2EOEA

Solution structure of the c2h2 type zinc finger (region 508-540) of human zinc finger protein 347
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYKCNECGKVFTQNSHLANHQRIHTGVKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 347
publication title Solution structure of the C2H2 type zinc finger (region 508-540) of human Zinc finger protein 347
rcsb
source organism Homo sapiens
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eoeA01
2YTFA 2EJ4A 5KL3A 2EM7A 2EPAA 2GHFA 2MKNA 2EOEA 1BBOA 5KL7A 4R2RA 2YTQA 1X3CA 2EL5A 2EN7A 2YTEA 2EM3A 2YRKA 2YTGA 2EM4A 2ELYA 1YSAC 2EPCA 2EQ1A 2EMHA 2WCC3 4R2AA 2EMLA 2MDGA 2EM5A 2LV2A 4R2QA 3EPJA 2DRPA 1KJKA 1G2FC 2EMGA 2ENAA 1Z1BA 2J7JA 1LLMC 2EN6A 2YTOA 4X9JA 2MKDA 1BB8A 2EOZA 1ZR9A 4F6MA 2EMBA 2YTPA 2EOOA 2EN1A 1TN9A 1ZU1A 2EOJA 3EPLA 1TF6A 2LVHA 1NCSA 1A1KA 2JP9A 2EMZA 1A1IA 1F2IG 1JK1A 2NABA 1B69A 2YTJA 2A25A 4WSGA 2EMWA 2EOIA 2EN8A 3EPHA 2RPCA 2WBSA 1P47A 2EOYA 2LCEA 1YUJA 2YSPA 2EP3A 2ENHA 1A1JA 2EMFA 4IS1C 1X5WA 2M9AA 1JK2A 2I13A 2EMCA 1YUIA 1UN6B 2YTDA 2EMYA 4R2PA 2DLQA 2YU5A 4R2CA 1RMDA 2CTDA 2EPZA 2EM9A 2RSIA 2EPPA 3EPKA 1DGCA 2EM8A 2GLIA 5KL2A 1MEYC 2EOSA 1UBDC 4GZNC 4M9VC 5KL4A 2EOQA 2EL6A 1TF3A 2LT7A 2EM2A 1X6HA 2YTIA 4IJDA 4R2DA 2EQ0A 2YSOA 4FK5C 1ZAAC 1G2DC 4R2SA 2VRDA 1X6FA 2EPXA 2BB8A 2R1FA 3VHTB 2EN2A 2EMXA 2WBUA 2DGCA 2EPUA 2DMIA 2EPRA 3MHSC 1WJPA 1X6EA 2EMIA 2PRTA 2EE8A 2YRHA 2EQ3A 1A1LA 2EM6A 2DLKA 2E72A 3MHHC 2EMKA 2ADRA 2EN4A 2ELZA 2EM0A 3M99B 1A1HA 2CSHA 5KL5A 2YU8A 2EORA 2EOHA 4R2EA 2D9HA 2EL4A 2ENCA 2WBTA 5KL6A 4F2JC 2CT1A 4F6NA 2JPAA 1AAYA 3UK3C 2YTNA 2EN3A 1A1GA 2HGHA 2LO3A 2YRMA 1A1FA 2EMAA 2EOFA 2EOXA 2EOMA
chains in the Genus database with same CATH superfamily
