2EOEA

Solution structure of the c2h2 type zinc finger (region 508-540) of human zinc finger protein 347
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYKCNECGKVFTQNSHLANHQRIHTGVKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 347
publication title Solution structure of the C2H2 type zinc finger (region 508-540) of human Zinc finger protein 347
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eoeA01
1WJPA 1X6HA 2EM6A 2EM5A 4R2CA 5KL7A 2EM3A 2EORA 3UK3C 2EPCA 2YU8A 2EMFA 3MHSC 2EL5A 4R2DA 1JK2A 3EPKA 1ZR9A 2CSHA 1JK1A 2EN2A 2JPAA 2EPZA 2EM8A 2NABA 2ENCA 2EN3A 2EQ3A 1MEYC 5KL5A 2EOHA 2EQ0A 3VHTB 2PRTA 2YTNA 2EL6A 1UN6B 4IJDA 2MKNA 2EOSA 4R2EA 2CTDA 3EPHA 1A1GA 2YRHA 2EMWA 2YSPA 2ELYA 2EMAA 3EPLA 2GHFA 2MDGA 1TN9A 2YTEA 2DMIA 4GZNC 2WBUA 2EN7A 3M99B 2YTGA 2A25A 2DRPA 4R2QA 5KL6A 2ELZA 2EOEA 2GLIA 1X6EA 1X5WA 2EMLA 1G2FC 1KJKA 2EPPA 1X3CA 2EM2A 2EN4A 2YTJA 4R2PA 1LLMC 2I13A 2EOQA 3MHHC 2EPAA 1A1FA 2LCEA 1B69A 2EMZA 2WBSA 1F2IG 2EOOA 1YUJA 2EP3A 1X6FA 2EMCA 4F2JC 2EM7A 2EOFA 5KL3A 2RSIA 2EMYA 2EM0A 2EOIA 3EPJA 4F6NA 4M9VC 2HGHA 1UBDC 2EMIA 1G2DC 2EE8A 2EMGA 1ZU1A 2YTQA 2EL4A 2YTPA 2YTIA 2MKDA 2WCC3 2EN8A 4R2SA 2VRDA 2YTFA 1A1IA 1AAYA 4F6MA 2J7JA 4R2RA 2LV2A 1YUIA 2YRKA 1A1HA 2EJ4A 1BB8A 1BBOA 2EOXA 1A1LA 2WBTA 1A1JA 4R2AA 2CT1A 2BB8A 1Z1BA 2EOMA 2E72A 2R1FA 2D9HA 2ENHA 2YRMA 1TF3A 2LVHA 2LT7A 2EQ1A 2RPCA 1TF6A 2EOJA 2EM9A 2EN6A 2EN1A 1NCSA 2EM4A 1DGCA 2LO3A 2JP9A 2EPUA 2EMXA 1ZAAC 2ENAA 2EMHA 2EOYA 2EMBA 1YSAC 1RMDA 2EPRA 2YTOA 4FK5C 2ADRA 2YU5A 2DGCA 5KL2A 2M9AA 2YSOA 1A1KA 2EMKA 2DLKA 2EOZA 2EPXA 5KL4A 4X9JA 4IS1C 4WSGA 1P47A 2DLQA 2YTDA
chains in the Genus database with same CATH superfamily
