1J26A

Solution structure of a putative peptidyl-trna hydrolase domain in a mouse hypothetical protein
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
112
structure length
112
Chain Sequence
GSSGSSGEHAKQASSYIPLDRLSISYCRSSGPGGQNVNKVNSKAEVRFHLASADWIEEPVRQKIALTHKNKINKAGELVLTSESSRYQFRNLAECLQKIRDMIAEASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immature colon carcinoma transcript 1
publication title Solution structure of the catalytic domain of the mitochondrial protein ICT1 that is essential for cell vitality
pubmed doi rcsb
source organism Mus musculus
molecule tags Translation
total genus 25
structure length 112
sequence length 112
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2002-12-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1j26A01
2YT4A 1XMQE 1IBME 4YHHE 4JI0E 2EZ6A 3LLHA 5LMNE 2HHHE 2IHR1 4DV7E 1N32E 3OTOE 4LFBE 5LMUE 3P1XA 1HNXE 4B3RE 4JV5E 2ZM6E 4X8WA 1HNZE 3C4TA 2KHXA 1XNQE 2L2KB 1X47A 4DV4E 1T4OA 1T4LB 2VQFE 4JI3E 3C4BA 2UXCE 2LTSA 2L3JA 2UUBE 4OX9E 1DI2A 4JI4E 4OOGC 1GQEA 2RS7A 4DV0E 5IWAE 1XNRE 3T1HE 1XMOE 2NUEA 1WHNA 1IBLE 2DB2A 4M2ZA 4DUYE 2UXBE 5BR8E 4JI5E 4LFAE 4NXME 2LTRA 4DUZE 2CPNA 2E5LE 1YZ9A 4YY3E 1N36E 4X66E 2B3TB 1X49A 1RQ0A 4WFTA 2NUGA 4DR1E 2NUFA 3ADGA 4JI1E 2RTXA 4JI6E 4DKKA 2NA2A 1HR0E 3ADLA 2LUQA 2B7VA 2DMYA 3VYYA 2LUPB 1J26A 1IBKE 2RS6A 4GKJE 2UXDE 4DV2E 2DIXA 1T4NA 1YYOA 4X64E 1J5EE 1HNWE 4NXNE 4DR2E 2UUAE 2UUCE 2N3HA 4DV6E 2UU9E 4LF9E 1UILA 4DR7E 4B3TE 4JI8E 4WYQB 2L2MA 2LRSA 4DV3E 4LF6E 3HTXA 1PKPA 2L2NA 4X65E 2LBSB 2F4VE 2MDRA 1QU6A 4DV5E 4LF7E 1UHZA 2JVAA 1EKZA 2LJHA 3ADJA 2RSMA 4B3SE 2L3CA 2L33A 2JY9A 1ZBTA 2N3GA 4LF4E 1N33E 4JYAE 4JI2E 4X62E 1RC7A 4DR3E 3VYXA 4DR4E 4DR6E 2B7TA 5CFFE 3ADIA 1I94E 3T1YE 4JI7E 1X48A 4LF5E 2VQEE 1YYWA 4M30A 4KHPE 1YYKA 1FJGE 4DR5E 1O0WA 4B3ME 4LFCE 1FKAE 4K0KE 1STUA 4DV1E 4GKKE 4LF8E 4AQYE 3J7Yp 1WHQA 1N34E
chains in the Genus database with same CATH superfamily
