1J26A

Solution structure of a putative peptidyl-trna hydrolase domain in a mouse hypothetical protein
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
112
structure length
112
Chain Sequence
GSSGSSGEHAKQASSYIPLDRLSISYCRSSGPGGQNVNKVNSKAEVRFHLASADWIEEPVRQKIALTHKNKINKAGELVLTSESSRYQFRNLAECLQKIRDMIAEASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immature colon carcinoma transcript 1
publication title Solution structure of the catalytic domain of the mitochondrial protein ICT1 that is essential for cell vitality
pubmed doi rcsb
source organism Mus musculus
molecule tags Translation
total genus 25
structure length 112
sequence length 112
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2002-12-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1j26A01
1T4OA 1J5EE 3VYYA 1X47A 4JI3E 4DV6E 1PKPA 4DUZE 3C4BA 4DR2E 4X8WA 3LLHA 4B3SE 4LF8E 3VYXA 2L3CA 2B7TA 2LBSB 1HNWE 4DR1E 2JVAA 2LTRA 5IWAE 3ADLA 2NUGA 2L2NA 4DR4E 1FJGE 5CFFE 2L2MA 4YHHE 1X49A 1I94E 2LRSA 4WYQB 4NXNE 4DV7E 4B3TE 2RS7A 2EZ6A 4JI7E 4DR6E 1T4LB 2L3JA 2RSMA 3ADGA 4JI1E 1YYWA 4DR3E 1RC7A 2UXCE 1J26A 1EKZA 1ZBTA 4DKKA 2IHR1 4K0KE 1UHZA 4JI2E 4NXME 2MDRA 1XMQE 4GKJE 4LF9E 3OTOE 1STUA 4JI8E 2DB2A 2ZM6E 1UILA 1WHNA 4JI0E 4YY3E 1GQEA 2RS6A 4LF4E 4DR7E 1RQ0A 4OX9E 2YT4A 3T1HE 2KHXA 1T4NA 1N32E 1IBKE 2L33A 2DMYA 3C4TA 1O0WA 4DV2E 1YYOA 4LFBE 4JI4E 2UUAE 1HNZE 2LJHA 1YYKA 2DIXA 2N3GA 1IBME 1IBLE 1WHQA 4JI6E 4LF5E 3P1XA 4X66E 1N36E 2UU9E 5LMNE 2NUEA 4B3RE 3T1YE 4DV3E 4DR5E 4B3ME 1XNRE 4X62E 4M30A 2N3HA 4OOGC 3J7Yp 2LUPB 1HNXE 2UUBE 2CPNA 2VQEE 4JYAE 1X48A 2UUCE 3ADJA 4AQYE 2L2KB 4DV1E 2UXBE 3ADIA 5LMUE 5BR8E 4DV4E 4LF7E 1DI2A 2NA2A 1XMOE 2VQFE 1XNQE 4X65E 2B7VA 4X64E 4DUYE 4LF6E 4KHPE 2E5LE 2B3TB 2LTSA 4DV0E 1QU6A 4JI5E 4LFCE 1HR0E 2UXDE 4WFTA 4LFAE 1N34E 2HHHE 3HTXA 4JV5E 1N33E 2LUQA 4M2ZA 2JY9A 1YZ9A 2RTXA 2F4VE 4GKKE 2NUFA 4DV5E 1FKAE
chains in the Genus database with same CATH superfamily