2LUQA 1X6HA 1O0WA 4DR5E 3LLHA 4M0VA 2I9IA 2JY9A 1GQEA 2EM3A 4B3TE 4LF8E 3MHSC 2B7VA 2FV4B 4JI1E 3VYYA 2LUPB 1EH8A 3EPKA 3QG5C 3MSWA 2ZM6E 5KL5A 2EOHA 5BR8E 1T4NA 3ECRA 3JU0A 4IJDA 2V88A 3FIGA 3EPHA 1A1GA 3KZYA 1XNQE 4LFCE 2LJHA 4JYAE 2KONA 3EPLA 1XMQE 1T38A 4RH8A 2WZOA 2WBUA 3M99B 2ELZA 2EOEA 2MC6A 1EKZA 4M2ZA 1X5WA 4LFBE 4DV7E 4JV5E 5LL6R 2YWQA 4P7DA 3C4TA 2V87A 4BS9A 4BHCA 5AE1A 2FGGA 2L6MA 2EM7A 2EOFA 5KL3A 3THNA 2G7HA 2EM0A 2V8QB 2EOIA 2EL4A 2YTIA 1YFHA 2EN8A 5ADZA 1AAYA 4TUGA 4DV2E 4ZYEA 1A1HA 1BBOA 5A6JA 4P78A 4DR4E 2E72A 2L3CA 4Q28A 1X48A 2LVHA 2V83A 1YYWA 2EN1A 2YT4A 2UXCE 2EPUA 4KWYA 4DV3E 2LMZA 1WXRA 3BBGA 4LF9E 1YSAC 2EPRA 2M7QA 2EZ6A 4AQYE 4LTYA 4FK5C 2JXPA 5A69A 2L3JA 1IQSA 5A6KA 2M9AA 2EOZA 4X9JA 2L8TA 4DUZE 3KZZA 4WSGA 2KHXA 4JI2E 2M4IA 1I94E 1PJQA 3F6GA 5KL7A 1PKPA 3DJWA 1T39A 2EPCA 2DMYA 4LF5E 4F9BB 4MLQA 1JK2A 3JAMC 1ZR9A 2CSHA 1JK1A 4JI3E 2EM8A 3BIDA 2EQ3A 2UUAE 1N33E 3ADGA 2GPIA 3JTZA 2RS6A 2PRTA 2EL6A 4DMIA 2E5LE 4M30A 5A2QC 4Q35B 4R2EA 2CTDA 1BBGA 2EPLX 2YSPA 4KZSA 5LMUE 4ZYHA 2BBGA 3THOB 2HC5A 2Q8UA 2NUGA 3ADIA 3ADJA 2YTEA 4GZNC 2YPNA 1PJSA 3J80C 2VF1A 2NUEA 1T4OA 2EMLA 2EPNA 1KYQA 1G2FC 4R2PA 2N3GA 2F8BA 2I13A 1B69A 1IQOA 4BCAA 2EMZA 2EOOA 4L8NA 4DV4E 4LF4E 5IT9C 4F2JC 2B7TA 3EPJA 3OMLA 4M9VC 1DQ3A 5AASA 4LFAE 4B3RE 2EE8A 2EMGA 3F6HA 2MKDA 1ZBQA 2VRDA 2YTFA 4X64E 4F6MA 5F3WA 4R2RA 3VYXA 2L2NA 1A1JA 4BC9A 2BB8A 2M1SA 4BMJA 2E1MA 1Z1BA 2R76A 2R1FA 1L4SA 2YRMA 2LT7A 5TSEA 4RHBB 2EOJA 2EM9A 2JR1A 1YYOA 1DGCA 2NA2A 4DUYE 2JP9A 4WX9A 2B3TB 2N3HA 4HEIA 2EMBA 1RMDA 1MGTA 1RQ0A 3HPZA 2L92A 2ADRA 2YU5A 2B9DA 3HXLA 2YSOA 1A1KA 2EMKA 2DLKA 2EPXA 4X66E 1IMUA 1AH5A 2DLQA 4ZYDA 4LU9A 3J81C 2YTDA 1WJPA 2EM6A 2EM5A 4YHHE 4BHBA 2EORA 4R03A 4DR6E 3UK3C 1X49A 4DR1E 2YU8A 5LLQA 4HTGA 4R8OA 2EL5A 5A6AA 2UXDE 2LRSA 2FTXB 2EN2A 2LTSA 2EPZA 3VK6A 2NABA 4BBYA 2ENCA 1MEYC 2EPKX 3IWCA 1WHNA 2F4VE 5IXMB 1IBME 3VHTB 1UHZA 2MKNA 2EOSA 1GZ6A 2UUBE 2YRHA 2HJJA 4JI4E 2JOXA 2ELYA 2EMAA 2LTRA 2DIXA 2UU9E 2MDGA 4NXME 4O4KA 1TN9A 5IWAE 3C4BA 1WRJA 2UUCE 4WXCA 3K6QA 1STUA 1QU6A 2A25A 2JOBA 2LJUA 1UILA 2YZTA 5KL6A 4R2QA 1N34E 2DRPA 4F9AB 1X6EA 3OTOE 1X3CA 2EM2A 1LLMC 3ADLA 2EOQA 2EPAA 1A1FA 2LCEA 2V85A 2WBSA 1F2IG 1PDAA 2LE2A 1YYKA 2IHR1 4L5NC 2EP3A 