1IBME 3THNA 3LLHA 2WBUA 2YTJA 2EN7A 1N32E 5AE1A 2ADRA 2LO3A 5LMUE 4M9VC 1HNXE 2DGCA 2V87A 1HNZE 5A6BD 2EPKX 2MDGA 2EOEA 4LTYA 2EOSA 2YTDA 4WPYA 1X6FA 2L2KB 4DV4E 3BIDA 3IWDA 3C4BA 4BC7A 2L3JA 1SR9A 3BGHA 2LVHA 1XMOE 1JK1A 1IMUA 1L4SA 1WHNA 4R2RA 5T6JA 2EMIA 2DB2A 4M0VA 4DUYE 2ENAA 3MSWA 5BR8E 2I9IA 1QNTA 4DUZE 2D9HA 2EPRA 2YTQA 2EL6A 2DRPA 4R2PA 4WX9A 4X66E 1RQ0A 1P47A 3ADGA 5A2QC 4ZYEA 2ENCA 1ZBQA 2UXDE 2DIXA 3JTZA 4X64E 1J5EE 5AE2A 2N3HA 2K7IA 4F9AB 1UILA 2EMZA 4F6MA 1BBGA 4L8NA 2M4IA 2EJ4A 1PKPA 4L5NC 5IT9C 3J7AG 4MLQA 2MDRA 1NCSA 1T39A 4LF7E 3LMLA 4B3SE 3EPKA 2EN3A 2EOJA 1ZBTA 4IJDA 3FIGA 1N33E 4JI2E 4X62E 2EOQA 4DR3E 3HPSA 3OMLA 4DR4E 1TF3A 2VQEE 3F6GA 1YYKA 1ZAAC 3KZZA 2MC6A 2EM9A 4R2QA 1O0WA 4R8OA 2EMWA 5KL6A 3HXLA 1B69A 2R76A 3EQ1A 3F6HA 4R03A 4GKKE 2L8TA 1N34E 2EMKA 2L92A 1XMQE 2EZ6A 1EH6A 2HHHE 2IHR1 3OTOE 1MEYC 2LCEA 5A6BA 4X8WA 4LU9A 2GHFA 3KWRA 2YRKA 3AV0A 3C4TA 1SFEA 2EOYA 2KHXA 2EN4A 2R1FA 1XNQE 1T4OA 2EQ1A 5ADZA 2DSYA 2UXCE 4BCAA 2LTSA 2UUBE 2EOMA 4OX9E 4JI4E 4WXDA 2EMGA 4R2SA 1XNRE 3T1HE 3DJWA 1DGCA 2WZOA 5LLQA 1IBLE 4NZVA 2HGHA 2YRMA 2YTEA 3J80C 4LFAE 1KJKA 2EOXA 3RMPA 2LTRA 1A1HA 1PJTA 2EPLX 1RMDA 4F9BB 1YZ9A 3DF6A 2DMIA 2B3TB 2EOHA 2NUGA 2EPOA 5FLXC 5A69A 4JI1E 2RTXA 4DKKA 2NA2A 2YRHA 2B7VA 2EMYA 4X9JA 2RS6A 1BB8A 2KONA 1YYOA 1YUIA 5A6JA 2HC5A 5KL7A 4DR2E 2UUAE 4GZNC 3UK3C 3EPLA 2UU9E 2M7QA 2FTXB 4DR7E 3ECRA 4B3TE 4KZSA 2LRSA 2B9DA 4DV3E 3HTXA 2EPXA 2F4VE 2L2NA 1YPNA 2EPAA 3MHSC 4DMIA 2EMFA 1EKZA 4FK5C 5AE3A 5DNYA 2EM3A 4LF4E 2EM7A 2YTNA 4Q28A 4RH8A 4JYAE 2EL4A 4TUIA 1RC7A 2JOBA 3M99B 4O4KA 2EOOA 5CFFE 3ADIA 1PJSA 1I94E 1GTKA 3AUZA 3KZYA 2EN8A 2EOIA 4WXCA 2EM0A 1AH5A 2EQ3A 2EORA 2LJUA 2Q8UA 4ZYDA 2EN2A 1FKAE 2RSIA 3C6MA 2EM6A 1STUA 4DV1E 2WCC3 4LF8E 3IWCA 1WHQA 1A1LA 3MHHC 1X6EA 2ELYA 2YT4A 4YHHE 1KYQA 2ODRC 1NEIA 2JYAA 5LMNE 2L6MA 4DV7E 2JR1A 5KL4A 1EH7A 4JV5E 2ZM6E 2LV2A 2YWQA 2NABA 2CTDA 2YTOA 1T4LB 4JI3E 1UBDC 2A25A 4ZYHA 3IWBA 2YTIA 4DV0E 5IWAE 2CT1A 2YU5A 2EWLA 5A6KA 2JPAA 3ZOQB 2NUEA 1EH8A 2MKNA 3VK6A 5IV8B 1YSAC 4M2ZA 1BBOA 4P78A 2UXBE 2JP9A 2M9AA 4JI5E 2EM8A 2DLKA 2EPPA 4P7DA 2YTFA 2CPNA 2GPIA 2E5LE 2EMCA 1N36E 4NHRA 1X49A 4MLVA 4WFTA 4DR1E 1N3GA 3QG5C 4KWYA 2YSOA 2EL5A 3JU0A 4JI6E 1HR0E 3ADLA 3VYYA 2E72A 3BBGA 1LLMC 4GKJE 2EPZA 2EPUA 2BBGA 1PDAA 1PJQA 2V86A 3EPJA 3H09A 4O43A 2LE2A 4DV6E 2WBTA 4GEQB 1A1IA 2YPNA 4WYQB 4LF6E 2F8BA 1G2DC 2LJHA 2YU8A 