superfamily
2YPNA 1BBOA 4LF5E 2M7QA 5T6JA 2UUCE 2EN1A 3TQMA 2EWLA 2LV2A 2YTQA 3KZYA 4X66E 3C6KA 1J26A 2M9AA 2N8XA 2YTPA 2E1MA 2DLQA 3DF6A 3HTXA 2NA2A 5LMUE 4DV3E 2V86A 4O5GA 2WBUA 2V83A 4DKKA 4IS1C 2EMZA 4JV5E 4DR6E 1T38A 4DR7E 2LUQA 4TUGA 1A1JA 1DGCA 5LLQA 4LU9A 4R2QA 2EL4A 4B3SE 2B7VA 2EPKX 1SFEA 2LO3A 4O43A 5AE1A 4JI1E 2CPNA 2R76A 1KJKA 2ENCA 1YYWA 2UXBE 2MKDA 3JU0A 1JK1A 2EPCA 4LTYA 4YHHE 3KWRA 4HTGA 4ZYHA 1YUJA 4X62E 1P47A 2RQLA 3HPSA 5DNYA 4F6NA 5KL2A 2EM0A 4M2ZA 1X47A 4DV1E 2L3JA 3MHSC 1A1FA 5CFFE 2JR1A 2CSHA 3L00A 2EPUA 1QNTA 3OTOE 1T4OA 3EQ1A 1T39A 4WSPA 4B3ME 4DUZE 3BF2A 4DR3E 1ZBTA 2EMLA 3VYXA 2NUEA 2DIXA 2N3HA 2EPXA 5IXMB 1N32E 2MDRA 1YFHA 2EN4A 1N3GA 5BR8E 4F6MA 4WXCA 4RH8A 2UUAE 2V8QB 4DR1E 5AASA 3HQ1A 4Q35B 4BHBA 2EPPA 4DR2E 2EN3A 2GHFA 2LCEA 2K7IA 2V89A 2B9DA 3C6MA 2YTGA 3LMLA 2EMFA 2L2KB 4X64E 2WZOA 4WXDA 4F9BB 2EM5A 2EOFA 3QG5C 1BBGA 1WRJA 3ADJA 5KL5A 1X6HA 4MLQA 2RPCA 2EJ4A 2L3CA 3HPZA 1HNWE 2YU5A 1PJSA 3J7Yp 2EQ1A 4LF9E 5ADZA 1DQ3A 4NZVA 2YU8A 2CT1A 2HHHE 1LLMC 2JXPA 4L5NC 1X49A 2BB8A 3JTZA 1TF3A 5IV8B 2EN8A 4BC9A 3F6GA 2EOHA 5AC5A 5KL4A 2LVHA 1G2FC 1STUA 2LBSB 2KONA 4R8OA 4BC7A 2L8TA 4F54A 2YSOA 3T1YE 1IBLE 2MC6A 1TF6A 4LF6E 3HXLA 2EPRA 3J81C 2VQFE 2G7HA 1WXRA 1WHQA 1HNZE 1NCSA 2Q8UA 4LFCE 2EM3A 2EPMX 1ZBQA 1NEIA 2H36X 2EOJA 1XMOE 2UUBE 3OMLA 2EQ3A 2LMZA 4WPYA 4RHBB 1ZAAC 1RMDA 2EPZA 4GKKE 2M1SA 1A1GA 1N36E 4OOGC 2KOUA 1GTKA 2E5LE 2YZTA 4YY3E 2EOOA 2HGHA 2E72A 5A6BA 1A1KA 5LL6R 2VRDA 1IBKE 4LFAE 2EM9A 1KYQA 1ZU1A 4BS9A 2L2NA 1IQSA 3BIDA 3J80C 2ODRC 4WFTA 3J7AG 1UBDC 3UK3C 5A69A 2V87A 2YTDA 3VK6A 4ZYDA 4M9VC 4TUIA 4BMJA 2EOYA 1ZR9A 5AC4A 2EQ0A 4Q28A 2EOZA 2R1FA 4DV5E 2LRSA 5TSEA 4DR5E 4BHCA 2EM8A 4WX9A 3THOB 1F2IG 2EN7A 5KL3A 2NUFA 2JVAA 3DJWA 2L6MA 2BBGA 4JI8E 1XNQE 3ADGA 5AE3A 2DB2A 1N33E 2EMYA 2DGCA 1DI2A 2EL5A 1SR9A 2RS7A 4N4RB 2GPIA 2RTXA 1HNXE 2YRKA 4LF8E 2EOQA 3C4BA 2EZ6A 1X3CA 2V88A 2VE7C 3EPHA 4IJDA 1PKPA 2EM4A 2A25A 2EN6A 1RQ0A 2V85A 3C4TA 2EOIA 4LFBE 1X6FA 3MSWA 1HR0E 2HJJA 2EOSA 