3KWRA 5A6BD 1YPNA 4NHRA 2EMYA 4O5GA 2LBSB 4F6NA 1G2DC 5AC5A 1ZU1A 2YTQA 4DR2E 5T6JA 1A1IA 4GKKE 2LV2A 4ZYGA 1YUIA 2YRKA 5LMNE 1BB8A 2WBTA 1GTKA 3HTXA 4I8OA 1N32E 4F9CB 2D9HA 2ENHA 2DB2A 1HNWE 4DV5E 2RPCA 4O24A 1FKAE 1QNTA 2EM4A 3C6MA 1XNRE 2LO3A 4J8ZA 4N4RB 4DV6E 2ODRD 2EMXA 5AC4A 2ENAA 2EWLA 4BC7A 4JI5E 4WYQB 1N36E 2JVAA 3EQ1A 3T1HE 2YTOA 4LF7E 4YY3E 3H09A 3T1YE 1PJTA 1EH7A 5KL4A 1SR9A 2V86A 1EH6A 1P47A 4JI8E 2MDRA 1FJGE 4R2CA 5AE3A 2EMFA 2HHHE 1HNXE 4DV0E 3HPSA 1NEIA 4R2DA 3HQ1A 2L2KB 4JI6E 2DSYA 2L2MA 3BGHA 3IWDA 2JPAA 2L33A 4DKKA 2EN3A 1XMOE 2UXBE 2EQ0A 4JI7E 2VQEE 2JWOA 2YTNA 4B3ME 1UN6B 1WHQA 4WFTA 4DR3E 1ZBTA 1RC7A 2EMWA 4TUIA 3BF2A 2KOUA 3C6KA 2RTXA 2GHFA 1J5EE 1X47A 2EPOA 4X8WA 4OOGC 2DMIA 2EN7A 1T4LB 2YTGA 2RQLA 4WXDA 4LF6E 2CPNA 4GKJE 5IV8B 2H36X 2GLIA 4MLVA 5CFFE 1KJKA 2EPPA 2EN4A 2YTJA 3MHHC 2JYAA 3J7Yp 1YUJA 1HNZE 4B3SE 4DR7E 1X6FA 2EMCA 2ODRC 2RSIA 3LMLA 1UBDC 2HGHA 1N3GA 2EMIA 2YTPA 2WCC3 4R2SA 3DF6A 4GEQB 4F54A 2J7JA 2VQFE 3AUZA 2K7IA 2EJ4A 2EPMX 2EOXA 1A1LA 4R2AA 5AE2A 3AV0A 2K4VA 2CT1A 2MC5A 2EOMA 2RS7A 5DNYA 4X62E 1TF3A 4WPYA 4O43A 4OX9E 3IWBA 1HR0E 1J26A 2EQ1A 1TF6A 1SFEA 4K0KE 2EN6A 1NCSA 1IBKE 4X65E 4DV1E 1ZAAC 2EMHA 2EOYA 4JI0E 3RMPA 2NUFA 3TQMA 4KHPE 5A6BA 2N8XA 2V89A 2RSMA 1YZ9A 2DGCA 4NZVA 3ZOQB 5KL2A 1IBLE 4IS1C 4NXNE 4WSPA 3P1XA 3L00A 5FLXC 2VE7C 1DI2A 3J7AG
chains in the Genus database with same CATH topology
1WJPA 1X6HA 2EM6A 2EM5A 4R2CA 5KL7A 2EM3A 2EORA 3UK3C 2EPCA 2YU8A 2EMFA 3MHSC 2EL5A 4R2DA 1JK2A 3EPKA 1ZR9A 2CSHA 1JK1A 2EN2A 2JPAA 2EPZA 2EM8A 2NABA 2ENCA 2EN3A 2EQ3A 1MEYC 5KL5A 2EOHA 2EQ0A 3VHTB 2PRTA 2YTNA 2EL6A 1UN6B 4IJDA 2MKNA 2EOSA 4R2EA 2CTDA 3EPHA 1A1GA 2YRHA 2EMWA 2YSPA 2ELYA 2EMAA 3EPLA 2GHFA 2MDGA 1TN9A 2YTEA 2DMIA 4GZNC 2WBUA 2EN7A 3M99B 2YTGA 2A25A 2DRPA 4R2QA 5KL6A 2ELZA 2EOEA 2GLIA 1X6EA 1X5WA 2EMLA 1G2FC 1KJKA 2EPPA 1X3CA 2EM2A 2EN4A 2YTJA 4R2PA 1LLMC 2I13A 2EOQA 3MHHC 2EPAA 1A1FA 2LCEA 1B69A 2EMZA 2WBSA 1F2IG 2EOOA 1YUJA 