2EOEA

Solution structure of the c2h2 type zinc finger (region 508-540) of human zinc finger protein 347
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYKCNECGKVFTQNSHLANHQRIHTGVKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 508-540) of human Zinc finger protein 347
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 347
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eoeA01
2YU5A 2EM8A 2EMWA 2EPRA 2J7JA 2GLIA 2EPZA 1NCSA 2JPAA 2WBUA 1RMDA 2EOHA 2MKNA 2LO3A 2JP9A 3EPHA 1BB8A 4F2JC 2EMZA 1TF3A 2ENAA 1WJPA 2LV2A 2E72A 2PRTA 1AAYA 1X6FA 2YRMA 4R2AA 4R2QA 2DMIA 5KL3A 2EN7A 1MEYC 2EMXA 4R2DA 1A1HA 2EOZA 2M9AA 1X6HA 4R2CA 2EPUA 1YUJA 4R2EA 2EOJA 2EE8A 1X5WA 2YTIA 2YRKA 3MHSC 3EPJA 3UK3C 1Z1BA 2DGCA 2BB8A 2ELZA 2EMAA 2I13A 2EOMA 1A1LA 2HGHA 2YSOA 2EN8A 2EOSA 1YUIA 2EMKA 4R2SA 2EM9A 2YTGA 3MHHC 4IJDA 2EMLA 1F2IG 2DLKA 2EPXA 2EPPA 2YTPA 4M9VC 2GHFA 2EQ0A 2EMHA 2EOXA 2R1FA 1UBDC 1TF6A 2EM5A 2EN4A 4IS1C 2EMBA 2EOYA 2EM4A 2NABA 2EJ4A 2A25A 4X9JA 1ZR9A 4WSGA 1G2DC 2MDGA 2YRHA 2EOFA 2WCC3 2ENHA 2EMGA 1X3CA 2ENCA 2YTEA 4F6NA 5KL2A 1B69A 2EP3A 2EM6A 2EORA 2WBTA 4F6MA 1G2FC 3EPKA 2EM2A 2YTJA 2EM0A 2EL6A 2EPAA 4R2RA 2EM3A 5KL5A 2EQ1A 2RPCA 2YTOA 2CSHA 1X6EA 2YU8A 1BBOA 2EM7A 2EOOA 2ELYA 2EPCA 2EMFA 2EOEA 1JK2A 2YTNA 1A1KA 1A1IA 2EL4A 1A1FA 2VRDA 2LT7A 2EOQA 3VHTB 1P47A 3EPLA 2LVHA 3M99B 2EN2A 2MKDA 2WBSA 2ADRA 2YSPA 5KL6A 2YTDA 1A1JA 2EN3A 2LCEA 5KL4A 2EN6A 1TN9A 2YTQA 2DLQA 2EQ3A 2EL5A 2EMYA 1ZU1A 1ZAAC 2EMIA 1DGCA 4GZNC 2EMCA 1KJKA 2EOIA 4R2PA 2CT1A 4FK5C 1YSAC 1LLMC 5KL7A 2DRPA 1JK1A 2RSIA 2CTDA 2YTFA 1UN6B 2EN1A 1A1GA 2D9HA
chains in the Genus database with same CATH superfamily
3KZYA 1X47A 2J7JA 4BHCA 2WBUA 2E1MA 1RMDA 2EOHA 2MKNA 2N3HA 4JYAE 3EPHA 2VF1A 2HJJA 2KOUA 4DV4E 5ADZA 2WZOA 4Q35B 2PRTA 1X6FA 4R2QA 4R2DA 4GKKE 4DR2E 4R2CA 1HNXE 2EPKX 2G7HA 1FJGE 2EOJA 2EE8A 2YTIA 3TQMA 2L3CA 1Z1BA 2DGCA 4BCAA 4JI7E 2ELZA 2EMAA 4NZVA 4OX9E 1T4OA 4JI4E 2UXDE 2EN8A 4X8WA 