2FGGA 2LTSA 4KZSA 4NXME 2WBTA 2EMHA 3AUZA 2YWQA 2LE2A 1UILA 3MHHC 4MLVA 4P78A 2ELZA 2FV4B 5A6KA 3THNA 4L8NA 1X48A 2UU9E 4GEQB 1J5EE 2JOBA 2HC5A 4KHPE 5F3WA 3ADLA 3VYYA 5LMNE 2EP3A 4R2DA 2MKNA 2D9HA 4DV2E 3ECRA 2GLIA 2EOMA 1MGTA 4R2RA 2L92A 4X65E 4LF4E 1AAYA 4B3RE 4WYQB 4R2CA 1YPNA 1EH8A 2L33A 4JI6E 1T4NA 5FLXC 2YTIA 2ENAA 2NABA 2JPAA 4WSGA 2F4VE 2EM6A 2DSYA 4JI0E 3JAMC 2YTOA 4DUYE 2EPNA 2MDGA 1I94E 2ODRD 2MC5A 2JP9A 3H09A 2RSIA 2KHXA 2ADRA 3K6QA 2ENHA 2DLKA 2N3GA 1YUIA 4GZNC 2YRMA 3M99B 2EM7A 3ZOQB 2EMKA 4ZYGA 2EM2A 1YSAC 3EPLA 1EKZA 4BBYA 1GZ6A 4R03A 2EE8A 3IWCA 2JYAA 5A6JA 1XNRE 4JYAE 4R2SA 2EMXA 5A2QC 1PJQA 2B3TB 2YTJA 4B3TE 1L4SA 2JY9A 4DV6E 1IBME 3BGHA 4HEIA 1X5WA 4DMIA 2EMIA 3EPKA 2LUPB 2LT7A 2CTDA 2EOEA 1UHZA 2YRHA 4DV7E 1Z1BA 1XMQE 2LTRA 5IWAE 3BBGA 4NHRA 4P7DA 2ELYA 4J8ZA 1FKAE 1UN6B 4JI5E 1A1HA 4GKJE 1GQEA 2EN2A 4LF7E 2J7JA 3ADIA 3IWBA 5IT9C 3LLHA 4R2EA 4DR4E 1YYKA 2JWOA 3KZZA 1JK2A 2ZM6E 1O0WA 1WHNA 3F6HA 2DRPA 4OX9E 1B69A 2RSMA 1X6EA 4ZYEA 2EPAA 3P1XA 4R2PA 4AQYE 2EPOA 4X8WA 2YTEA 2M4IA 1G2DC 4JI3E 1RC7A 2FTXB 2UXDE 1EH6A 2DMYA 1YYOA 3VHTB 2EMWA 5KL7A 4JI2E 2YTFA 3IWDA 2EMBA 3FIGA 1MEYC 2JOXA 4I8OA 2EL6A 4F9CB 4K0KE 4M0VA 4JI7E 2PRTA 1AH5A 1N34E 2NUGA 2YSPA 2LJHA 4F9AB 4R2AA 1IMUA 4F2JC 2EORA 1TN9A 2EMGA 2I13A 2I9IA 3T1HE 1A1IA 1WJPA 1YZ9A 4O24A 2L2MA 3AV0A 3EPJA 1PDAA 2WBSA 2LJUA 1PJTA 1QU6A 2VF1A 4JI4E 1FJGE 5AE2A 4KWYA 2B7TA 5KL6A 2K4VA 2YTNA 3RMPA 2UXCE 4X9JA 2IHR1 2EPLX 5A6AA 1BB8A 2EMCA 4DV4E 1EH7A 2WCC3 2YT4A 2EOXA 4BCAA 1T4LB 2F8BA 1IQOA 4O4KA 5A6BD 4M30A 1A1LA 4NXNE 4FK5C 2DMIA 2VQEE 4DV0E 2EMAA 2RS6A
chains in the Genus database with same CATH topology
5KL5A 1BBOA 1X5WA 1X6HA 3EPKA 2EMIA 2RPCA 2YRKA 2EN1A 2EOQA 2LT7A 1X3CA 2CTDA 2EJ4A 2EOEA 2LV2A 2YTQA 2YRHA 2YU5A 1Z1BA 2EQ1A 3EPHA 4IJDA 2ELYA 2M9AA 2YTPA 2EM4A 1UN6B 2A25A 2YU8A 2EN6A 1A1HA 2CT1A 1LLMC 2DLQA 2EN2A 2J7JA 2BB8A 2EOIA 4R2EA 1TF3A 2WBUA 2EN8A 1JK2A 4IS1C 2EMZA 1X6FA 2EOHA 5KL4A 2LVHA 2EOSA 1G2FC 2DRPA 2WBTA 2EMHA 1B69A 1X6EA 