2EP3A 1X6FA 2EMCA 4F2JC 2EM7A 2EOFA 5KL3A 2RSIA 2EMYA 2EM0A 2EOIA 3EPJA 4F6NA 4M9VC 2HGHA 1UBDC 2EMIA 1G2DC 2EE8A 2EMGA 1ZU1A 2YTQA 2EL4A 2YTPA 2YTIA 2MKDA 2WCC3 2EN8A 4R2SA 2VRDA 2YTFA 1A1IA 1AAYA 4F6MA 2J7JA 4R2RA 2LV2A 1YUIA 2YRKA 1A1HA 2EJ4A 1BB8A 1BBOA 2EOXA 1A1LA 2WBTA 1A1JA 4R2AA 2CT1A 2BB8A 1Z1BA 2EOMA 2E72A 2R1FA 2D9HA 2ENHA 2YRMA 1TF3A 2LVHA 2LT7A 2EQ1A 2RPCA 1TF6A 2EOJA 2EM9A 2EN6A 2EN1A 1NCSA 2EM4A 1DGCA 2LO3A 2JP9A 2EPUA 2EMXA 1ZAAC 2ENAA 2EMHA 2EOYA 2EMBA 1YSAC 1RMDA 2EPRA 2YTOA 4FK5C 2ADRA 2YU5A 2DGCA 5KL2A 2M9AA 2YSOA 1A1KA 2EMKA 2DLKA 2EOZA 2EPXA 5KL4A 4X9JA 4IS1C 4WSGA 1P47A 2DLQA 2YTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJP A;  1X6H A;  2EM6 A;  2EM5 A;  4R2C A;  5KL7 A;  2EM3 A;  2EOR A;  3UK3 C;  2EPC A;  2YU8 A;  2EMF A;  3MHS C;  2EL5 A;  4R2D A;  1JK2 A;  3EPK A;  1ZR9 A;  2CSH A;  1JK1 A;  2EN2 A;  2JPA A;  2EPZ A;  2EM8 A;  2NAB A;  2ENC A;  2EN3 A;  2EQ3 A;  1MEY C;  5KL5 A;  2EOH A;  2EQ0 A;  3VHT B;  2PRT A;  2YTN A;  2EL6 A;  1UN6 B;  4IJD A;  2MKN A;  2EOS A;  4R2E A;  2CTD A;  3EPH A;  1A1G A;  2YRH A;  2EMW A;  2YSP A;  2ELY A;  2EMA A;  3EPL A;  2GHF A;  2MDG A;  1TN9 A;  2YTE A;  2DMI A;  4GZN C;  2WBU A;  2EN7 A;  3M99 B;  2YTG A;  2A25 A;  2DRP A;  4R2Q A;  5KL6 A;  2ELZ A;  2EOE A;  2GLI A;  1X6E A;  1X5W A;  2EML A;  1G2F C;  1KJK A;  2EPP A;  1X3C A;  2EM2 A;  2EN4 A;  2YTJ A;  4R2P A;  1LLM C;  2I13 A;  2EOQ A;  3MHH C;  2EPA A;  1A1F A;  2LCE A;  1B69 A;  2EMZ A;  2WBS A;  1F2I G;  2EOO A;  1YUJ A;  2EP3 A;  1X6F A;  2EMC A;  4F2J C;  2EM7 A;  2EOF A;  5KL3 A;  2RSI A;  2EMY A;  2EM0 A;  2EOI A;  3EPJ A;  4F6N A;  4M9V C;  2HGH A;  1UBD C;  2EMI A;  1G2D C;  2EE8 A;  2EMG A;  1ZU1 A;  2YTQ A;  2EL4 A;  2YTP A;  2YTI A;  2MKD A;  2WCC 3;  2EN8 A;  4R2S A;  2VRD A;  2YTF A;  1A1I A;  1AAY A;  4F6M A;  2J7J A;  4R2R A;  2LV2 A;  1YUI A;  2YRK A;  1A1H A;  2EJ4 A;  1BB8 A;  1BBO A;  2EOX A;  1A1L A;  2WBT A;  1A1J A;  