3MHHC 2LUPB 2DLKA 1X49A 2YTPA 3ADLA 2FV4B 2EMHA 2R1FA 4O24A 3J80C 1TF6A 2HHHE 2EM5A 5A6KA 1DQ3A 2K7IA 3J7Yp 3KZZA 4IS1C 2RTXA 2EMBA 2NABA 2IHR1 4ZYHA 2LMZA 2EJ4A 3OMLA 2UXBE 4WSGA 4KHPE 3BIDA 2EOFA 4DR3E 3VYXA 2WCC3 2EMGA 2YTEA 4R8OA 1B69A 1T4LB 4F9CB 3EPKA 2EM2A 5A6BA 4DR1E 2EM3A 4P7DA 2RS6A 1WXRA 2YU8A 1KYQA 2EM7A 1EH7A 2ODRD 2YTNA 1A1IA 1EH6A 1QU6A 3F6HA 2E5LE 2LT7A 2EOQA 2Q8UA 3M99B 2JYAA 2EN2A 3HPSA 2ADRA 5KL6A 1YYOA 1UILA 2V89A 4X62E 5IV8B 1WHNA 5KL4A 2EL5A 2B7VA 2EMIA 2M1SA 4GZNC 2JOXA 2EMCA 1KJKA 3JTZA 2LBSB 1EH8A 2CT1A 2LUQA 4BMJA 2N3GA 2L2MA 4L8NA 2LTRA 2CTDA 3ADIA 5A6BD 4MLVA 2EM8A 2EMWA 4O5GA 4N4RB 1NCSA 2UUCE 4NXNE 1PJSA 2DIXA 3ADGA 1J5EE 2LTSA 2B7TA 1T38A 1IMUA 2VQFE 3KWRA 4WFTA 1AAYA 4R2AA 2DMIA 1A1HA 2EOZA 4KWYA 1RQ0A 4TUGA 5IXMB 2L8TA 3OTOE 3THNA 1YUJA 5IT9C 4DV5E 1N3GA 3UK3C 1X5WA 3ADJA 4TUIA 2BB8A 2I13A 2EOMA 1A1LA 4M30A 1J26A 2HGHA 2ZM6E 4DR5E 4NXME 2RSMA 2EPMX 1YPNA 4X66E 2EOSA 5LLQA 1X48A 4IJDA 4DR7E 2EMLA 5A2QC 2DB2A 2EPXA 4DMIA 4GEQB 1IBME 4JI5E 4LTYA 4DV6E 3QG5C 4DV2E 1EKZA 4M9VC 4WX9A 2GHFA 2EQ0A 4DV3E 2EOXA 4MLQA 2EN4A 2V88A 3JAMC 2LJHA 4KZSA 1STUA 1WRJA 2EOYA 4DR6E 2A25A 1G2DC 2V87A 2MDGA 4M0VA 2ENHA 1X3CA 2ENCA 4DKKA 2L6MA 5KL2A 2M7QA 2YTJA 4DV1E 4X65E 2EPAA 3JU0A 2CSHA 1X6EA 1IBLE 2YT4A 1BBOA 4Q28A 2ELYA 5A6JA 2EPCA 2B3TB 4P78A 2EOEA 1JK2A 3T1HE 2K4VA 4RHBB 2EL4A 4F54A 5F3WA 4BC9A 4LF5E 3IWDA 4LF6E 2H36X 1P47A 3EPLA 1T4NA 4JV5E 2NA2A 2YTDA 5DNYA 5AASA 2EQ3A 2EMYA 2DSYA 1GZ6A 1YYKA 3THOB 2EOIA 1L4SA 1HNZE 2JWOA 4O4KA 4WXDA 1YSAC 1GQEA 2JY9A 5KL7A 2DRPA 2RSIA 3BGHA 3L00A 2YTFA 1XMQE 3P1XA 1WHQA 2V86A 3J7AG 1A1GA 2YU5A 2GLIA 4DUZE 2JPAA 2LJUA 5T6JA 4F2JC 4BS9A 2KHXA 2EMZA 4GKJE 1WJPA 1I94E 2NUFA 2LV2A 4DUYE 1PJQA 1XMOE 2MDRA 3FIGA 4LF8E 2EN7A 3H09A 4NHRA 2JVAA 4JI2E 4LF7E 2M9AA 2EPUA 3VYYA 2CPNA 4WSPA 2YRKA 4WYQB 4LFBE 2VE7C 2KONA 1IBKE 2BBGA 1RC7A 1YUIA 2EMKA 2JXPA 3IWBA 2EM9A 2YTGA 3F6GA 5LL6R 2LE2A 5AC5A 4LF4E 2UUAE 3LLHA 1YYWA 1O0WA 5FLXC 