2EPAA 1A1JA 4R2PA 1DGCA 3MHHC 2ELZA 2YSOA 4R2QA 2EL4A 2YTEA 1TF6A 1G2DC 2EPRA 2LO3A 3VHTB 1NCSA 2EMWA 5KL7A 2EM3A 2EP3A 2YTFA 4R2DA 2MKNA 2EOJA 2D9HA 2EMBA 1KJKA 2ENCA 2GLIA 2EOMA 2MKDA 4R2RA 1MEYC 1JK1A 2EPCA 2EL6A 2EQ3A 1AAYA 1YUJA 1P47A 4R2CA 2EPZA 1RMDA 1ZAAC 2PRTA 4F6NA 2YSPA 5KL2A 2EM0A 1A1GA 4R2AA 2YTIA 2ENAA 4F2JC 3MHSC 1A1FA 2EOOA 2NABA 2EORA 2JPAA 1TN9A 2CSHA 4WSGA 2EMGA 2E72A 2HGHA 2I13A 1A1KA 2EPUA 2EM6A 2VRDA 1A1IA 1WJPA 2EM9A 2YTOA 1ZU1A 3EPJA 2MDGA 2WBSA 2EMLA 2EPXA 2JP9A 1UBDC 5KL6A 2EN4A 2RSIA 3UK3C 4F6MA 2ADRA 2YTDA 2ENHA 2DLKA 2YTNA 1YUIA 4M9VC 4X9JA 4GZNC 2EOYA 2YRMA 1ZR9A 2EQ0A 2EM7A 3M99B 2EMKA 2EPPA 2EOZA 2R1FA 2EMCA 1BB8A 2EM2A 2WCC3 1YSAC 3EPLA 2EM8A 2EN3A 2EOXA 2GHFA 2LCEA 2EE8A 1F2IG 2YTGA 2EN7A 2EMFA 5KL3A 1A1LA 4R2SA 2EMYA 2EMXA 4FK5C 2DMIA 2DGCA 2EM5A 2EL5A 2EOFA 2YTJA 2EMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KL5 A;  1BBO A;  1X5W A;  1X6H A;  3EPK A;  2EMI A;  2RPC A;  2YRK A;  2EN1 A;  2EOQ A;  2LT7 A;  1X3C A;  2CTD A;  2EJ4 A;  2EOE A;  2LV2 A;  2YTQ A;  2YRH A;  2YU5 A;  1Z1B A;  2EQ1 A;  3EPH A;  4IJD A;  2ELY A;  2M9A A;  2YTP A;  2EM4 A;  1UN6 B;  2A25 A;  2YU8 A;  2EN6 A;  1A1H A;  2CT1 A;  1LLM C;  2DLQ A;  2EN2 A;  2J7J A;  2BB8 A;  2EOI A;  4R2E A;  1TF3 A;  2WBU A;  2EN8 A;  1JK2 A;  4IS1 C;  2EMZ A;  1X6F A;  2EOH A;  5KL4 A;  2LVH A;  2EOS A;  1G2F C;  2DRP A;  2WBT A;  2EMH A;  1B69 A;  1X6E A;  2EPA A;  1A1J A;  4R2P A;  1DGC A;  3MHH C;  2ELZ A;  2YSO A;  4R2Q A;  2EL4 A;  2YTE A;  1TF6 A;  1G2D C;  2EPR A;  2LO3 A;  3VHT B;  1NCS A;  2EMW A;  5KL7 A;  2EM3 A;  2EP3 A;  2YTF A;  4R2D A;  2MKN A;  2EOJ A;  2D9H A;  2EMB A;  1KJK A;  2ENC A;  2GLI A;  2EOM A;  2MKD A;  4R2R A;  1MEY C;  1JK1 A;  2EPC A;  2EL6 A;  2EQ3 A;  1AAY A;  1YUJ A;  1P47 A;  4R2C A;  2EPZ A;  1RMD A;  1ZAA C;  2PRT A;  4F6N A;  2YSP A;  5KL2 A;  2EM0 A;  1A1G A;  4R2A A;  2YTI A;  2ENA A;  4F2J C;  3MHS C;  1A1F A;  2EOO A;  2NAB A;  2EOR A;  2JPA A;  1TN9 A;  2CSH A;  4WSG A;  