4R2A A;  2CT1 A;  2BB8 A;  1Z1B A;  2EOM A;  2E72 A;  2R1F A;  2D9H A;  2ENH A;  2YRM A;  1TF3 A;  2LVH A;  2LT7 A;  2EQ1 A;  2RPC A;  1TF6 A;  2EOJ A;  2EM9 A;  2EN6 A;  2EN1 A;  1NCS A;  2EM4 A;  1DGC A;  2LO3 A;  2JP9 A;  2EPU A;  2EMX A;  1ZAA C;  2ENA A;  2EMH A;  2EOY A;  2EMB A;  1YSA C;  1RMD A;  2EPR A;  2YTO A;  4FK5 C;  2ADR A;  2YU5 A;  2DGC A;  5KL2 A;  2M9A A;  2YSO A;  1A1K A;  2EMK A;  2DLK A;  2EOZ A;  2EPX A;  5KL4 A;  4X9J A;  4IS1 C;  4WSG A;  1P47 A;  2DLQ A;  2YTD A; 
#chains in the Genus database with same CATH topology
 2LUQ A;  1X6H A;  1O0W A;  4DR5 E;  3LLH A;  4M0V A;  2I9I A;  2JY9 A;  1GQE A;  2EM3 A;  4B3T E;  4LF8 E;  3MHS C;  2B7V A;  2FV4 B;  4JI1 E;  3VYY A;  2LUP B;  1EH8 A;  3EPK A;  3QG5 C;  3MSW A;  2ZM6 E;  5KL5 A;  2EOH A;  5BR8 E;  1T4N A;  3ECR A;  3JU0 A;  4IJD A;  2V88 A;  3FIG A;  3EPH A;  1A1G A;  3KZY A;  1XNQ E;  4LFC E;  2LJH A;  4JYA E;  2KON A;  3EPL A;  1XMQ E;  1T38 A;  4RH8 A;  2WZO A;  2WBU A;  3M99 B;  2ELZ A;  2EOE A;  2MC6 A;  1EKZ A;  4M2Z A;  1X5W A;  4LFB E;  4DV7 E;  4JV5 E;  5LL6 R;  2YWQ A;  4P7D A;  3C4T A;  2V87 A;  4BS9 A;  4BHC A;  5AE1 A;  2FGG A;  2L6M A;  2EM7 A;  2EOF A;  5KL3 A;  3THN A;  2G7H A;  2EM0 A;  2V8Q B;  2EOI A;  2EL4 A;  2YTI A;  1YFH A;  2EN8 A;  5ADZ A;  1AAY A;  4TUG A;  4DV2 E;  4ZYE A;  1A1H A;  1BBO A;  5A6J A;  4P78 A;  4DR4 E;  2E72 A;  2L3C A;  4Q28 A;  1X48 A;  2LVH A;  2V83 A;  1YYW A;  2EN1 A;  2YT4 A;  2UXC E;  2EPU A;  4KWY A;  4DV3 E;  2LMZ A;  1WXR A;  3BBG A;  4LF9 E;  1YSA C;  2EPR A;  2M7Q A;  2EZ6 A;  4AQY E;  4LTY A;  4FK5 C;  2JXP A;  5A69 A;  2L3J A;  1IQS A;  5A6K A;  2M9A A;  2EOZ A;  4X9J A;  2L8T A;  4DUZ E;  3KZZ A;  4WSG A;  2KHX A;  4JI2 E;  2M4I A;  1I94 E;  1PJQ A;  3F6G A;  5KL7 A;  1PKP A;  3DJW A;  1T39 A;  2EPC A;  2DMY A;  4LF5 E;  4F9B B;  4MLQ A;  1JK2 A;  3JAM C;  1ZR9 A;  2CSH A;  1JK1 A;  4JI3 E;  2EM8 A;  3BID A;  2EQ3 A;  2UUA E;  1N33 E;  