3HQ1A 3VK6A 2I9IA 3T1YE 1IQOA 2N8XA 1GTKA 2YRHA 4AQYE 1T39A 4YHHE 2EZ6A 1QNTA 4F6NA 4HTGA 2EP3A 1HR0E 4B3TE 2EORA 3AV0A 2EM0A 3C6MA 4R2RA 1XNQE 4WPYA 3AUZA 5KL5A 2ODRC 4DV0E 2RPCA 2YTOA 4M2ZA 3ZOQB 3HPZA 1N32E 4LFAE 4HEIA 1BBGA 1N36E 4YY3E 4B3ME 1A1FA 2L3JA 2HC5A 2LVHA 4WXCA 3ECRA 4JI1E 2YPNA 2WBSA 2YSPA 2YWQA 1ZBTA 2EPLX 2EN3A 4F9AB 2F4VE 2NUEA 4JI0E 1TN9A 2YTQA 4DR4E 3EQ1A 2DLQA 3MSWA 3HTXA 1HNWE 1ZU1A 1DGCA 2EWLA 4R03A 1PDAA 1AH5A 4O43A 3C4BA 4R2PA 2UU9E 4ZYEA 1LLMC 2GPIA 1JK1A 2UXCE 1UN6B 5A6AA 1UHZA 1PJTA 1IQSA 4OOGC 4LU9A 2EPRA 4L5NC 4ZYDA 2EPZA 4F9BB 1YZ9A 2LO3A 2JP9A 1BB8A 4BC7A 1N34E 1TF3A 2ENAA 1YFHA 1ZBQA 4LFCE 2JR1A 2EPOA 3RMPA 2L2NA 2E72A 1MEYC 2YRMA 5KL3A 2UUBE 2EMXA 2L2KB 4JI3E 3DF6A 3J81C 5AC4A 5BR8E 1X6HA 5AE2A 1FKAE 1XNRE 4B3RE 5LMUE 2V8QB 4R2EA 4X64E 2B9DA 5TSEA 2EPNA 3EPJA 1MGTA 3MHSC 4BHBA 4B3SE 2YSOA 2DMYA 2R76A 1NEIA 4R2SA 2V83A 1F2IG 2EPPA 2FGGA 5AE1A 1SR9A 2FTXB 3DJWA 3K6QA 1UBDC 1PKPA 2L33A 3C4TA 4I8OA 5LMNE 5IWAE 2EM4A 2LRSA 4X9JA 1ZR9A 2MC6A 4JI8E 5CFFE 3C6KA 2MC5A 2JOBA 3HXLA 4J8ZA 4LF9E 3IWCA 2NUGA 4ZYGA 2EM6A 2WBTA 4F6MA 1G2FC 1N33E 2VQEE 2EL6A 2EQ1A 5AE3A 4JI6E 1DI2A 2EOOA 2EMFA 2YZTA 1A1KA 2V85A 2VRDA 2F8BA 3VHTB 2MKDA 3BF2A 2L92A 1A1JA 4DV7E 2LCEA 2EN6A 5A69A 3BBGA 1ZAAC 3LMLA 2M4IA 1SFEA 2RQLA 4K0KE 4FK5C 4RH8A 2RS7A 2EN1A 4BBYA 2D9HA
chains in the Genus database with same CATH topology
2YU5A 2EM8A 2EMWA 2EPRA 2J7JA 2GLIA 2EPZA 1NCSA 2JPAA 2WBUA 1RMDA 2EOHA 2MKNA 2LO3A 2JP9A 3EPHA 1BB8A 4F2JC 2EMZA 1TF3A 2ENAA 1WJPA 2LV2A 2E72A 2PRTA 1AAYA 1X6FA 2YRMA 4R2AA 4R2QA 2DMIA 5KL3A 2EN7A 1MEYC 2EMXA 4R2DA 1A1HA 2EOZA 2M9AA 1X6HA 4R2CA 2EPUA 1YUJA 4R2EA 2EOJA 2EE8A 1X5WA 2YTIA 2YRKA 3MHSC 3EPJA 3UK3C 1Z1BA 2DGCA 2BB8A 2ELZA 2EMAA 2I13A 2EOMA 1A1LA 2HGHA 2YSOA 2EN8A 2EOSA 1YUIA 2EMKA 4R2SA 2EM9A 2YTGA 3MHHC 4IJDA 2EMLA 1F2IG 2DLKA 2EPXA 2EPPA 2YTPA 4M9VC 2GHFA 2EQ0A 2EMHA 2EOXA 2R1FA 1UBDC 1TF6A 2EM5A 2EN4A 4IS1C 2EMBA 2EOYA 2EM4A 2NABA 2EJ4A 