2KONA 2EJ4A 2F8BA 2Q8UA 4X64E 4LFAE 2EPAA 2EPMX 2DMYA 5KL7A 3J81C 4JYAE 2EM3A 3T1YE 1GTKA 2EPCA 2EMHA 1HNZE 2LUQA 1I94E 3JTZA 2LV2A 3EPJA 4O4KA 2LTSA 2EMGA 3F6HA 2YWQA 2B9DA 4DV0E 1Z1BA 1XMOE 4NHRA 1LLMC 2V86A 4OX9E 5LMUE 1WRJA 2EN6A 2RSMA 4X9JA 2EOZA 1XMQE 4WFTA 3QG5C 5A6KA 4F6MA 1YYWA 2UXBE 2RTXA 3IWCA 2YTPA 1T4OA 3J7Yp 3EPLA 4BBYA 1TF6A 4WX9A 1YYKA 5A2QC 1DQ3A 4BHBA 2EMWA 2M1SA 2EN8A 1RQ0A 3L00A 3ECRA 1P47A 2I9IA 2ENHA 1A1JA 3VK6A 4GKJE 2I13A 1IMUA 1UN6B 2EMYA 4DR1E 2IHR1 1RMDA 4M2ZA 1WHNA 2EPPA 2DB2A 2FV4B 1DGCA 3DF6A 2UUAE 1MEYC 3KWRA 5IV8B 5IT9C 4LF8E 2EOQA 2EL6A 2EM2A 4IJDA 4FK5C 5A69A 2DIXA 1G2DC 2VRDA 3HTXA 2BB8A 2EPXA 2R1FA 4JI2E 2HHHE 2JR1A 2EMXA 4BHCA 2DGCA 4OOGC 1EKZA 2JOBA 2LJUA 2VF1A 2EMIA 2YRHA 1A1LA 2EM6A 1STUA 2EMKA 1IQSA 4L5NC 2EM0A 3M99B 2N3GA 4O24A 2R76A 5KL5A 3JU0A 2K4VA 2L8TA 2EORA 2L92A 2EL4A 2YT4A 1AAYA 4LU9A 3C6MA 1IBLE 3BGHA 5IWAE 2HGHA 2LO3A 5A6BA 2UXCE 2V87A 1A1FA 2EMAA 2EOMA 3AUZA 3HPZA 3C4TA 2MKNA 1QU6A 3C6KA 2LE2A 4DUYE 1EH6A 4LF7E 1EH8A 2YTGA 4N4RB 3ADIA 2ELYA 4JI6E 2EQ1A 2ZM6E 2LRSA 2N3HA 4DR7E 1WXRA 5LMNE 2JVAA 3KZZA 1GQEA 4R2QA 2DRPA 4R03A 1G2FC 2JYAA 1YPNA 2J7JA 5AC5A 1FKAE 4TUGA 2DSYA 1PJQA 4YHHE 2RQLA 3H09A 2NA2A 5A6AA 5T6JA 4KWYA 1AH5A 3TQMA 3BIDA 2CPNA 4DV7E 5TSEA 2LVHA 1NCSA 2JP9A 2NABA 1HNWE 4HEIA 1YYOA 4KHPE 4WSGA 2EOIA 4F54A 4LFBE 2RPCA 2WBSA 2LCEA 2EP3A 4DKKA 1X5WA 2NUFA 1YZ9A 4LF5E 2JXPA 2RS6A 4JI7E 1EH7A 3JAMC 2EPLX 2BBGA 2EPZA 1IBME 3EPKA 5KL2A 1XNQE 4WPYA 4RH8A 4GZNC 3OTOE 5LL6R 3HXLA 2EQ0A 1PJTA 1ZAAC 2F4VE 4R2SA 4K0KE 1X6FA 4M0VA 4F9BB 2JOXA 2L3JA 2EN2A 3BBGA 2WBUA 2LBSB 4DR6E 3MHSC 4KZSA 2DMIA 1KYQA 2YPNA 1X6EA 1UILA 2PRTA 1MGTA 2DLKA 4BS9A 1FJGE 4ZYHA 4DV5E 2VQFE 2ADRA 2ODRC 3ADLA 2V89A 1A1HA 4HTGA 3ADJA 2YU8A 3J7AG 1SFEA 4R2EA 2ENCA 2WBTA 4NZVA 4F2JC 4M30A 4F6NA 2JPAA 2KOUA 1UHZA 4JI5E 2YTNA 4DMIA 2YRMA 2V88A 4M9VC 3FIGA 4RHBB 2M4IA 4Q35B 5LLQA 2V83A 4R2RA 4DV4E 3P1XA 1X3CA 2EL5A 4DR2E 1XNRE 2EM4A 3LLHA 2MDRA 2EPNA 4BMJA 4X8WA 2WZOA 5IXMB 2RS7A 2WCC3 3THOB 4R8OA 3DJWA 2B7VA 2EMLA 2L2MA 2L3CA 4ZYGA 4ZYEA 1T4LB 4J8ZA 2ENAA 1IBKE 1N3GA 2ODRD 2E1MA 3HPSA 3LMLA 1ZR9A 2VE7C 2YZTA 2EMBA 1T39A 3THNA 1TN9A 4X65E 1ZU1A 2EOJA 2LTRA 4B3ME 1A1KA 2MC6A 2EMZA 2JWOA 1PDAA 