3ADG A;  2GPI A;  3JTZ A;  2RS6 A;  2PRT A;  2EL6 A;  4DMI A;  2E5L E;  4M30 A;  5A2Q C;  4Q35 B;  4R2E A;  2CTD A;  1BBG A;  2EPL X;  2YSP A;  4KZS A;  5LMU E;  4ZYH A;  2BBG A;  3THO B;  2HC5 A;  2Q8U A;  2NUG A;  3ADI A;  3ADJ A;  2YTE A;  4GZN C;  2YPN A;  1PJS A;  3J80 C;  2VF1 A;  2NUE A;  1T4O A;  2EML A;  2EPN A;  1KYQ A;  1G2F C;  4R2P A;  2N3G A;  2F8B A;  2I13 A;  1B69 A;  1IQO A;  4BCA A;  2EMZ A;  2EOO A;  4L8N A;  4DV4 E;  4LF4 E;  5IT9 C;  4F2J C;  2B7T A;  3EPJ A;  3OML A;  4M9V C;  1DQ3 A;  5AAS A;  4LFA E;  4B3R E;  2EE8 A;  2EMG A;  3F6H A;  2MKD A;  1ZBQ A;  2VRD A;  2YTF A;  4X64 E;  4F6M A;  5F3W A;  4R2R A;  3VYX A;  2L2N A;  1A1J A;  4BC9 A;  2BB8 A;  2M1S A;  4BMJ A;  2E1M A;  1Z1B A;  2R76 A;  2R1F A;  1L4S A;  2YRM A;  2LT7 A;  5TSE A;  4RHB B;  2EOJ A;  2EM9 A;  2JR1 A;  1YYO A;  1DGC A;  2NA2 A;  4DUY E;  2JP9 A;  4WX9 A;  2B3T B;  2N3H A;  4HEI A;  2EMB A;  1RMD A;  1MGT A;  1RQ0 A;  3HPZ A;  2L92 A;  2ADR A;  2YU5 A;  2B9D A;  3HXL A;  2YSO A;  1A1K A;  2EMK A;  2DLK A;  2EPX A;  4X66 E;  1IMU A;  1AH5 A;  2DLQ A;  4ZYD A;  4LU9 A;  3J81 C;  2YTD A;  1WJP A;  2EM6 A;  2EM5 A;  4YHH E;  4BHB A;  2EOR A;  4R03 A;  4DR6 E;  3UK3 C;  1X49 A;  4DR1 E;  2YU8 A;  5LLQ A;  4HTG A;  4R8O A;  2EL5 A;  5A6A A;  2UXD E;  2LRS A;  2FTX B;  2EN2 A;  2LTS A;  2EPZ A;  3VK6 A;  2NAB A;  4BBY A;  2ENC A;  1MEY C;  2EPK X;  3IWC A;  1WHN A;  2F4V E;  5IXM B;  1IBM E;  3VHT B;  1UHZ A;  2MKN A;  2EOS A;  1GZ6 A;  2UUB E;  2YRH A;  2HJJ A;  4JI4 E;  2JOX A;  2ELY A;  2EMA A;  2LTR A;  2DIX A;  2UU9 E;  2MDG A;  4NXM E;  4O4K A;  1TN9 A;  5IWA E;  3C4B A;  1WRJ A;  2UUC E;  4WXC A;  3K6Q A;  1STU A;  1QU6 A;  2A25 A;  2JOB A;  2LJU A;  1UIL A;  2YZT A;  5KL6 A;  4R2Q A;  1N34 E;  2DRP A;  4F9A B;  1X6E A;  3OTO E;  1X3C A;  2EM2 A;  1LLM C;  3ADL A;  2EOQ A;  2EPA A;  1A1F A;  2LCE A;  2V85 A;  2WBS A;  1F2I G;  1PDA A;  2LE2 A;  1YYK A;  2IHR 1;  4L5N C;  2EP3 