2EMGA 1T4OA 4WSGA 2G7HA 4DV6E 4DUZE 5AE3A 4R2EA 2V87A 3VYXA 5F3WA 2LBSB 2DRPA 2L6MA 2LTRA 3H09A 1A1LA 2NUGA 5KL6A 2L2NA 4DR4E 2EWLA 1EH8A 2L2MA 4KWYA 2EL6A 2FGGA 2DGCA 1IQSA 3THNA 4DV7E 4B3TE 2RS7A 2GLIA 2EMCA 2L3JA 2VF1A 2UXCE 2CSHA 1A1FA 5KL5A 2EMHA 2KONA 3MHSC 2EMFA 2EPRA 4IS1C 2EOOA 4O43A 2V88A 4JI0E 2E1MA 2EM8A 3JTZA 2ENCA 2YSOA 5TSEA 2EM2A 2EOMA 4BC7A 2KHXA 4BS9A 2DSYA 1X6HA 2EQ3A 3BGHA 1YYOA 3F6GA 4JI4E 2CTDA 2UUAE 1NCSA 2YTEA 1IBLE 1WHQA 3BF2A 1BBGA 4JI6E 4BMJA 5AE2A 2WBSA 4RHBB 2K4VA 4WX9A 4B3RE 3T1YE 1AH5A 1B69A 4X62E 4LTYA 2N3HA 2RQLA 4MLQA 3J7Yp 2JWOA 2UUBE 2CPNA 2EPKX 1PJTA 3IWDA 2EM9A 1WRJA 2L2KB 3KZYA 2VRDA 4DV1E 1T39A 2M1SA 2EMLA 5BR8E 5LMUE 4L5NC 4R2CA 5T6JA 4P7DA 3TQMA 4O5GA 4R2PA 1XNQE 5LLQA 2B7VA 2HGHA 2FV4B 5AASA 2EL4A 2EPZA 1SR9A 3J80C 2EMXA 1PJQA 1N34E 2MDGA 2YTFA 2V89A 4M2ZA 2JY9A 4DMIA 2DLKA 1MEYC 4DV5E 2I13A 4HTGA 1UN6B 5IV8B 3AV0A 2YTQA 2NABA 3EQ1A 1YSAC 3HPSA 3THOB 4R2SA 4X8WA 1A1IA 5FLXC 2L8TA 4B3SE 4LF8E 2B7TA 1HNWE 2EMIA 2EOYA 3ADLA 2EPLX 1FJGE 5CFFE 1BBOA 1X49A 1I94E 4WYQB 3JU0A 2ODRC 3C6KA 1X6EA 4DR6E 2EN7A 2YRHA 1WJPA 4F9BB 2YTJA 1X6FA 3EPLA 4NXME 2MDRA 5ADZA 2EM3A 1STUA 4JI8E 3DF6A 2DB2A 1L4SA 4F54A 1UILA 4RH8A 4NZVA 5AC5A 1WHNA 4YY3E 4KZSA 4DR7E 2JYAA 2EPPA 2ENHA 2LMZA 1RQ0A 2YT4A 2YTIA 2R1FA 5LL6R 3C6MA 2N8XA 2V86A 3F6HA 1O0WA 1X3CA 3C4TA 2LO3A 4F2JC 1G2FC 3HXLA 2LE2A 4R2QA 1TF6A 4O24A 1IBME 4O4KA 3P1XA 2EOQA 2EMBA 2H36X 4X66E 2DLQA 1N36E 5LMNE 2KOUA 2EMYA 2B9DA 4OOGC 3VK6A 1X48A 5AE1A 2EM5A 2EMWA 2MKNA 1YFHA 1A1GA 1AAYA 3ADIA 3J81C 2YTPA 3HQ1A 1XMOE 1N3GA 3EPJA 2HJJA 4DUYE 1KYQA 4LF6E 1GTKA 4KHPE 2B3TB 4DV0E 3VHTB 1QU6A 4JI5E 2EORA 2EPOA 2Q8UA 5A6JA 2UXDE 1GZ6A 1TN9A 5A6BA 4WPYA 4R2AA 1A1KA 2EOXA 2DMIA 3M99B 2EN3A 4BHCA 2EOIA 5KL2A 1X5WA 3HPZA 1JK2A 2HC5A 3LLHA 1A1JA 1YUIA 4WXCA 4F6NA 2L3CA 1YPNA 2R76A 4FK5C 5IWAE 2ELYA 1BB8A 2EQ1A 2BBGA 1F2IG 2LRSA 2EPUA 3LMLA 5A6AA 1EH6A 4NXNE 2D9HA 2MC5A 2EJ4A 2YWQA 