2YTJA 3AV0A 2L2NA 1X48A 4DUZE 2A25A 5DNYA 2YSPA 3VYYA 4DR4E 2EMFA 5BR8E 1T4NA 2EMCA 4I8OA 2YTDA 1RC7A 3BF2A 2RSIA 4X66E 2EM9A 2EM8A 3EQ1A 1J5EE 2EOSA 1N32E 4JI0E 5KL4A 2LT7A 3ZOQB 4BC9A 4F9CB 4YY3E 5AASA 2E5LE 4JI8E 2YSOA 2H36X 2K7IA 4LF4E 5CFFE 1SR9A 4BC7A 4LFCE 2NUGA 4TUIA 5FLXC 1WJPA 2GPIA 1N34E 2EE8A 5F3WA 2EQ3A 4BCAA 2FTXB 4LTYA 3OMLA 2ELZA 4B3SE 4AQYE 2D9HA 3UK3C 4WSPA 4B3RE 1A1GA 5A6JA 1T38A 4WXCA 4MLQA 4O5GA 4WYQB 4R2AA 4LF6E 2YTFA 5KL3A 2EM7A 3RMPA 2GHFA 2EOEA 1BBOA 1N36E 2YTQA 2YTEA 5A6BD 2EN7A 4DR3E 2HJJA 5AC4A 3MSWA 5AE3A 2UXDE 2YRKA 3C4BA 2LJHA 1YSAC 1NEIA 3F6GA 4P78A 2B3TB 2MDGA 2EM5A 4Q28A 1KJKA 2EPKX 2V8QB 4F9AB 1N33E 3KZYA 5ADZA 2M7QA 2V85A 2MC5A 4P7DA 1BBGA 2YTOA 1BB8A 2MKDA 2KHXA 4JV5E 4DV1E 2L33A 2B7TA 1DI2A 3IWBA 2EOOA 2EN1A 4DR5E 3K6QA 2JY9A 2FGGA 1HR0E 1A1IA 4B3TE 1F2IG 1L4SA 1JK1A 1B69A 4JI1E 4DV2E 4WXDA 1IQOA 2EWLA 1HNXE 3EPHA 4O43A 2EOYA 2L2KB 1YUJA 4NXNE 2EZ6A 4DV6E 4IS1C 2G7HA 4JI3E 2M9AA 1JK2A 1YUIA 5AE2A 4R2PA 2DLQA 2YU5A 2EPOA 4R2CA 2CTDA 4GEQB 2GLIA 1UBDC 2L6MA 4MLVA 3ADGA 4X62E 1TF3A 1YFHA 1X6HA 3T1HE 2YTIA 1X49A 4R2DA 1X47A 3HQ1A 4L8NA 2LMZA 3VHTB 2VQEE 2UUBE 2EPUA 4LF9E 4NXME 2EPRA 2N8XA 2UUCE 1PJSA 3IWDA 2HC5A 1O0WA 1ZBTA 2E72A 4DV3E 3MHHC 4ZYDA 1WHQA 2EN4A 1PKPA 2CSHA 1GZ6A 2EOHA 3J80C 5KL6A 1J26A 2CT1A 2NUEA 3VYXA 5AE1A 4GKKE 4JI4E 2LUPB 2EN3A 2UU9E 1QNTA 1ZBQA 2EOFA 2EOXA
chains in the Genus database with same CATH topology
2YTFA 2EJ4A 5KL3A 2EM7A 2EPAA 2GHFA 2MKNA 2EOEA 1BBOA 5KL7A 4R2RA 2YTQA 1X3CA 2EL5A 2EN7A 2YTEA 2EM3A 2YRKA 2YTGA 2EM4A 2ELYA 1YSAC 2EPCA 2EQ1A 2EMHA 2WCC3 4R2AA 2EMLA 2MDGA 2EM5A 2LV2A 4R2QA 3EPJA 2DRPA 1KJKA 1G2FC 2EMGA 2ENAA 1Z1BA 2J7JA 1LLMC 2EN6A 2YTOA 4X9JA 2MKDA 1BB8A 2EOZA 1ZR9A 4F6MA 2EMBA 2YTPA 2EOOA 2EN1A 1TN9A 1ZU1A 2EOJA 3EPLA 1TF6A 2LVHA 1NCSA 1A1KA 2JP9A 2EMZA 1A1IA 1F2IG 1JK1A 2NABA 1B69A 2YTJA 2A25A 4WSGA 2EMWA 2EOIA 2EN8A 3EPHA 2RPCA 2WBSA 1P47A 2EOYA 2LCEA 1YUJA 2YSPA 2EP3A 2ENHA 1A1JA 2EMFA 4IS1C 