2EMG A;  2E72 A;  2HGH A;  2I13 A;  1A1K A;  2EPU A;  2EM6 A;  2VRD A;  1A1I A;  1WJP A;  2EM9 A;  2YTO A;  1ZU1 A;  3EPJ A;  2MDG A;  2WBS A;  2EML A;  2EPX A;  2JP9 A;  1UBD C;  5KL6 A;  2EN4 A;  2RSI A;  3UK3 C;  4F6M A;  2ADR A;  2YTD A;  2ENH A;  2DLK A;  2YTN A;  1YUI A;  4M9V C;  4X9J A;  4GZN C;  2EOY A;  2YRM A;  1ZR9 A;  2EQ0 A;  2EM7 A;  3M99 B;  2EMK A;  2EPP A;  2EOZ A;  2R1F A;  2EMC A;  1BB8 A;  2EM2 A;  2WCC 3;  1YSA C;  3EPL A;  2EM8 A;  2EN3 A;  2EOX A;  2GHF A;  2LCE A;  2EE8 A;  1F2I G;  2YTG A;  2EN7 A;  2EMF A;  5KL3 A;  1A1L A;  4R2S A;  2EMY A;  2EMX A;  4FK5 C;  2DMI A;  2DGC A;  2EM5 A;  2EL5 A;  2EOF A;  2YTJ A;  2EMA A; 
#chains in the Genus database with same CATH topology
 2YPN A;  1BBO A;  4LF5 E;  2M7Q A;  5T6J A;  2UUC E;  2EN1 A;  3TQM A;  2EWL A;  2LV2 A;  2YTQ A;  3KZY A;  4X66 E;  3C6K A;  1J26 A;  2M9A A;  2N8X A;  2YTP A;  2E1M A;  2DLQ A;  3DF6 A;  3HTX A;  2NA2 A;  5LMU E;  4DV3 E;  2V86 A;  4O5G A;  2WBU A;  2V83 A;  4DKK A;  4IS1 C;  2EMZ A;  4JV5 E;  4DR6 E;  1T38 A;  4DR7 E;  2LUQ A;  4TUG A;  1A1J A;  1DGC A;  5LLQ A;  4LU9 A;  4R2Q A;  2EL4 A;  4B3S E;  2B7V A;  2EPK X;  1SFE A;  2LO3 A;  4O43 A;  5AE1 A;  4JI1 E;  2CPN A;  2R76 A;  1KJK A;  2ENC A;  1YYW A;  2UXB E;  2MKD A;  3JU0 A;  1JK1 A;  2EPC A;  4LTY A;  4YHH E;  3KWR A;  4HTG A;  4ZYH A;  1YUJ A;  4X62 E;  1P47 A;  2RQL A;  3HPS A;  5DNY A;  4F6N A;  5KL2 A;  2EM0 A;  4M2Z A;  1X47 A;  4DV1 E;  2L3J A;  3MHS C;  1A1F A;  5CFF E;  2JR1 A;  2CSH A;  3L00 A;  2EPU A;  1QNT A;  3OTO E;  1T4O A;  3EQ1 A;  1T39 A;  4WSP A;  4B3M E;  4DUZ E;  3BF2 A;  4DR3 E;  1ZBT A;  2EML A;  3VYX A;  2NUE A;  2DIX A;  2N3H A;  2EPX A;  5IXM B;  1N32 E;  2MDR A;  1YFH A;  2EN4 A;  1N3G A;  5BR8 E;  4F6M A;  4WXC A;  4RH8 A;  2UUA E;  2V8Q B;  4DR1 E;  5AAS A;  3HQ1 A;  4Q35 B;  4BHB A;  2EPP A;  4DR2 E;  2EN3 A;  2GHF A;  2LCE A;  2K7I A;  2V89 A;  2B9D A;  3C6M A;  2YTG A;  3LML A;  2EMF A;  2L2K B;  4X64 E;  2WZO A;  4WXD