2A25A 4X9JA 1ZR9A 4WSGA 1G2DC 2MDGA 2YRHA 2EOFA 2WCC3 2ENHA 2EMGA 1X3CA 2ENCA 2YTEA 4F6NA 5KL2A 1B69A 2EP3A 2EM6A 2EORA 2WBTA 4F6MA 1G2FC 3EPKA 2EM2A 2YTJA 2EM0A 2EL6A 2EPAA 4R2RA 2EM3A 5KL5A 2EQ1A 2RPCA 2YTOA 2CSHA 1X6EA 2YU8A 1BBOA 2EM7A 2EOOA 2ELYA 2EPCA 2EMFA 2EOEA 1JK2A 2YTNA 1A1KA 1A1IA 2EL4A 1A1FA 2VRDA 2LT7A 2EOQA 3VHTB 1P47A 3EPLA 2LVHA 3M99B 2EN2A 2MKDA 2WBSA 2ADRA 2YSPA 5KL6A 2YTDA 1A1JA 2EN3A 2LCEA 5KL4A 2EN6A 1TN9A 2YTQA 2DLQA 2EQ3A 2EL5A 2EMYA 1ZU1A 1ZAAC 2EMIA 1DGCA 4GZNC 2EMCA 1KJKA 2EOIA 4R2PA 2CT1A 4FK5C 1YSAC 1LLMC 5KL7A 2DRPA 1JK1A 2RSIA 2CTDA 2YTFA 1UN6B 2EN1A 1A1GA 2D9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YU5 A;  2EM8 A;  2EMW A;  2EPR A;  2J7J A;  2GLI A;  2EPZ A;  1NCS A;  2JPA A;  2WBU A;  1RMD A;  2EOH A;  2MKN A;  2LO3 A;  2JP9 A;  3EPH A;  1BB8 A;  4F2J C;  2EMZ A;  1TF3 A;  2ENA A;  1WJP A;  2LV2 A;  2E72 A;  2PRT A;  1AAY A;  1X6F A;  2YRM A;  4R2A A;  4R2Q A;  2DMI A;  5KL3 A;  2EN7 A;  1MEY C;  2EMX A;  4R2D A;  1A1H A;  2EOZ A;  2M9A A;  1X6H A;  4R2C A;  2EPU A;  1YUJ A;  4R2E A;  2EOJ A;  2EE8 A;  1X5W A;  2YTI A;  2YRK A;  3MHS C;  3EPJ A;  3UK3 C;  1Z1B A;  2DGC A;  2BB8 A;  2ELZ A;  2EMA A;  2I13 A;  2EOM A;  1A1L A;  2HGH A;  2YSO A;  2EN8 A;  2EOS A;  1YUI A;  2EMK A;  4R2S A;  2EM9 A;  2YTG A;  3MHH C;  4IJD A;  2EML A;  1F2I G;  2DLK A;  2EPX A;  2EPP A;  2YTP A;  4M9V C;  2GHF A;  2EQ0 A;  2EMH A;  2EOX A;  2R1F A;  1UBD C;  1TF6 A;  2EM5 A;  2EN4 A;  4IS1 C;  2EMB A;  2EOY A;  2EM4 A;  2NAB A;  2EJ4 A;  2A25 A;  4X9J A;  1ZR9 A;  4WSG A;  1G2D C;  2MDG A;  2YRH A;  2EOF A;  2WCC 3;  2ENH A;  2EMG A;  1X3C A;  2ENC A;  2YTE A;  4F6N A;  5KL2 A;  1B69 A;  2EP3 A;  2EM6 A;  2EOR A;  2WBT A;  4F6M A;  1G2F C;  3EPK A;  2EM2 A;  2YTJ A;  2EM0 A;  2EL6 A;  2EPA A;  4R2R A;  2EM3 A;  5KL5 A;  2EQ1 A;  2RPC A;  2YTO A;  2CSH A;  1X6E A;  2YU8 A;  1BBO A;  2EM7 A;  2EOO A;  2ELY A;  2EPC A;  2EMF A;  2EOE A;  1JK2 A;  