1X5WA 2M9AA 1JK2A 2I13A 2EMCA 1YUIA 1UN6B 2YTDA 2EMYA 4R2PA 2DLQA 2YU5A 4R2CA 1RMDA 2CTDA 2EPZA 2EM9A 2RSIA 2EPPA 3EPKA 1DGCA 2EM8A 2GLIA 5KL2A 1MEYC 2EOSA 1UBDC 4GZNC 4M9VC 5KL4A 2EOQA 2EL6A 1TF3A 2LT7A 2EM2A 1X6HA 2YTIA 4IJDA 4R2DA 2EQ0A 2YSOA 4FK5C 1ZAAC 1G2DC 4R2SA 2VRDA 1X6FA 2EPXA 2BB8A 2R1FA 3VHTB 2EN2A 2EMXA 2WBUA 2DGCA 2EPUA 2DMIA 2EPRA 3MHSC 1WJPA 1X6EA 2EMIA 2PRTA 2EE8A 2YRHA 2EQ3A 1A1LA 2EM6A 2DLKA 2E72A 3MHHC 2EMKA 2ADRA 2EN4A 2ELZA 2EM0A 3M99B 1A1HA 2CSHA 5KL5A 2YU8A 2EORA 2EOHA 4R2EA 2D9HA 2EL4A 2ENCA 2WBTA 5KL6A 4F2JC 2CT1A 4F6NA 2JPAA 1AAYA 3UK3C 2YTNA 2EN3A 1A1GA 2HGHA 2LO3A 2YRMA 1A1FA 2EMAA 2EOFA 2EOXA 2EOMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YTF A;  2EJ4 A;  5KL3 A;  2EM7 A;  2EPA A;  2GHF A;  2MKN A;  2EOE A;  1BBO A;  5KL7 A;  4R2R A;  2YTQ A;  1X3C A;  2EL5 A;  2EN7 A;  2YTE A;  2EM3 A;  2YRK A;  2YTG A;  2EM4 A;  2ELY A;  1YSA C;  2EPC A;  2EQ1 A;  2EMH A;  2WCC 3;  4R2A A;  2EML A;  2MDG A;  2EM5 A;  2LV2 A;  4R2Q A;  3EPJ A;  2DRP A;  1KJK A;  1G2F C;  2EMG A;  2ENA A;  1Z1B A;  2J7J A;  1LLM C;  2EN6 A;  2YTO A;  4X9J A;  2MKD A;  1BB8 A;  2EOZ A;  1ZR9 A;  4F6M A;  2EMB A;  2YTP A;  2EOO A;  2EN1 A;  1TN9 A;  1ZU1 A;  2EOJ A;  3EPL A;  1TF6 A;  2LVH A;  1NCS A;  1A1K A;  2JP9 A;  2EMZ A;  1A1I A;  1F2I G;  1JK1 A;  2NAB A;  1B69 A;  2YTJ A;  2A25 A;  4WSG A;  2EMW A;  2EOI A;  2EN8 A;  3EPH A;  2RPC A;  2WBS A;  1P47 A;  2EOY A;  2LCE A;  1YUJ A;  2YSP A;  2EP3 A;  2ENH A;  1A1J A;  2EMF A;  4IS1 C;  1X5W A;  2M9A A;  1JK2 A;  2I13 A;  2EMC A;  1YUI A;  1UN6 B;  2YTD A;  2EMY A;  4R2P A;  2DLQ A;  2YU5 A;  4R2C A;  1RMD A;  2CTD A;  2EPZ A;  2EM9 A;  2RSI A;  2EPP A;  3EPK A;  1DGC A;  2EM8 A;  2GLI A;  5KL2 A;  1MEY C;  2EOS A;  1UBD C;  4GZN C;  4M9V C;  5KL4 A;  2EOQ A;  2EL6 A;  1TF3 A;  2LT7 A;  2EM2 A;  1X6H A;  2YTI A;  4IJD A;  4R2D A;  2EQ0 A;  2YSO A;  4FK5 C;  1ZAA C;  1G2D C;  4R2S A;  2VRD A;  1X6F A;  2EPX A;  2BB8 A;  