A;  3KWR A;  5A6B D;  1YPN A;  4NHR A;  2EMY A;  4O5G A;  2LBS B;  4F6N A;  1G2D C;  5AC5 A;  1ZU1 A;  2YTQ A;  4DR2 E;  5T6J A;  1A1I A;  4GKK E;  2LV2 A;  4ZYG A;  1YUI A;  2YRK A;  5LMN E;  1BB8 A;  2WBT A;  1GTK A;  3HTX A;  4I8O A;  1N32 E;  4F9C B;  2D9H A;  2ENH A;  2DB2 A;  1HNW E;  4DV5 E;  2RPC A;  4O24 A;  1FKA E;  1QNT A;  2EM4 A;  3C6M A;  1XNR E;  2LO3 A;  4J8Z A;  4N4R B;  4DV6 E;  2ODR D;  2EMX A;  5AC4 A;  2ENA A;  2EWL A;  4BC7 A;  4JI5 E;  4WYQ B;  1N36 E;  2JVA A;  3EQ1 A;  3T1H E;  2YTO A;  4LF7 E;  4YY3 E;  3H09 A;  3T1Y E;  1PJT A;  1EH7 A;  5KL4 A;  1SR9 A;  2V86 A;  1EH6 A;  1P47 A;  4JI8 E;  2MDR A;  1FJG E;  4R2C A;  5AE3 A;  2EMF A;  2HHH E;  1HNX E;  4DV0 E;  3HPS A;  1NEI A;  4R2D A;  3HQ1 A;  2L2K B;  4JI6 E;  2DSY A;  2L2M A;  3BGH A;  3IWD A;  2JPA A;  2L33 A;  4DKK A;  2EN3 A;  1XMO E;  2UXB E;  2EQ0 A;  4JI7 E;  2VQE E;  2JWO A;  2YTN A;  4B3M E;  1UN6 B;  1WHQ A;  4WFT A;  4DR3 E;  1ZBT A;  1RC7 A;  2EMW A;  4TUI A;  3BF2 A;  2KOU A;  3C6K A;  2RTX A;  2GHF A;  1J5E E;  1X47 A;  2EPO A;  4X8W A;  4OOG C;  2DMI A;  2EN7 A;  1T4L B;  2YTG A;  2RQL A;  4WXD A;  4LF6 E;  2CPN A;  4GKJ E;  5IV8 B;  2H36 X;  2GLI A;  4MLV A;  5CFF E;  1KJK A;  2EPP A;  2EN4 A;  2YTJ A;  3MHH C;  2JYA A;  3J7Y p;  1YUJ A;  1HNZ E;  4B3S E;  4DR7 E;  1X6F A;  2EMC A;  2ODR C;  2RSI A;  3LML A;  1UBD C;  2HGH A;  1N3G A;  2EMI A;  2YTP A;  2WCC 3;  4R2S A;  3DF6 A;  4GEQ B;  4F54 A;  2J7J A;  2VQF E;  3AUZ A;  2K7I A;  2EJ4 A;  2EPM X;  2EOX A;  1A1L A;  4R2A A;  5AE2 A;  3AV0 A;  2K4V A;  2CT1 A;  2MC5 A;  2EOM A;  2RS7 A;  5DNY A;  4X62 E;  1TF3 A;  4WPY A;  4O43 A;  4OX9 E;  3IWB A;  1HR0 E;  1J26 A;  2EQ1 A;  1TF6 A;  1SFE A;  4K0K E;  2EN6 A;  1NCS A;  1IBK E;  4X65 E;  4DV1 E;  1ZAA C;  2EMH A;  2EOY A;  4JI0 E;  3RMP A;  2NUF A;  3TQM A;  4KHP E;  5A6B A;  2N8X A;  2V89 A;  2RSM A;  1YZ9 A;  2DGC A;  4NZV A;  3ZOQ B;  5KL2 A;  1IBL E;  4IS1 C;  4NXN E;  4WSP A;  3P1X A;  3L00 A;  5FLX C;  2VE7 C;  1DI2 A;  3J7A G; 