2YTN A;  1A1K A;  1A1I A;  2EL4 A;  1A1F A;  2VRD A;  2LT7 A;  2EOQ A;  3VHT B;  1P47 A;  3EPL A;  2LVH A;  3M99 B;  2EN2 A;  2MKD A;  2WBS A;  2ADR A;  2YSP A;  5KL6 A;  2YTD A;  1A1J A;  2EN3 A;  2LCE A;  5KL4 A;  2EN6 A;  1TN9 A;  2YTQ A;  2DLQ A;  2EQ3 A;  2EL5 A;  2EMY A;  1ZU1 A;  1ZAA C;  2EMI A;  1DGC A;  4GZN C;  2EMC A;  1KJK A;  2EOI A;  4R2P A;  2CT1 A;  4FK5 C;  1YSA C;  1LLM C;  5KL7 A;  2DRP A;  1JK1 A;  2RSI A;  2CTD A;  2YTF A;  1UN6 B;  2EN1 A;  1A1G A;  2D9H A; 
#chains in the Genus database with same CATH topology
 3KZY A;  1X47 A;  2J7J A;  4BHC A;  2WBU A;  2E1M A;  1RMD A;  2EOH A;  2MKN A;  2N3H A;  4JYA E;  3EPH A;  2VF1 A;  2HJJ A;  2KOU A;  4DV4 E;  5ADZ A;  2WZO A;  4Q35 B;  2PRT A;  1X6F A;  4R2Q A;  4R2D A;  4GKK E;  4DR2 E;  4R2C A;  1HNX E;  2EPK X;  2G7H A;  1FJG E;  2EOJ A;  2EE8 A;  2YTI A;  3TQM A;  2L3C A;  1Z1B A;  2DGC A;  4BCA A;  4JI7 E;  2ELZ A;  2EMA A;  4NZV A;  4OX9 E;  1T4O A;  4JI4 E;  2UXD E;  2EN8 A;  4X8W A;  3MHH C;  2LUP B;  2DLK A;  1X49 A;  2YTP A;  3ADL A;  2FV4 B;  2EMH A;  2R1F A;  4O24 A;  3J80 C;  1TF6 A;  2HHH E;  2EM5 A;  5A6K A;  1DQ3 A;  2K7I A;  3J7Y p;  3KZZ A;  4IS1 C;  2RTX A;  2EMB A;  2NAB A;  2IHR 1;  4ZYH A;  2LMZ A;  2EJ4 A;  3OML A;  2UXB E;  4WSG A;  4KHP E;  3BID A;  2EOF A;  4DR3 E;  3VYX A;  2WCC 3;  2EMG A;  2YTE A;  4R8O A;  1B69 A;  1T4L B;  4F9C B;  3EPK A;  2EM2 A;  5A6B A;  4DR1 E;  2EM3 A;  4P7D A;  2RS6 A;  1WXR A;  2YU8 A;  1KYQ A;  2EM7 A;  1EH7 A;  2ODR D;  2YTN A;  1A1I A;  1EH6 A;  1QU6 A;  3F6H A;  2E5L E;  2LT7 A;  2EOQ A;  2Q8U A;  3M99 B;  2JYA A;  2EN2 A;  3HPS A;  2ADR A;  5KL6 A;  1YYO A;  1UIL A;  2V89 A;  4X62 E;  5IV8 B;  1WHN A;  5KL4 A;  2EL5 A;  2B7V A;  2EMI A;  2M1S A;  4GZN C;  2JOX A;  2EMC A;  1KJK A;  3JTZ A;  2LBS B;  1EH8 A;  2CT1 A;  2LUQ A;  4BMJ A;  2N3G A;  2L2M A;  4L8N A;  2LTR A;  2CTD A;  3ADI A;  5A6B D;  4MLV A;  2EM8 A;  2EMW A;  4O5G A;  4N4R B;  