2R1F A;  3VHT B;  2EN2 A;  2EMX A;  2WBU A;  2DGC A;  2EPU A;  2DMI A;  2EPR A;  3MHS C;  1WJP A;  1X6E A;  2EMI A;  2PRT A;  2EE8 A;  2YRH A;  2EQ3 A;  1A1L A;  2EM6 A;  2DLK A;  2E72 A;  3MHH C;  2EMK A;  2ADR A;  2EN4 A;  2ELZ A;  2EM0 A;  3M99 B;  1A1H A;  2CSH A;  5KL5 A;  2YU8 A;  2EOR A;  2EOH A;  4R2E A;  2D9H A;  2EL4 A;  2ENC A;  2WBT A;  5KL6 A;  4F2J C;  2CT1 A;  4F6N A;  2JPA A;  1AAY A;  3UK3 C;  2YTN A;  2EN3 A;  1A1G A;  2HGH A;  2LO3 A;  2YRM A;  1A1F A;  2EMA A;  2EOF A;  2EOX A;  2EOM A; 
#chains in the Genus database with same CATH topology
 2KON A;  2EJ4 A;  2F8B A;  2Q8U A;  4X64 E;  4LFA E;  2EPA A;  2EPM X;  2DMY A;  5KL7 A;  3J81 C;  4JYA E;  2EM3 A;  3T1Y E;  1GTK A;  2EPC A;  2EMH A;  1HNZ E;  2LUQ A;  1I94 E;  3JTZ A;  2LV2 A;  3EPJ A;  4O4K A;  2LTS A;  2EMG A;  3F6H A;  2YWQ A;  2B9D A;  4DV0 E;  1Z1B A;  1XMO E;  4NHR A;  1LLM C;  2V86 A;  4OX9 E;  5LMU E;  1WRJ A;  2EN6 A;  2RSM A;  4X9J A;  2EOZ A;  1XMQ E;  4WFT A;  3QG5 C;  5A6K A;  4F6M A;  1YYW A;  2UXB E;  2RTX A;  3IWC A;  2YTP A;  1T4O A;  3J7Y p;  3EPL A;  4BBY A;  1TF6 A;  4WX9 A;  1YYK A;  5A2Q C;  1DQ3 A;  4BHB A;  2EMW A;  2M1S A;  2EN8 A;  1RQ0 A;  3L00 A;  3ECR A;  1P47 A;  2I9I A;  2ENH A;  1A1J A;  3VK6 A;  4GKJ E;  2I13 A;  1IMU A;  1UN6 B;  2EMY A;  4DR1 E;  2IHR 1;  1RMD A;  4M2Z A;  1WHN A;  2EPP A;  2DB2 A;  2FV4 B;  1DGC A;  3DF6 A;  2UUA E;  1MEY C;  3KWR A;  5IV8 B;  5IT9 C;  4LF8 E;  2EOQ A;  2EL6 A;  2EM2 A;  4IJD A;  4FK5 C;  5A69 A;  2DIX A;  1G2D C;  2VRD A;  3HTX A;  2BB8 A;  2EPX A;  2R1F A;  4JI2 E;  2HHH E;  2JR1 A;  2EMX A;  4BHC A;  2DGC A;  4OOG C;  1EKZ A;  2JOB A;  2LJU A;  2VF1 A;  2EMI A;  2YRH A;  1A1L A;  2EM6 A;  1STU A;  2EMK A;  1IQS A;  4L5N C;  2EM0 A;  3M99 B;  2N3G A;  4O24 A;  2R76 A;  5KL5 A;  3JU0 A;  2K4V A;  2L8T A;  2EOR A;  2L92 A;  2EL4 A;  2YT4 A;  1AAY A;  4LU9 A;  3C6M A;  1IBL E;  3BGH A;  5IWA E;  2HGH A;  2LO3 A;  5A6B A;  2UXC E;  