1G2FC 1UN6B 2JOXA 2V88A 2L3CA 2EMLA 5AASA 4HEIA 1JK2A 2MC5A 2JXPA 2FGGA 4R2AA 4Q35B 2EN6A 1GZ6A 4I8OA 2EQ0A 3TQMA 2VF1A 3VYXA 2LT7A 4WSPA 4DR6E 3T1YE 2MKDA 2BB8A 4LF5E 1YYWA 4M30A 4KHPE 4IS1C 4F6NA 2LMZA 3L00A 2V8QB 2RQLA 1FJGE 2HJJA 2V85A 4DR5E 4B3ME 1MGTA 2EMBA 4LFCE 4K0KE 3HQ1A 2EPMX 1TF6A 4N4RB 4BHBA 2VE7C 2I13A 5LL6R 2EM2A 2EM4A 4WSGA 3HPZA 2YTPA 4R2EA 4JI0E 2EP3A 1IQOA 4ZYGA 2EMHA 2H36X 4BC9A 4O24A 3J81C 2EPNA 1TN9A 1DQ3A 4LFBE 3P1XA 4B3RE 2DLQA 2YZTA 3C6KA 1YUJA 5KL3A 1WJPA 4F2JC 5KL5A 1X47A 2ENHA 1A1JA 1X6HA 2VQFE 2CSHA 2WBSA 1DI2A 2PRTA 5TSEA 4OOGC 1GQEA 2RPCA 2RS7A 3VHTB 4BMJA 1X3CA 2K4VA 2M1SA 4TUGA 1ZR9A 2KOUA 4NXME 4BBYA 4R2CA 2N8XA 2ODRD 2EMAA 5AC4A 4YY3E 2EM5A 2NUFA 5KL2A 2E1MA 1YFHA 1T38A 4BS9A 1IQSA 2LUQA 3THOB 2DMYA 2LUPB 1J26A 1IBKE 3K6QA 1A1KA 2ELZA 4DV2E 2V89A 1T4NA 2EOZA 2VRDA 2EMXA 3BF2A 4R2DA 1HNWE 5IXMB 4NXNE 2UUCE 3JAMC 4LF9E 2G7HA 1Z1BA 2GLIA 2V83A 4J8ZA 4JI8E 2L2MA 2JWOA 4X65E 2LBSB 2EPCA 1QU6A 2FV4B 4DV5E 2EE8A 1UHZA 1WRJA 2J7JA 2JVAA 5F3WA 3ADJA 2RSMA 2L33A 4O5GA 2JY9A 2EOFA 1ZU1A 2N3GA 2YSPA 1AAYA 4HTGA 5AC5A 4BHCA 4F54A 1WXRA 2B7TA 1A1GA 4JI7E 1X48A 4RHBB 5A6AA 1A1FA 3EPHA 1X5WA 2EN1A 2YTGA 4AQYE 3J7Yp 1F2IG 4F9CB
chains in the Genus database with same CATH topology
2L92A 2YT4A 1XMQE 1IBME 3HPZA 4YHHE 4JI0E 2ODRC 2EZ6A 3LLHA 5LMNE 2HHHE 2H36X 4BC9A 2IHR1 2L6MA 4DV7E 3J81C 1N32E 2JR1A 5AE1A 3OTOE 4LFBE 1DQ3A 5LMUE 3P1XA 1HNXE 4B3RE 4JV5E 2YZTA 2ZM6E 4X8WA 2F4VE 2V87A 4LU9A 1HNZE 3KWRA 3AV0A 3C4TA 2KHXA 4LTYA 4WPYA 1XNQE 2L2KB 1X47A 4DV4E 1T4OA 5ADZA 1T4LB 3IWDA 2VQFE 4JI3E 3C4BA 2DSYA 4BC7A 4BCAA 2UXCE 2LTSA 2L3JA 2UUBE 1SR9A 4OX9E 3IWBA 1DI2A 4JI4E 4OOGC 1GQEA 2RS7A 4DV0E 5IWAE 1XNRE 3T1HE 1XMOE 3DJWA 4BMJA 2EWLA 2K4VA 2M1SA 2WZOA 3ZOQB 2NUEA 1WHNA 3VK6A 4TUGA 5T6JA 1IBLE 2DB2A 4M0VA 4M2ZA 4DUYE 4P78A 2UXBE 3MSWA 5BR8E 3J80C 4JI5E 2KOUA 4LFAE 4NXME 4P7DA 3RMPA 2LTRA 4DUZE 4BBYA 2CPNA 2ODRD 4F9BB 2E5LE 1YZ9A 4YY3E 3DF6A 1N36E 4X66E 2B3TB 1X49A 1RQ0A 4WFTA 2NUGA 4DR1E 2NUFA 3ADGA 5FLXC 4JI1E 2E1MA 5A2QC 2RTXA 3JU0A 4BS9A 4JI6E 4DKKA 2NA2A 1HR0E 3ADLA 2LUQA 2B7VA 2DMYA 3VYYA 2LUPB 1J26A 1IBKE 2RS6A 3K6QA 1ZBQA 4GKJE 2KONA 2UXDE 4DV2E 