1NCS A;  2UUC E;  4NXN E;  1PJS A;  2DIX A;  3ADG A;  1J5E E;  2LTS A;  2B7T A;  1T38 A;  1IMU A;  2VQF E;  3KWR A;  4WFT A;  1AAY A;  4R2A A;  2DMI A;  1A1H A;  2EOZ A;  4KWY A;  1RQ0 A;  4TUG A;  5IXM B;  2L8T A;  3OTO E;  3THN A;  1YUJ A;  5IT9 C;  4DV5 E;  1N3G A;  3UK3 C;  1X5W A;  3ADJ A;  4TUI A;  2BB8 A;  2I13 A;  2EOM A;  1A1L A;  4M30 A;  1J26 A;  2HGH A;  2ZM6 E;  4DR5 E;  4NXM E;  2RSM A;  2EPM X;  1YPN A;  4X66 E;  2EOS A;  5LLQ A;  1X48 A;  4IJD A;  4DR7 E;  2EML A;  5A2Q C;  2DB2 A;  2EPX A;  4DMI A;  4GEQ B;  1IBM E;  4JI5 E;  4LTY A;  4DV6 E;  3QG5 C;  4DV2 E;  1EKZ A;  4M9V C;  4WX9 A;  2GHF A;  2EQ0 A;  4DV3 E;  2EOX A;  4MLQ A;  2EN4 A;  2V88 A;  3JAM C;  2LJH A;  4KZS A;  1STU A;  1WRJ A;  2EOY A;  4DR6 E;  2A25 A;  1G2D C;  2V87 A;  2MDG A;  4M0V A;  2ENH A;  1X3C A;  2ENC A;  4DKK A;  2L6M A;  5KL2 A;  2M7Q A;  2YTJ A;  4DV1 E;  4X65 E;  2EPA A;  3JU0 A;  2CSH A;  1X6E A;  1IBL E;  2YT4 A;  1BBO A;  4Q28 A;  2ELY A;  5A6J A;  2EPC A;  2B3T B;  4P78 A;  2EOE A;  1JK2 A;  3T1H E;  2K4V A;  4RHB B;  2EL4 A;  4F54 A;  5F3W A;  4BC9 A;  4LF5 E;  3IWD A;  4LF6 E;  2H36 X;  1P47 A;  3EPL A;  1T4N A;  4JV5 E;  2NA2 A;  2YTD A;  5DNY A;  5AAS A;  2EQ3 A;  2EMY A;  2DSY A;  1GZ6 A;  1YYK A;  3THO B;  2EOI A;  1L4S A;  1HNZ E;  2JWO A;  4O4K A;  4WXD A;  1YSA C;  1GQE A;  2JY9 A;  5KL7 A;  2DRP A;  2RSI A;  3BGH A;  3L00 A;  2YTF A;  1XMQ E;  3P1X A;  1WHQ A;  2V86 A;  3J7A G;  1A1G A;  2YU5 A;  2GLI A;  4DUZ E;  2JPA A;  2LJU A;  5T6J A;  4F2J C;  4BS9 A;  2KHX A;  2EMZ A;  4GKJ E;  1WJP A;  1I94 E;  2NUF A;  2LV2 A;  4DUY E;  1PJQ A;  1XMO E;  2MDR A;  3FIG A;  4LF8 E;  2EN7 A;  3H09 A;  4NHR A;  2JVA A;  4JI2 E;  4LF7 E;  2M9A A;  2EPU A;  3VYY A;  2CPN A;  4WSP A;  2YRK A;  4WYQ B;  4LFB E;  2VE7 C;  2KON A;  1IBK E;  2BBG A;  1RC7 A;  1YUI A;  2EMK A;  2JXP A;  3IWB A;  2EM9 A;  2YTG A;  3F6G A;  5LL6 R;  2LE2 A;  5AC5 A;  4LF4 E;  2UUA E;  3LLH A;  