2V87 A;  1A1F A;  2EMA A;  2EOM A;  3AUZ A;  3HPZ A;  3C4T A;  2MKN A;  1QU6 A;  3C6K A;  2LE2 A;  4DUY E;  1EH6 A;  4LF7 E;  1EH8 A;  2YTG A;  4N4R B;  3ADI A;  2ELY A;  4JI6 E;  2EQ1 A;  2ZM6 E;  2LRS A;  2N3H A;  4DR7 E;  1WXR A;  5LMN E;  2JVA A;  3KZZ A;  1GQE A;  4R2Q A;  2DRP A;  4R03 A;  1G2F C;  2JYA A;  1YPN A;  2J7J A;  5AC5 A;  1FKA E;  4TUG A;  2DSY A;  1PJQ A;  4YHH E;  2RQL A;  3H09 A;  2NA2 A;  5A6A A;  5T6J A;  4KWY A;  1AH5 A;  3TQM A;  3BID A;  2CPN A;  4DV7 E;  5TSE A;  2LVH A;  1NCS A;  2JP9 A;  2NAB A;  1HNW E;  4HEI A;  1YYO A;  4KHP E;  4WSG A;  2EOI A;  4F54 A;  4LFB E;  2RPC A;  2WBS A;  2LCE A;  2EP3 A;  4DKK A;  1X5W A;  2NUF A;  1YZ9 A;  4LF5 E;  2JXP A;  2RS6 A;  4JI7 E;  1EH7 A;  3JAM C;  2EPL X;  2BBG A;  2EPZ A;  1IBM E;  3EPK A;  5KL2 A;  1XNQ E;  4WPY A;  4RH8 A;  4GZN C;  3OTO E;  5LL6 R;  3HXL A;  2EQ0 A;  1PJT A;  1ZAA C;  2F4V E;  4R2S A;  4K0K E;  1X6F A;  4M0V A;  4F9B B;  2JOX A;  2L3J A;  2EN2 A;  3BBG A;  2WBU A;  2LBS B;  4DR6 E;  3MHS C;  4KZS A;  2DMI A;  1KYQ A;  2YPN A;  1X6E A;  1UIL A;  2PRT A;  1MGT A;  2DLK A;  4BS9 A;  1FJG E;  4ZYH A;  4DV5 E;  2VQF E;  2ADR A;  2ODR C;  3ADL A;  2V89 A;  1A1H A;  4HTG A;  3ADJ A;  2YU8 A;  3J7A G;  1SFE A;  4R2E A;  2ENC A;  2WBT A;  4NZV A;  4F2J C;  4M30 A;  4F6N A;  2JPA A;  2KOU A;  1UHZ A;  4JI5 E;  2YTN A;  4DMI A;  2YRM A;  2V88 A;  4M9V C;  3FIG A;  4RHB B;  2M4I A;  4Q35 B;  5LLQ A;  2V83 A;  4R2R A;  4DV4 E;  3P1X A;  1X3C A;  2EL5 A;  4DR2 E;  1XNR E;  2EM4 A;  3LLH A;  2MDR A;  2EPN A;  4BMJ A;  4X8W A;  2WZO A;  5IXM B;  2RS7 A;  2WCC 3;  3THO B;  4R8O A;  3DJW A;  2B7V A;  2EML A;  2L2M A;  2L3C A;  4ZYG A;  4ZYE A;  1T4L B;  4J8Z A;  2ENA A;  1IBK E;  1N3G A;  2ODR D;  2E1M A;  3HPS A;  3LML A;  1ZR9 A;  2VE7 C;  2YZT A;  2EMB A;  1T39 A;  3THN A;  1TN9 A;  4X65 E;  1ZU1 A;  2EOJ A;  2LTR A;  4B3M E;  1A1K A;  2MC6 A;  2EMZ A;  2JWO A;  1PDA A;  2YTJ A;  3AV0 A;  2L2N A;  