2DIXA 2V89A 1T4NA 1YYOA 2V86A 3H09A 3JTZA 4X64E 1J5EE 1HNWE 4NXNE 4DR2E 2UUAE 5AE2A 2N3HA 2UUCE 2LE2A 4DV6E 3JAMC 4F9AB 2UU9E 4GEQB 2M7QA 4LF9E 1UILA 2G7HA 2FTXB 4DR7E 2V83A 4J8ZA 4B3TE 4JI8E 4WYQB 4L8NA 2L2MA 2JWOA 4KZSA 2LRSA 2B9DA 2M4IA 4DV3E 4LF6E 2F8BA 1PKPA 2L2NA 4L5NC 4X65E 2LBSB 2MDRA 1QU6A 2FV4B 4DV5E 5IT9C 4LF7E 3J7AG 1UHZA 4DMIA 2JVAA 1EKZA 5F3WA 2LJHA 3ADJA 2RSMA 3LMLA 5AE3A 4B3SE 2JOXA 2V88A 2L33A 5DNYA 5AASA 2L3CA 2JY9A 1ZBTA 2MC5A 2FGGA 2N3GA 3FIGA 4LF4E 1N33E 4Q28A 1GZ6A 4JYAE 4JI2E 4X62E 4TUIA 3HTXA 4I8OA 1RC7A 2JOBA 4DR3E 2VF1A 3HPSA 3VYXA 3OMLA 4WSPA 4DR4E 4F54A 4DR6E 1WXRA 2B7TA 5CFFE 3ADIA 1I94E 3T1YE 4JI7E 1X48A 3AUZA 2VQEE 4LF5E 4M30A 3F6GA 1YYWA 4KHPE 1YYKA 2LMZA 2V8QB 2MC6A 1FJGE 2V85A 4DR5E 1O0WA 4B3ME 4R8OA 4LFCE 1FKAE 4K0KE 3HQ1A 3HXLA 1STUA 3F6HA 4DV1E 4R03A 4GKKE 2L8TA 4LF8E 4AQYE 2VE7C 1WHQA 3IWCA 4F9CB 3J7Yp 1N34E 5LL6R
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YT4 A;  1XMQ E;  1IBM E;  4YHH E;  4JI0 E;  2EZ6 A;  3LLH A;  5LMN E;  2HHH E;  2IHR 1;  4DV7 E;  1N32 E;  3OTO E;  4LFB E;  5LMU E;  3P1X A;  1HNX E;  4B3R E;  4JV5 E;  2ZM6 E;  4X8W A;  1HNZ E;  3C4T A;  2KHX A;  1XNQ E;  2L2K B;  1X47 A;  4DV4 E;  1T4O A;  1T4L B;  2VQF E;  4JI3 E;  3C4B A;  2UXC E;  2LTS A;  2L3J A;  2UUB E;  4OX9 E;  1DI2 A;  4JI4 E;  4OOG C;  1GQE A;  2RS7 A;  4DV0 E;  5IWA E;  1XNR E;  3T1H E;  1XMO E;  2NUE A;  1WHN A;  1IBL E;  2DB2 A;  4M2Z A;  4DUY E;  2UXB E;  5BR8 E;  4JI5 E;  4LFA E;  4NXM E;  2LTR A;  4DUZ E;  2CPN A;  2E5L E;  1YZ9 A;  4YY3 E;  1N36 E;  4X66 E;  2B3T B;  1X49 A;  1RQ0 A;  4WFT A;  2NUG A;  4DR1 E;  2NUF A;  3ADG A;  4JI1 E;  2RTX A;  4JI6 E;  4DKK A;  2NA2 A;  1HR0 E;  3ADL A;  2LUQ A;  2B7V A;  2DMY A;  3VYY A;  2LUP B;  1J26 A;  1IBK E;  2RS6 A;  4GKJ E;  2UXD E;  4DV2 E;  2DIX A;  1T4N A;  1YYO A;  4X64 E;  1J5E E;  1HNW E;  4NXN E;  4DR2 E;  2UUA E;  2UUC E;  2N3H A;  4DV6 E;  2UU9 E;  4LF9 E;  1UIL A;  4DR7 E;  4B3T E;  4JI8 E;  4WYQ B;  2L2M A;  2LRS A;  4DV3 E;  4LF6 E;  3HTX A;  1PKP A;  2L2N A;  4X65 E;  2LBS B;  2F4V E;  2MDR A;  1QU6 A;  4DV5 E;  4LF7 E;  1UHZ A;  2JVA A;  1EKZ A;  2LJH A;  3ADJ A;  2RSM