1YYW A;  1O0W A;  5FLX C;  3HQ1 A;  3VK6 A;  2I9I A;  3T1Y E;  1IQO A;  2N8X A;  1GTK A;  2YRH A;  4AQY E;  1T39 A;  4YHH E;  2EZ6 A;  1QNT A;  4F6N A;  4HTG A;  2EP3 A;  1HR0 E;  4B3T E;  2EOR A;  3AV0 A;  2EM0 A;  3C6M A;  4R2R A;  1XNQ E;  4WPY A;  3AUZ A;  5KL5 A;  2ODR C;  4DV0 E;  2RPC A;  2YTO A;  4M2Z A;  3ZOQ B;  3HPZ A;  1N32 E;  4LFA E;  4HEI A;  1BBG A;  1N36 E;  4YY3 E;  4B3M E;  1A1F A;  2L3J A;  2HC5 A;  2LVH A;  4WXC A;  3ECR A;  4JI1 E;  2YPN A;  2WBS A;  2YSP A;  2YWQ A;  1ZBT A;  2EPL X;  2EN3 A;  4F9A B;  2F4V E;  2NUE A;  4JI0 E;  1TN9 A;  2YTQ A;  4DR4 E;  3EQ1 A;  2DLQ A;  3MSW A;  3HTX A;  1HNW E;  1ZU1 A;  1DGC A;  2EWL A;  4R03 A;  1PDA A;  1AH5 A;  4O43 A;  3C4B A;  4R2P A;  2UU9 E;  4ZYE A;  1LLM C;  2GPI A;  1JK1 A;  2UXC E;  1UN6 B;  5A6A A;  1UHZ A;  1PJT A;  1IQS A;  4OOG C;  4LU9 A;  2EPR A;  4L5N C;  4ZYD A;  2EPZ A;  4F9B B;  1YZ9 A;  2LO3 A;  2JP9 A;  1BB8 A;  4BC7 A;  1N34 E;  1TF3 A;  2ENA A;  1YFH A;  1ZBQ A;  4LFC E;  2JR1 A;  2EPO A;  3RMP A;  2L2N A;  2E72 A;  1MEY C;  2YRM A;  5KL3 A;  2UUB E;  2EMX A;  2L2K B;  4JI3 E;  3DF6 A;  3J81 C;  5AC4 A;  5BR8 E;  1X6H A;  5AE2 A;  1FKA E;  1XNR E;  4B3R E;  5LMU E;  2V8Q B;  4R2E A;  4X64 E;  2B9D A;  5TSE A;  2EPN A;  3EPJ A;  1MGT A;  3MHS C;  4BHB A;  4B3S E;  2YSO A;  2DMY A;  2R76 A;  1NEI A;  4R2S A;  2V83 A;  1F2I G;  2EPP A;  2FGG A;  5AE1 A;  1SR9 A;  2FTX B;  3DJW A;  3K6Q A;  1UBD C;  1PKP A;  2L33 A;  3C4T A;  4I8O A;  5LMN E;  5IWA E;  2EM4 A;  2LRS A;  4X9J A;  1ZR9 A;  2MC6 A;  4JI8 E;  5CFF E;  3C6K A;  2MC5 A;  2JOB A;  3HXL A;  4J8Z A;  4LF9 E;  3IWC A;  2NUG A;  4ZYG A;  2EM6 A;  2WBT A;  4F6M A;  1G2F C;  1N33 E;  2VQE E;  2EL6 A;  2EQ1 A;  5AE3 A;  4JI6 E;  1DI2 A;  2EOO A;  2EMF A;  2YZT A;  1A1K A;  2V85 A;  2VRD A;  2F8B A;  3VHT B;  2MKD A;  3BF2 A;  2L92 A;  1A1J A;  4DV7 E;  2LCE A;  2EN6 A;  5A69 A;  3BBG A;  1ZAA C;  3LML A;  2M4I A;  1SFE A;  2RQL A;  4K0K E;  4FK5 C;  4RH8 A;  2RS7 A;  2EN1 A;  4BBY A;  2D9H A; 