2J7JA 4WSPA 2EZ6A 3EPKA 4BHBA 2V85A 2EE8A 1T4LB 2RSMA 3ADGA 1YYWA 2LT7A 3IWCA 1J26A 1EKZA 2IHR1 2WCC3 4GKJE 1WXRA 2EPAA 2BB8A 4LF9E 1SFEA 1ZBQA 2JXPA 2EPMX 2K7IA 2WZOA 2YRMA 2YU5A 2ELZA 4HEIA 2RS6A 3OMLA 4LF4E 4I8OA 4BBYA 1YUJA 4OX9E 2EN4A 2PRTA 2EPNA 1N32E 4ZYGA 4IJDA 2L33A 2JPAA 4DV2E 1QNTA 1HNZE 2LJHA 4NHRA 1YYKA 2DIXA 2N3GA 4LF5E 2EOHA 4R2DA 2L92A 1P47A 4B3ME 1ZR9A 2LV2A 1XNRE 2EOEA 2EQ0A 1KJKA 1MGTA 4Q35B 2EOZA 2YTOA 1PDAA 4ZYEA 4Q28A 1Z1BA 4X9JA 1DQ3A 2EN8A 2ADRA 4DV4E 1DI2A 2EM7A 5DNYA 2RSIA 4M9VC 2NA2A 2FTXB 2VQFE 2EOSA 4X64E 4F9AB 2E5LE 2EN2A 2YPNA 3KZZA 2E72A 2EOJA 2WBTA 3ECRA 4WFTA 4JV5E 1G2DC 2F4VE 4GKKE 4L8NA 4GEQB 1A1HA 2JP9A 2EN6A 1TF3A 1T38A 2YTNA 2YZTA 1J5EE 3VYYA 1X47A 4JI3E 3J7AG 2EMKA 1PKPA 3C4BA 1PJSA 4DR2E 2EPXA 4GZNC 2EMZA 4R8OA 3RMPA 3BIDA 4R2RA 4DR1E 2JVAA 2EM4A 2JOXA 1EH7A 2LCEA 4P78A 5AC4A 1UBDC 2EM0A 2EM6A 4YHHE 5A6KA 5A2QC 3MHHC 3DJWA 4JI7E 2EOFA 4JI1E 3MSWA 4DR3E 2M4IA 1RC7A 2LVHA 2LJUA 1ZBTA 4DKKA 4K0KE 1UHZA 4JI2E 2YU8A 1XMQE 3OTOE 2RPCA 2EN1A 2I9IA 2YRKA 2ZM6E 4M0VA 1LLMC 2GPIA 4MLVA 1IMUA 3AUZA 2VE7C 1RMDA 1GQEA 1JK1A 3EPHA 3K6QA 2YTDA 2M9AA 1DGCA 3T1HE 1ZAAC 1T4NA 1IBKE 3ZOQB 4F9CB 5IXMB 2A25A 2EL5A 2DMYA 2YTGA 2JR1A 2ODRD 2EP3A 4LFBE 2MC6A 4LU9A 5KL4A 2CT1A 3JAMC 3UK3C 4BC9A 3L00A 2UU9E 3BBGA 2NUEA 2MKDA 4BCAA 4F6MA 4DV3E 4DR5E 4M30A 3IWBA 2ENAA 2EPCA 5A6BD 2LUPB 1HNXE 2VQEE 1NEIA 4JYAE 2UUCE 5KL7A 3ADJA 4ZYHA 4AQYE 2V83A 3FIGA 2WBUA 2UXBE 4R03A 1IQOA 4J8ZA 4LF7E 2JOBA 3QG5C 5A69A 2EMAA 4X65E 2V8QB 2LTSA 5KL3A 4LFCE 1HR0E 4LFAE 4N4RB 4TUGA 2HHHE 3HTXA 1N33E 4TUIA 4ZYDA 3KWRA 2LUQA 2F8BA 1YZ9A 2RTXA 2YSPA 5IT9C 2NUFA 4WXDA 1FKAE 2GHFA 2M7QA 1ZU1A
chains in the Genus database with same CATH topology