A;  4B3S E;  2L3C A;  2L33 A;  2JY9 A;  1ZBT A;  2N3G A;  4LF4 E;  1N33 E;  4JYA E;  4JI2 E;  4X62 E;  1RC7 A;  4DR3 E;  3VYX A;  4DR4 E;  4DR6 E;  2B7T A;  5CFF E;  3ADI A;  1I94 E;  3T1Y E;  4JI7 E;  1X48 A;  4LF5 E;  2VQE E;  1YYW A;  4M30 A;  4KHP E;  1YYK A;  1FJG E;  4DR5 E;  1O0W A;  4B3M E;  4LFC E;  1FKA E;  4K0K E;  1STU A;  4DV1 E;  4GKK E;  4LF8 E;  4AQY E;  3J7Y p;  1WHQ A;  1N34 E; 
#chains in the Genus database with same CATH topology
 1IBM E;  3THN A;  3LLH A;  2WBU A;  2YTJ A;  2EN7 A;  1N32 E;  5AE1 A;  2ADR A;  2LO3 A;  5LMU E;  4M9V C;  1HNX E;  2DGC A;  2V87 A;  1HNZ E;  5A6B D;  2EPK X;  2MDG A;  2EOE A;  4LTY A;  2EOS A;  2YTD A;  4WPY A;  1X6F A;  2L2K B;  4DV4 E;  3BID A;  3IWD A;  3C4B A;  4BC7 A;  2L3J A;  1SR9 A;  3BGH A;  2LVH A;  1XMO E;  1JK1 A;  1IMU A;  1L4S A;  1WHN A;  4R2R A;  5T6J A;  2EMI A;  2DB2 A;  4M0V A;  4DUY E;  2ENA A;  3MSW A;  5BR8 E;  2I9I A;  1QNT A;  4DUZ E;  2D9H A;  2EPR A;  2YTQ A;  2EL6 A;  2DRP A;  4R2P A;  4WX9 A;  4X66 E;  1RQ0 A;  1P47 A;  3ADG A;  5A2Q C;  4ZYE A;  2ENC A;  1ZBQ A;  2UXD E;  2DIX A;  3JTZ A;  4X64 E;  1J5E E;  5AE2 A;  2N3H A;  2K7I A;  4F9A B;  1UIL A;  2EMZ A;  4F6M A;  1BBG A;  4L8N A;  2M4I A;  2EJ4 A;  1PKP A;  4L5N C;  5IT9 C;  3J7A G;  4MLQ A;  2MDR A;  1NCS A;  1T39 A;  4LF7 E;  3LML A;  4B3S E;  3EPK A;  2EN3 A;  2EOJ A;  1ZBT A;  4IJD A;  3FIG A;  1N33 E;  4JI2 E;  4X62 E;  2EOQ A;  4DR3 E;  3HPS A;  3OML A;  4DR4 E;  1TF3 A;  2VQE E;  3F6G A;  1YYK A;  1ZAA C;  3KZZ A;  2MC6 A;  2EM9 A;  4R2Q A;  1O0W A;  4R8O A;  2EMW A;  5KL6 A;  3HXL A;  1B69 A;  2R76 A;  3EQ1 A;  3F6H A;  4R03 A;  4GKK E;  2L8T A;  1N34 E;  2EMK A;  2L92 A;  1XMQ E;  2EZ6 A;  1EH6 A;  2HHH E;  2IHR 1;  3OTO E;  1MEY C;  2LCE A;  5A6B A;  4X8W A;  4LU9 A;  2GHF A;  3KWR A;  2YRK A;  3AV0 A;  3C4T A;  1SFE A;  2EOY A;  2KHX A;  2EN4 A;  2R1F A;  1XNQ E;  1T4O A;  2EQ1 A;  5ADZ A;  2DSY A;  2UXC E;  4BCA A;  2LTS A;  2UUB E;  2EOM A;  4OX9 E;  4JI4 E;  4WXD A;  2EMG A;  4R2S A;  1XNR E;  3T1H E;  3DJW A;  1DGC A;  2WZO A;  5LLQ A;  1IBL E;  4NZV A;  2HGH A;  2YRM A;  2YTE A;  3J80 C;  4LFA E;  1KJK A;  2EOX A;  