A;  4F9B B;  2EM5 A;  2EOF A;  3QG5 C;  1BBG A;  1WRJ A;  3ADJ A;  5KL5 A;  1X6H A;  4MLQ A;  2RPC A;  2EJ4 A;  2L3C A;  3HPZ A;  1HNW E;  2YU5 A;  1PJS A;  3J7Y p;  2EQ1 A;  4LF9 E;  5ADZ A;  1DQ3 A;  4NZV A;  2YU8 A;  2CT1 A;  2HHH E;  1LLM C;  2JXP A;  4L5N C;  1X49 A;  2BB8 A;  3JTZ A;  1TF3 A;  5IV8 B;  2EN8 A;  4BC9 A;  3F6G A;  2EOH A;  5AC5 A;  5KL4 A;  2LVH A;  1G2F C;  1STU A;  2LBS B;  2KON A;  4R8O A;  4BC7 A;  2L8T A;  4F54 A;  2YSO A;  3T1Y E;  1IBL E;  2MC6 A;  1TF6 A;  4LF6 E;  3HXL A;  2EPR A;  3J81 C;  2VQF E;  2G7H A;  1WXR A;  1WHQ A;  1HNZ E;  1NCS A;  2Q8U A;  4LFC E;  2EM3 A;  2EPM X;  1ZBQ A;  1NEI A;  2H36 X;  2EOJ A;  1XMO E;  2UUB E;  3OML A;  2EQ3 A;  2LMZ A;  4WPY A;  4RHB B;  1ZAA C;  1RMD A;  2EPZ A;  4GKK E;  2M1S A;  1A1G A;  1N36 E;  4OOG C;  2KOU A;  1GTK A;  2E5L E;  2YZT A;  4YY3 E;  2EOO A;  2HGH A;  2E72 A;  5A6B A;  1A1K A;  5LL6 R;  2VRD A;  1IBK E;  4LFA E;  2EM9 A;  1KYQ A;  1ZU1 A;  4BS9 A;  2L2N A;  1IQS A;  3BID A;  3J80 C;  2ODR C;  4WFT A;  3J7A G;  1UBD C;  3UK3 C;  5A69 A;  2V87 A;  2YTD A;  3VK6 A;  4ZYD A;  4M9V C;  4TUI A;  4BMJ A;  2EOY A;  1ZR9 A;  5AC4 A;  2EQ0 A;  4Q28 A;  2EOZ A;  2R1F A;  4DV5 E;  2LRS A;  5TSE A;  4DR5 E;  4BHC A;  2EM8 A;  4WX9 A;  3THO B;  1F2I G;  2EN7 A;  5KL3 A;  2NUF A;  2JVA A;  3DJW A;  2L6M A;  2BBG A;  4JI8 E;  1XNQ E;  3ADG A;  5AE3 A;  2DB2 A;  1N33 E;  2EMY A;  2DGC A;  1DI2 A;  2EL5 A;  1SR9 A;  2RS7 A;  4N4R B;  2GPI A;  2RTX A;  1HNX E;  2YRK A;  4LF8 E;  2EOQ A;  3C4B A;  2EZ6 A;  1X3C A;  2V88 A;  2VE7 C;  3EPH A;  4IJD A;  1PKP A;  2EM4 A;  2A25 A;  2EN6 A;  1RQ0 A;  2V85 A;  3C4T A;  2EOI A;  4LFB E;  1X6F A;  3MSW A;  1HR0 E;  2HJJ A;  2EOS A;  2FGG A;  2LTS A;  4KZS A;  4NXM E;  2WBT A;  2EMH A;  3AUZ A;  2YWQ A;  2LE2 A;  1UIL A;  3MHH C;  4MLV A;  4P78 A;  2ELZ A;  2FV4 B;  5A6K A;  3THN A;  4L8N A;  1X48 A;  2UU9 E;  4GEQ B;  1J5E E;  2JOB A;  2HC5 A;  4KHP E;  5F3W A;  3ADL A;  3VYY A;  5LMN E;  2EP3 A;  4R2D