1T4OA 2YZTA 3AV0A 1YYWA 1J5EE 3VYYA 1X47A 4JI3E 3J7AG 2G7HA 4DV6E 3HPZA 1PKPA 4DUZE 5AE3A 3HPSA 3C4BA 4DR2E 4X8WA 3LLHA 5FLXC 2V87A 2L8TA 4B3SE 4R8OA 4LF8E 3VYXA 2L3CA 2B7TA 3RMPA 2LBSB 2L6MA 5F3WA 4DR1E 1HNWE 2JVAA 2JOXA 2LTRA 5IWAE 3ADLA 3H09A 4P78A 2NUGA 2L2NA 4DR4E 2EWLA 1FJGE 5CFFE 2L2MA 4YHHE 1X49A 1I94E 2LRSA 4WYQB 2FGGA 2ODRC 3JU0A 3LMLA 4NXNE 2MC5A 4DV7E 4B3TE 2RS7A 5A2QC 4WSPA 2EZ6A 3DJWA 4JI7E 4DR6E 1T4LB 2V85A 2L3JA 2RSMA 2VF1A 3ADGA 3MSWA 4F9BB 4DR3E 4JI1E 2M4IA 1RC7A 2UXCE 3IWCA 1J26A 1EKZA 1ZBTA 4DKKA 2IHR1 4K0KE 1UHZA 4JI2E 4NXME 2MDRA 1XMQE 4GKJE 2KONA 5ADZA 1WXRA 4LF9E 3OTOE 1ZBQA 1STUA 4JI8E 3DF6A 2DB2A 2ZM6E 2V88A 1UILA 2WZOA 4M0VA 4F54A 1WHNA 4JI0E 3AUZA 2VE7C 4YY3E 4KZSA 1GQEA 2E1MA 2RS6A 3OMLA 3JTZA 4LF4E 4DR7E 3K6QA 2LMZA 4I8OA 4BBYA 1RQ0A 4OX9E 2YT4A 3T1HE 4BC7A 2KHXA 5LL6R 4BS9A 1T4NA 2DSYA 1N32E 1IBKE 2V86A 3ZOQB 4F9CB 3F6HA 2L33A 2DMYA 1O0WA 3C4TA 2JR1A 2ODRD 4DV2E 1YYOA 4LFBE 3F6GA 4JI4E 2MC6A 4LU9A 2UUAE 1HNZE 3HXLA 2LE2A 2LJHA 1YYKA 2DIXA 2N3GA 1IBME 1IBLE 1WHQA 4JI6E 4LF5E 3JAMC 3P1XA 4BMJA 2H36X 4BC9A 5AE2A 4X66E 1N36E 2K4VA 2UU9E 5LMNE 2NUEA 4B3RE 2L92A 4BCAA 3T1YE 4DV3E 4DR5E 4B3ME 2KOUA 1XNRE 4X62E 4LTYA 3IWBA 2B9DA 2N3HA 4M30A 4OOGC 3J7Yp 2LUPB 2JWOA 1HNXE 2UUBE 2CPNA 3IWDA 3VK6A 2VQEE 1X48A 5AE1A 2UUCE 4JYAE 3ADJA 4AQYE 4Q28A 2L2KB 2V83A 3FIGA 4DV1E 2UXBE 2M1SA 5LMUE 1DQ3A 5BR8E 3ADIA 4L5NC 4R03A 5T6JA 4J8ZA 4P7DA 3J81C 2JOBA 3HQ1A 4DV4E 4LF7E 1DI2A 5DNYA 2NA2A 1XMOE 2FTXB 2VQFE 1XNQE 4X65E 2B7VA 4X64E 4DUYE 4F9AB 4LF6E 4KHPE 2E5LE 2FV4B 2B3TB 2V8QB 2LTSA 5AASA 1QU6A 4DV0E 4JI5E 4LFCE 1SR9A 3J80C 1HR0E 2UXDE 4WFTA 4LFAE 1GZ6A 4TUGA 1N34E 2HHHE 2V89A 3HTXA 4JV5E 4TUIA 1N33E 3KWRA 2LUQA 4WPYA 4M2ZA 2F8BA 2JY9A 4DMIA 1YZ9A 2RTXA 5IT9C 2F4VE 4GKKE 2NUFA 4DV5E 4L8NA 1FKAE 4GEQB 2M7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T4O A;  1J5E E;  3VYY A;  1X47 A;  4JI3 E;  4DV6 E;  1PKP A;  4DUZ E;  3C4B A;  4DR2 E;  4X8W A;  3LLH A;  4B3S E;  4LF8 E;  3VYX A;  2L3C A;  2B7T A;  2LBS B;  1HNW E;  4DR1 E;  2JVA A;  2LTR A;  5IWA E;  3ADL A;  2NUG A;  2L2N A;  4DR4 E;  1FJG E;  5CFF E;  2L2M A;  4YHH E;  1X49 A;  1I94 E;  2LRS