3RMP A;  2LTR A;  1A1H A;  1PJT A;  2EPL X;  1RMD A;  4F9B B;  1YZ9 A;  3DF6 A;  2DMI A;  2B3T B;  2EOH A;  2NUG A;  2EPO A;  5FLX C;  5A69 A;  4JI1 E;  2RTX A;  4DKK A;  2NA2 A;  2YRH A;  2B7V A;  2EMY A;  4X9J A;  2RS6 A;  1BB8 A;  2KON A;  1YYO A;  1YUI A;  5A6J A;  2HC5 A;  5KL7 A;  4DR2 E;  2UUA E;  4GZN C;  3UK3 C;  3EPL A;  2UU9 E;  2M7Q A;  2FTX B;  4DR7 E;  3ECR A;  4B3T E;  4KZS A;  2LRS A;  2B9D A;  4DV3 E;  3HTX A;  2EPX A;  2F4V E;  2L2N A;  1YPN A;  2EPA A;  3MHS C;  4DMI A;  2EMF A;  1EKZ A;  4FK5 C;  5AE3 A;  5DNY A;  2EM3 A;  4LF4 E;  2EM7 A;  2YTN A;  4Q28 A;  4RH8 A;  4JYA E;  2EL4 A;  4TUI A;  1RC7 A;  2JOB A;  3M99 B;  4O4K A;  2EOO A;  5CFF E;  3ADI A;  1PJS A;  1I94 E;  1GTK A;  3AUZ A;  3KZY A;  2EN8 A;  2EOI A;  4WXC A;  2EM0 A;  1AH5 A;  2EQ3 A;  2EOR A;  2LJU A;  2Q8U A;  4ZYD A;  2EN2 A;  1FKA E;  2RSI A;  3C6M A;  2EM6 A;  1STU A;  4DV1 E;  2WCC 3;  4LF8 E;  3IWC A;  1WHQ A;  1A1L A;  3MHH C;  1X6E A;  2ELY A;  2YT4 A;  4YHH E;  1KYQ A;  2ODR C;  1NEI A;  2JYA A;  5LMN E;  2L6M A;  4DV7 E;  2JR1 A;  5KL4 A;  1EH7 A;  4JV5 E;  2ZM6 E;  2LV2 A;  2YWQ A;  2NAB A;  2CTD A;  2YTO A;  1T4L B;  4JI3 E;  1UBD C;  2A25 A;  4ZYH A;  3IWB A;  2YTI A;  4DV0 E;  5IWA E;  2CT1 A;  2YU5 A;  2EWL A;  5A6K A;  2JPA A;  3ZOQ B;  2NUE A;  1EH8 A;  2MKN A;  3VK6 A;  5IV8 B;  1YSA C;  4M2Z A;  1BBO A;  4P78 A;  2UXB E;  2JP9 A;  2M9A A;  4JI5 E;  2EM8 A;  2DLK A;  2EPP A;  4P7D A;  2YTF A;  2CPN A;  2GPI A;  2E5L E;  2EMC A;  1N36 E;  4NHR A;  1X49 A;  4MLV A;  4WFT A;  4DR1 E;  1N3G A;  3QG5 C;  4KWY A;  2YSO A;  2EL5 A;  3JU0 A;  4JI6 E;  1HR0 E;  3ADL A;  3VYY A;  2E72 A;  3BBG A;  1LLM C;  4GKJ E;  2EPZ A;  2EPU A;  2BBG A;  1PDA A;  1PJQ A;  2V86 A;  3EPJ A;  3H09 A;  4O43 A;  2LE2 A;  4DV6 E;  2WBT A;  4GEQ B;  1A1I A;  2YPN A;  4WYQ B;  4LF6 E;  2F8B A;  1G2D C;  2LJH A;  2YU8 A;  1G2F C;  1UN6 B;  2JOX A;  2V88 A;  2L3C A;  2EML A;  5AAS A;  4HEI A;  1JK2 A;  2MC5 A;  2JXP A;  2FGG A;  4R2A A;  4Q35 B;  2EN6 A;  1GZ6 A;  4I8O A;  2EQ0 A;  3TQM A;  2VF1 A;  3VYX A;  2LT7 A;  4WSP A;  4DR6 E;  3T1Y E;  2MKD A;  2BB8 A;  4LF5 E;  1YYW A;  4M30 A;  