A;  2MKN A;  2D9H A;  4DV2 E;  3ECR A;  2GLI A;  2EOM A;  1MGT A;  4R2R A;  2L92 A;  4X65 E;  4LF4 E;  1AAY A;  4B3R E;  4WYQ B;  4R2C A;  1YPN A;  1EH8 A;  2L33 A;  4JI6 E;  1T4N A;  5FLX C;  2YTI A;  2ENA A;  2NAB A;  2JPA A;  4WSG A;  2F4V E;  2EM6 A;  2DSY A;  4JI0 E;  3JAM C;  2YTO A;  4DUY E;  2EPN A;  2MDG A;  1I94 E;  2ODR D;  2MC5 A;  2JP9 A;  3H09 A;  2RSI A;  2KHX A;  2ADR A;  3K6Q A;  2ENH A;  2DLK A;  2N3G A;  1YUI A;  4GZN C;  2YRM A;  3M99 B;  2EM7 A;  3ZOQ B;  2EMK A;  4ZYG A;  2EM2 A;  1YSA C;  3EPL A;  1EKZ A;  4BBY A;  1GZ6 A;  4R03 A;  2EE8 A;  3IWC A;  2JYA A;  5A6J A;  1XNR E;  4JYA E;  4R2S A;  2EMX A;  5A2Q C;  1PJQ A;  2B3T B;  2YTJ A;  4B3T E;  1L4S A;  2JY9 A;  4DV6 E;  1IBM E;  3BGH A;  4HEI A;  1X5W A;  4DMI A;  2EMI A;  3EPK A;  2LUP B;  2LT7 A;  2CTD A;  2EOE A;  1UHZ A;  2YRH A;  4DV7 E;  1Z1B A;  1XMQ E;  2LTR A;  5IWA E;  3BBG A;  4NHR A;  4P7D A;  2ELY A;  4J8Z A;  1FKA E;  1UN6 B;  4JI5 E;  1A1H A;  4GKJ E;  1GQE A;  2EN2 A;  4LF7 E;  2J7J A;  3ADI A;  3IWB A;  5IT9 C;  3LLH A;  4R2E A;  4DR4 E;  1YYK A;  2JWO A;  3KZZ A;  1JK2 A;  2ZM6 E;  1O0W A;  1WHN A;  3F6H A;  2DRP A;  4OX9 E;  1B69 A;  2RSM A;  1X6E A;  4ZYE A;  2EPA A;  3P1X A;  4R2P A;  4AQY E;  2EPO A;  4X8W A;  2YTE A;  2M4I A;  1G2D C;  4JI3 E;  1RC7 A;  2FTX B;  2UXD E;  1EH6 A;  2DMY A;  1YYO A;  3VHT B;  2EMW A;  5KL7 A;  4JI2 E;  2YTF A;  3IWD A;  2EMB A;  3FIG A;  1MEY C;  2JOX A;  4I8O A;  2EL6 A;  4F9C B;  4K0K E;  4M0V A;  4JI7 E;  2PRT A;  1AH5 A;  1N34 E;  2NUG A;  2YSP A;  2LJH A;  4F9A B;  4R2A A;  1IMU A;  4F2J C;  2EOR A;  1TN9 A;  2EMG A;  2I13 A;  2I9I A;  3T1H E;  1A1I A;  1WJP A;  1YZ9 A;  4O24 A;  2L2M A;  3AV0 A;  3EPJ A;  1PDA A;  2WBS A;  2LJU A;  1PJT A;  1QU6 A;  2VF1 A;  4JI4 E;  1FJG E;  5AE2 A;  4KWY A;  2B7T A;  5KL6 A;  2K4V A;  2YTN A;  3RMP A;  2UXC E;  4X9J A;  2IHR 1;  2EPL X;  5A6A A;  1BB8 A;  2EMC A;  4DV4 E;  1EH7 A;  2WCC 3;  2YT4 A;  2EOX A;  4BCA A;  1T4L B;  2F8B A;  1IQO A;  4O4K A;  5A6B D;  4M30 A;  1A1L A;  4NXN E;  4FK5 C;  2DMI A;  2VQE E;  4DV0 E;  2EMA A;  2RS6 A; 