1X48 A;  4DUZ E;  2A25 A;  5DNY A;  2YSP A;  3VYY A;  4DR4 E;  2EMF A;  5BR8 E;  1T4N A;  2EMC A;  4I8O A;  2YTD A;  1RC7 A;  3BF2 A;  2RSI A;  4X66 E;  2EM9 A;  2EM8 A;  3EQ1 A;  1J5E E;  2EOS A;  1N32 E;  4JI0 E;  5KL4 A;  2LT7 A;  3ZOQ B;  4BC9 A;  4F9C B;  4YY3 E;  5AAS A;  2E5L E;  4JI8 E;  2YSO A;  2H36 X;  2K7I A;  4LF4 E;  5CFF E;  1SR9 A;  4BC7 A;  4LFC E;  2NUG A;  4TUI A;  5FLX C;  1WJP A;  2GPI A;  1N34 E;  2EE8 A;  5F3W A;  2EQ3 A;  4BCA A;  2FTX B;  4LTY A;  3OML A;  2ELZ A;  4B3S E;  4AQY E;  2D9H A;  3UK3 C;  4WSP A;  4B3R E;  1A1G A;  5A6J A;  1T38 A;  4WXC A;  4MLQ A;  4O5G A;  4WYQ B;  4R2A A;  4LF6 E;  2YTF A;  5KL3 A;  2EM7 A;  3RMP A;  2GHF A;  2EOE A;  1BBO A;  1N36 E;  2YTQ A;  2YTE A;  5A6B D;  2EN7 A;  4DR3 E;  2HJJ A;  5AC4 A;  3MSW A;  5AE3 A;  2UXD E;  2YRK A;  3C4B A;  2LJH A;  1YSA C;  1NEI A;  3F6G A;  4P78 A;  2B3T B;  2MDG A;  2EM5 A;  4Q28 A;  1KJK A;  2EPK X;  2V8Q B;  4F9A B;  1N33 E;  3KZY A;  5ADZ A;  2M7Q A;  2V85 A;  2MC5 A;  4P7D A;  1BBG A;  2YTO A;  1BB8 A;  2MKD A;  2KHX A;  4JV5 E;  4DV1 E;  2L33 A;  2B7T A;  1DI2 A;  3IWB A;  2EOO A;  2EN1 A;  4DR5 E;  3K6Q A;  2JY9 A;  2FGG A;  1HR0 E;  1A1I A;  4B3T E;  1F2I G;  1L4S A;  1JK1 A;  1B69 A;  4JI1 E;  4DV2 E;  4WXD A;  1IQO A;  2EWL A;  1HNX E;  3EPH A;  4O43 A;  2EOY A;  2L2K B;  1YUJ A;  4NXN E;  2EZ6 A;  4DV6 E;  4IS1 C;  2G7H A;  4JI3 E;  2M9A A;  1JK2 A;  1YUI A;  5AE2 A;  4R2P A;  2DLQ A;  2YU5 A;  2EPO A;  4R2C A;  2CTD A;  4GEQ B;  2GLI A;  1UBD C;  2L6M A;  4MLV A;  3ADG A;  4X62 E;  1TF3 A;  1YFH A;  1X6H A;  3T1H E;  2YTI A;  1X49 A;  4R2D A;  1X47 A;  3HQ1 A;  4L8N A;  2LMZ A;  3VHT B;  2VQE E;  2UUB E;  2EPU A;  4LF9 E;  4NXM E;  2EPR A;  2N8X A;  2UUC E;  1PJS A;  3IWD A;  2HC5 A;  1O0W A;  1ZBT A;  2E72 A;  4DV3 E;  3MHH C;  4ZYD A;  1WHQ A;  2EN4 A;  1PKP A;  2CSH A;  1GZ6 A;  2EOH A;  3J80 C;  5KL6 A;  1J26 A;  2CT1 A;  2NUE A;  3VYX A;  5AE1 A;  4GKK E;  4JI4 E;  2LUP B;  2EN3 A;  2UU9 E;  1QNT A;  1ZBQ A;  2EOF A;  2EOX A; 