4KHP E;  4IS1 C;  4F6N A;  2LMZ A;  3L00 A;  2V8Q B;  2RQL A;  1FJG E;  2HJJ A;  2V85 A;  4DR5 E;  4B3M E;  1MGT A;  2EMB A;  4LFC E;  4K0K E;  3HQ1 A;  2EPM X;  1TF6 A;  4N4R B;  4BHB A;  2VE7 C;  2I13 A;  5LL6 R;  2EM2 A;  2EM4 A;  4WSG A;  3HPZ A;  2YTP A;  4R2E A;  4JI0 E;  2EP3 A;  1IQO A;  4ZYG A;  2EMH A;  2H36 X;  4BC9 A;  4O24 A;  3J81 C;  2EPN A;  1TN9 A;  1DQ3 A;  4LFB E;  3P1X A;  4B3R E;  2DLQ A;  2YZT A;  3C6K A;  1YUJ A;  5KL3 A;  1WJP A;  4F2J C;  5KL5 A;  1X47 A;  2ENH A;  1A1J A;  1X6H A;  2VQF E;  2CSH A;  2WBS A;  1DI2 A;  2PRT A;  5TSE A;  4OOG C;  1GQE A;  2RPC A;  2RS7 A;  3VHT B;  4BMJ A;  1X3C A;  2K4V A;  2M1S A;  4TUG A;  1ZR9 A;  2KOU A;  4NXM E;  4BBY A;  4R2C A;  2N8X A;  2ODR D;  2EMA A;  5AC4 A;  4YY3 E;  2EM5 A;  2NUF A;  5KL2 A;  2E1M A;  1YFH A;  1T38 A;  4BS9 A;  1IQS A;  2LUQ A;  3THO B;  2DMY A;  2LUP B;  1J26 A;  1IBK E;  3K6Q A;  1A1K A;  2ELZ A;  4DV2 E;  2V89 A;  1T4N A;  2EOZ A;  2VRD A;  2EMX A;  3BF2 A;  4R2D A;  1HNW E;  5IXM B;  4NXN E;  2UUC E;  3JAM C;  4LF9 E;  2G7H A;  1Z1B A;  2GLI A;  2V83 A;  4J8Z A;  4JI8 E;  2L2M A;  2JWO A;  4X65 E;  2LBS B;  2EPC A;  1QU6 A;  2FV4 B;  4DV5 E;  2EE8 A;  1UHZ A;  1WRJ A;  2J7J A;  2JVA A;  5F3W A;  3ADJ A;  2RSM A;  2L33 A;  4O5G A;  2JY9 A;  2EOF A;  1ZU1 A;  2N3G A;  2YSP A;  1AAY A;  4HTG A;  5AC5 A;  4BHC A;  4F54 A;  1WXR A;  2B7T A;  1A1G A;  4JI7 E;  1X48 A;  4RHB B;  5A6A A;  1A1F A;  3EPH A;  1X5W A;  2EN1 A;  2YTG A;  4AQY E;  3J7Y p;  1F2I G;  4F9C B; 
#chains in the Genus database with same CATH homology
 2L92 A;  2YT4 A;  1XMQ E;  1IBM E;  3HPZ A;  4YHH E;  4JI0 E;  2ODR C;  2EZ6 A;  3LLH A;  5LMN E;  2HHH E;  2H36 X;  4BC9 A;  2IHR 1;  2L6M A;  4DV7 E;  3J81 C;  1N32 E;  2JR1 A;  5AE1 A;  3OTO E;  4LFB E;  1DQ3 A;  5LMU E;  3P1X A;  1HNX E;  4B3R E;  4JV5 E;  2YZT A;  2ZM6 E;  4X8W A;  2F4V E;  2V87 A;  4LU9 A;  1HNZ E;  3KWR A;  3AV0 A;  3C4T A;  2KHX A;  4LTY A;  4WPY A;  1XNQ E;  2L2K B;  1X47 A;  4DV4 E;  1T4O A;  5ADZ A;  1T4L B;  3IWD A;  2VQF E;  4JI3 E;  3C4B A;  2DSY A;  4BC7 A;  4BCA A;  2UXC E;  2LTS A;  2L3J A;  2UUB E;  1SR9 A;  4OX9 E;  3IWB A;  1DI2 