#chains in the Genus database with same CATH homology
 2YU5 A;  2EM8 A;  2EMW A;  2EPR A;  2J7J A;  2GLI A;  2EPZ A;  1NCS A;  2JPA A;  2WBU A;  1RMD A;  2EOH A;  2MKN A;  2LO3 A;  2JP9 A;  3EPH A;  1BB8 A;  4F2J C;  2EMZ A;  1TF3 A;  2ENA A;  1WJP A;  2LV2 A;  2E72 A;  2PRT A;  1AAY A;  1X6F A;  2YRM A;  4R2A A;  4R2Q A;  2DMI A;  5KL3 A;  2EN7 A;  1MEY C;  2EMX A;  4R2D A;  1A1H A;  2EOZ A;  2M9A A;  1X6H A;  4R2C A;  2EPU A;  1YUJ A;  4R2E A;  2EOJ A;  2EE8 A;  1X5W A;  2YTI A;  2YRK A;  3MHS C;  3EPJ A;  3UK3 C;  1Z1B A;  2DGC A;  2BB8 A;  2ELZ A;  2EMA A;  2I13 A;  2EOM A;  1A1L A;  2HGH A;  2YSO A;  2EN8 A;  2EOS A;  1YUI A;  2EMK A;  4R2S A;  2EM9 A;  2YTG A;  3MHH C;  4IJD A;  2EML A;  1F2I G;  2DLK A;  2EPX A;  2EPP A;  2YTP A;  4M9V C;  2GHF A;  2EQ0 A;  2EMH A;  2EOX A;  2R1F A;  1UBD C;  1TF6 A;  2EM5 A;  2EN4 A;  4IS1 C;  2EMB A;  2EOY A;  2EM4 A;  2NAB A;  2EJ4 A;  2A25 A;  4X9J A;  1ZR9 A;  4WSG A;  1G2D C;  2MDG A;  2YRH A;  2EOF A;  2WCC 3;  2ENH A;  2EMG A;  1X3C A;  2ENC A;  2YTE A;  4F6N A;  5KL2 A;  1B69 A;  2EP3 A;  2EM6 A;  2EOR A;  2WBT A;  4F6M A;  1G2F C;  3EPK A;  2EM2 A;  2YTJ A;  2EM0 A;  2EL6 A;  2EPA A;  4R2R A;  2EM3 A;  5KL5 A;  2EQ1 A;  2RPC A;  2YTO A;  2CSH A;  1X6E A;  2YU8 A;  1BBO A;  2EM7 A;  2EOO A;  2ELY A;  2EPC A;  2EMF A;  2EOE A;  1JK2 A;  2YTN A;  1A1K A;  1A1I A;  2EL4 A;  1A1F A;  2VRD A;  2LT7 A;  2EOQ A;  3VHT B;  1P47 A;  3EPL A;  2LVH A;  3M99 B;  2EN2 A;  2MKD A;  2WBS A;  2ADR A;  2YSP A;  5KL6 A;  2YTD A;  1A1J A;  2EN3 A;  2LCE A;  5KL4 A;  2EN6 A;  1TN9 A;  2YTQ A;  2DLQ A;  2EQ3 A;  2EL5 A;  2EMY A;  1ZU1 A;  1ZAA C;  2EMI A;  1DGC A;  4GZN C;  2EMC A;  1KJK A;  2EOI A;  4R2P A;  2CT1 A;  4FK5 C;  1YSA C;  1LLM C;  5KL7 A;  2DRP A;  1JK1 A;  2RSI A;  2CTD A;  2YTF A;  1UN6 B;  2EN1 A;  1A1G A;  2D9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...