#chains in the Genus database with same CATH homology
 2YTF A;  2EJ4 A;  5KL3 A;  2EM7 A;  2EPA A;  2GHF A;  2MKN A;  2EOE A;  1BBO A;  5KL7 A;  4R2R A;  2YTQ A;  1X3C A;  2EL5 A;  2EN7 A;  2YTE A;  2EM3 A;  2YRK A;  2YTG A;  2EM4 A;  2ELY A;  1YSA C;  2EPC A;  2EQ1 A;  2EMH A;  2WCC 3;  4R2A A;  2EML A;  2MDG A;  2EM5 A;  2LV2 A;  4R2Q A;  3EPJ A;  2DRP A;  1KJK A;  1G2F C;  2EMG A;  2ENA A;  1Z1B A;  2J7J A;  1LLM C;  2EN6 A;  2YTO A;  4X9J A;  2MKD A;  1BB8 A;  2EOZ A;  1ZR9 A;  4F6M A;  2EMB A;  2YTP A;  2EOO A;  2EN1 A;  1TN9 A;  1ZU1 A;  2EOJ A;  3EPL A;  1TF6 A;  2LVH A;  1NCS A;  1A1K A;  2JP9 A;  2EMZ A;  1A1I A;  1F2I G;  1JK1 A;  2NAB A;  1B69 A;  2YTJ A;  2A25 A;  4WSG A;  2EMW A;  2EOI A;  2EN8 A;  3EPH A;  2RPC A;  2WBS A;  1P47 A;  2EOY A;  2LCE A;  1YUJ A;  2YSP A;  2EP3 A;  2ENH A;  1A1J A;  2EMF A;  4IS1 C;  1X5W A;  2M9A A;  1JK2 A;  2I13 A;  2EMC A;  1YUI A;  1UN6 B;  2YTD A;  2EMY A;  4R2P A;  2DLQ A;  2YU5 A;  4R2C A;  1RMD A;  2CTD A;  2EPZ A;  2EM9 A;  2RSI A;  2EPP A;  3EPK A;  1DGC A;  2EM8 A;  2GLI A;  5KL2 A;  1MEY C;  2EOS A;  1UBD C;  4GZN C;  4M9V C;  5KL4 A;  2EOQ A;  2EL6 A;  1TF3 A;  2LT7 A;  2EM2 A;  1X6H A;  2YTI A;  4IJD A;  4R2D A;  2EQ0 A;  2YSO A;  4FK5 C;  1ZAA C;  1G2D C;  4R2S A;  2VRD A;  1X6F A;  2EPX A;  2BB8 A;  2R1F A;  3VHT B;  2EN2 A;  2EMX A;  2WBU A;  2DGC A;  2EPU A;  2DMI A;  2EPR A;  3MHS C;  1WJP A;  1X6E A;  2EMI A;  2PRT A;  2EE8 A;  2YRH A;  2EQ3 A;  1A1L A;  2EM6 A;  2DLK A;  2E72 A;  3MHH C;  2EMK A;  2ADR A;  2EN4 A;  2ELZ A;  2EM0 A;  3M99 B;  1A1H A;  2CSH A;  5KL5 A;  2YU8 A;  2EOR A;  2EOH A;  4R2E A;  2D9H A;  2EL4 A;  2ENC A;  2WBT A;  5KL6 A;  4F2J C;  2CT1 A;  4F6N A;  2JPA A;  1AAY A;  3UK3 C;  2YTN A;  2EN3 A;  1A1G A;  2HGH A;  2LO3 A;  2YRM A;  1A1F A;  2EMA A;  2EOF A;  2EOX A;  2EOM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...