A;  4JI4 E;  4OOG C;  1GQE A;  2RS7 A;  4DV0 E;  5IWA E;  1XNR E;  3T1H E;  1XMO E;  3DJW A;  4BMJ A;  2EWL A;  2K4V A;  2M1S A;  2WZO A;  3ZOQ B;  2NUE A;  1WHN A;  3VK6 A;  4TUG A;  5T6J A;  1IBL E;  2DB2 A;  4M0V A;  4M2Z A;  4DUY E;  4P78 A;  2UXB E;  3MSW A;  5BR8 E;  3J80 C;  4JI5 E;  2KOU A;  4LFA E;  4NXM E;  4P7D A;  3RMP A;  2LTR A;  4DUZ E;  4BBY A;  2CPN A;  2ODR D;  4F9B B;  2E5L E;  1YZ9 A;  4YY3 E;  3DF6 A;  1N36 E;  4X66 E;  2B3T B;  1X49 A;  1RQ0 A;  4WFT A;  2NUG A;  4DR1 E;  2NUF A;  3ADG A;  5FLX C;  4JI1 E;  2E1M A;  5A2Q C;  2RTX A;  3JU0 A;  4BS9 A;  4JI6 E;  4DKK A;  2NA2 A;  1HR0 E;  3ADL A;  2LUQ A;  2B7V A;  2DMY A;  3VYY A;  2LUP B;  1J26 A;  1IBK E;  2RS6 A;  3K6Q A;  1ZBQ A;  4GKJ E;  2KON A;  2UXD E;  4DV2 E;  2DIX A;  2V89 A;  1T4N A;  1YYO A;  2V86 A;  3H09 A;  3JTZ A;  4X64 E;  1J5E E;  1HNW E;  4NXN E;  4DR2 E;  2UUA E;  5AE2 A;  2N3H A;  2UUC E;  2LE2 A;  4DV6 E;  3JAM C;  4F9A B;  2UU9 E;  4GEQ B;  2M7Q A;  4LF9 E;  1UIL A;  2G7H A;  2FTX B;  4DR7 E;  2V83 A;  4J8Z A;  4B3T E;  4JI8 E;  4WYQ B;  4L8N A;  2L2M A;  2JWO A;  4KZS A;  2LRS A;  2B9D A;  2M4I A;  4DV3 E;  4LF6 E;  2F8B A;  1PKP A;  2L2N A;  4L5N C;  4X65 E;  2LBS B;  2MDR A;  1QU6 A;  2FV4 B;  4DV5 E;  5IT9 C;  4LF7 E;  3J7A G;  1UHZ A;  4DMI A;  2JVA A;  1EKZ A;  5F3W A;  2LJH A;  3ADJ A;  2RSM A;  3LML A;  5AE3 A;  4B3S E;  2JOX A;  2V88 A;  2L33 A;  5DNY A;  5AAS A;  2L3C A;  2JY9 A;  1ZBT A;  2MC5 A;  2FGG A;  2N3G A;  3FIG A;  4LF4 E;  1N33 E;  4Q28 A;  1GZ6 A;  4JYA E;  4JI2 E;  4X62 E;  4TUI A;  3HTX A;  4I8O A;  1RC7 A;  2JOB A;  4DR3 E;  2VF1 A;  3HPS A;  3VYX A;  3OML A;  4WSP A;  4DR4 E;  4F54 A;  4DR6 E;  1WXR A;  2B7T A;  5CFF E;  3ADI A;  1I94 E;  3T1Y E;  4JI7 E;  1X48 A;  3AUZ A;  2VQE E;  4LF5 E;  4M30 A;  3F6G A;  1YYW A;  4KHP E;  1YYK A;  2LMZ A;  2V8Q B;  2MC6 A;  1FJG E;  2V85 A;  4DR5 E;  1O0W A;  4B3M E;  4R8O A;  4LFC E;  1FKA E;  4K0K E;  3HQ1 A;  3HXL A;  1STU A;  3F6H A;  4DV1 E;  4R03 A;  4GKK E;  2L8T A;  4LF8 E;  4AQY E;  2VE7 C;  1WHQ A;  3IWC A;  4F9C B;  3J7Y p;  1N34 E;  5LL6 R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...