#chains in the Genus database with same CATH homology
 5KL5 A;  1BBO A;  1X5W A;  1X6H A;  3EPK A;  2EMI A;  2RPC A;  2YRK A;  2EN1 A;  2EOQ A;  2LT7 A;  1X3C A;  2CTD A;  2EJ4 A;  2EOE A;  2LV2 A;  2YTQ A;  2YRH A;  2YU5 A;  1Z1B A;  2EQ1 A;  3EPH A;  4IJD A;  2ELY A;  2M9A A;  2YTP A;  2EM4 A;  1UN6 B;  2A25 A;  2YU8 A;  2EN6 A;  1A1H A;  2CT1 A;  1LLM C;  2DLQ A;  2EN2 A;  2J7J A;  2BB8 A;  2EOI A;  4R2E A;  1TF3 A;  2WBU A;  2EN8 A;  1JK2 A;  4IS1 C;  2EMZ A;  1X6F A;  2EOH A;  5KL4 A;  2LVH A;  2EOS A;  1G2F C;  2DRP A;  2WBT A;  2EMH A;  1B69 A;  1X6E A;  2EPA A;  1A1J A;  4R2P A;  1DGC A;  3MHH C;  2ELZ A;  2YSO A;  4R2Q A;  2EL4 A;  2YTE A;  1TF6 A;  1G2D C;  2EPR A;  2LO3 A;  3VHT B;  1NCS A;  2EMW A;  5KL7 A;  2EM3 A;  2EP3 A;  2YTF A;  4R2D A;  2MKN A;  2EOJ A;  2D9H A;  2EMB A;  1KJK A;  2ENC A;  2GLI A;  2EOM A;  2MKD A;  4R2R A;  1MEY C;  1JK1 A;  2EPC A;  2EL6 A;  2EQ3 A;  1AAY A;  1YUJ A;  1P47 A;  4R2C A;  2EPZ A;  1RMD A;  1ZAA C;  2PRT A;  4F6N A;  2YSP A;  5KL2 A;  2EM0 A;  1A1G A;  4R2A A;  2YTI A;  2ENA A;  4F2J C;  3MHS C;  1A1F A;  2EOO A;  2NAB A;  2EOR A;  2JPA A;  1TN9 A;  2CSH A;  4WSG A;  2EMG A;  2E72 A;  2HGH A;  2I13 A;  1A1K A;  2EPU A;  2EM6 A;  2VRD A;  1A1I A;  1WJP A;  2EM9 A;  2YTO A;  1ZU1 A;  3EPJ A;  2MDG A;  2WBS A;  2EML A;  2EPX A;  2JP9 A;  1UBD C;  5KL6 A;  2EN4 A;  2RSI A;  3UK3 C;  4F6M A;  2ADR A;  2YTD A;  2ENH A;  2DLK A;  2YTN A;  1YUI A;  4M9V C;  4X9J A;  4GZN C;  2EOY A;  2YRM A;  1ZR9 A;  2EQ0 A;  2EM7 A;  3M99 B;  2EMK A;  2EPP A;  2EOZ A;  2R1F A;  2EMC A;  1BB8 A;  2EM2 A;  2WCC 3;  1YSA C;  3EPL A;  2EM8 A;  2EN3 A;  2EOX A;  2GHF A;  2LCE A;  2EE8 A;  1F2I G;  2YTG A;  2EN7 A;  2EMF A;  5KL3 A;  1A1L A;  4R2S A;  2EMY A;  2EMX A;  4FK5 C;  2DMI A;  2DGC A;  2EM5 A;  2EL5 A;  2EOF A;  2YTJ A;  2EMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...