#chains in the Genus database with same CATH homology
 1WJP A;  1X6H A;  2EM6 A;  2EM5 A;  4R2C A;  5KL7 A;  2EM3 A;  2EOR A;  3UK3 C;  2EPC A;  2YU8 A;  2EMF A;  3MHS C;  2EL5 A;  4R2D A;  1JK2 A;  3EPK A;  1ZR9 A;  2CSH A;  1JK1 A;  2EN2 A;  2JPA A;  2EPZ A;  2EM8 A;  2NAB A;  2ENC A;  2EN3 A;  2EQ3 A;  1MEY C;  5KL5 A;  2EOH A;  2EQ0 A;  3VHT B;  2PRT A;  2YTN A;  2EL6 A;  1UN6 B;  4IJD A;  2MKN A;  2EOS A;  4R2E A;  2CTD A;  3EPH A;  1A1G A;  2YRH A;  2EMW A;  2YSP A;  2ELY A;  2EMA A;  3EPL A;  2GHF A;  2MDG A;  1TN9 A;  2YTE A;  2DMI A;  4GZN C;  2WBU A;  2EN7 A;  3M99 B;  2YTG A;  2A25 A;  2DRP A;  4R2Q A;  5KL6 A;  2ELZ A;  2EOE A;  2GLI A;  1X6E A;  1X5W A;  2EML A;  1G2F C;  1KJK A;  2EPP A;  1X3C A;  2EM2 A;  2EN4 A;  2YTJ A;  4R2P A;  1LLM C;  2I13 A;  2EOQ A;  3MHH C;  2EPA A;  1A1F A;  2LCE A;  1B69 A;  2EMZ A;  2WBS A;  1F2I G;  2EOO A;  1YUJ A;  2EP3 A;  1X6F A;  2EMC A;  4F2J C;  2EM7 A;  2EOF A;  5KL3 A;  2RSI A;  2EMY A;  2EM0 A;  2EOI A;  3EPJ A;  4F6N A;  4M9V C;  2HGH A;  1UBD C;  2EMI A;  1G2D C;  2EE8 A;  2EMG A;  1ZU1 A;  2YTQ A;  2EL4 A;  2YTP A;  2YTI A;  2MKD A;  2WCC 3;  2EN8 A;  4R2S A;  2VRD A;  2YTF A;  1A1I A;  1AAY A;  4F6M A;  2J7J A;  4R2R A;  2LV2 A;  1YUI A;  2YRK A;  1A1H A;  2EJ4 A;  1BB8 A;  1BBO A;  2EOX A;  1A1L A;  2WBT A;  1A1J A;  4R2A A;  2CT1 A;  2BB8 A;  1Z1B A;  2EOM A;  2E72 A;  2R1F A;  2D9H A;  2ENH A;  2YRM A;  1TF3 A;  2LVH A;  2LT7 A;  2EQ1 A;  2RPC A;  1TF6 A;  2EOJ A;  2EM9 A;  2EN6 A;  2EN1 A;  1NCS A;  2EM4 A;  1DGC A;  2LO3 A;  2JP9 A;  2EPU A;  2EMX A;  1ZAA C;  2ENA A;  2EMH A;  2EOY A;  2EMB A;  1YSA C;  1RMD A;  2EPR A;  2YTO A;  4FK5 C;  2ADR A;  2YU5 A;  2DGC A;  5KL2 A;  2M9A A;  2YSO A;  1A1K A;  2EMK A;  2DLK A;  2EOZ A;  2EPX A;  5KL4 A;  4X9J A;  4IS1 C;  4WSG A;  1P47 A;  2DLQ A;  2YTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...