A;  4WYQ B;  4NXN E;  4DV7 E;  4B3T E;  2RS7 A;  2EZ6 A;  4JI7 E;  4DR6 E;  1T4L B;  2L3J A;  2RSM A;  3ADG A;  4JI1 E;  1YYW A;  4DR3 E;  1RC7 A;  2UXC E;  1J26 A;  1EKZ A;  1ZBT A;  4DKK A;  2IHR 1;  4K0K E;  1UHZ A;  4JI2 E;  4NXM E;  2MDR A;  1XMQ E;  4GKJ E;  4LF9 E;  3OTO E;  1STU A;  4JI8 E;  2DB2 A;  2ZM6 E;  1UIL A;  1WHN A;  4JI0 E;  4YY3 E;  1GQE A;  2RS6 A;  4LF4 E;  4DR7 E;  1RQ0 A;  4OX9 E;  2YT4 A;  3T1H E;  2KHX A;  1T4N A;  1N32 E;  1IBK E;  2L33 A;  2DMY A;  3C4T A;  1O0W A;  4DV2 E;  1YYO A;  4LFB E;  4JI4 E;  2UUA E;  1HNZ E;  2LJH A;  1YYK A;  2DIX A;  2N3G A;  1IBM E;  1IBL E;  1WHQ A;  4JI6 E;  4LF5 E;  3P1X A;  4X66 E;  1N36 E;  2UU9 E;  5LMN E;  2NUE A;  4B3R E;  3T1Y E;  4DV3 E;  4DR5 E;  4B3M E;  1XNR E;  4X62 E;  4M30 A;  2N3H A;  4OOG C;  3J7Y p;  2LUP B;  1HNX E;  2UUB E;  2CPN A;  2VQE E;  4JYA E;  1X48 A;  2UUC E;  3ADJ A;  4AQY E;  2L2K B;  4DV1 E;  2UXB E;  3ADI A;  5LMU E;  5BR8 E;  4DV4 E;  4LF7 E;  1DI2 A;  2NA2 A;  1XMO E;  2VQF E;  1XNQ E;  4X65 E;  2B7V A;  4X64 E;  4DUY E;  4LF6 E;  4KHP E;  2E5L E;  2B3T B;  2LTS A;  4DV0 E;  1QU6 A;  4JI5 E;  4LFC E;  1HR0 E;  2UXD E;  4WFT A;  4LFA E;  1N34 E;  2HHH E;  3HTX A;  4JV5 E;  1N33 E;  2LUQ A;  4M2Z A;  2JY9 A;  1YZ9 A;  2RTX A;  2F4V E;  4GKK E;  2NUF A;  4DV5 E;  1FKA E; 
#chains in the Genus database with same CATH topology
 2EMG A;  1T4O A;  4WSG A;  2G7H A;  4DV6 E;  4DUZ E;  5AE3 A;  4R2E A;  2V87 A;  3VYX A;  5F3W A;  2LBS B;  2DRP A;  2L6M A;  2LTR A;  3H09 A;  1A1L A;  2NUG A;  5KL6 A;  2L2N A;  4DR4 E;  2EWL A;  1EH8 A;  2L2M A;  4KWY A;  2EL6 A;  2FGG A;  2DGC A;  1IQS A;  3THN A;  4DV7 E;  4B3T E;  2RS7 A;  2GLI A;  2EMC A;  2L3J A;  2VF1 A;  2UXC E;  2CSH A;  1A1F A;  5KL5 A;  2EMH A;  2KON A;  3MHS C;  2EMF A;  2EPR A;  4IS1 C;  2EOO A;  4O43 A;  2V88 A;  4JI0 E;  2E1M A;  2EM8 A;  3JTZ A;  2ENC A;  2YSO A;  5TSE A;  2EM2 A;  2EOM A;  4BC7 A;  2KHX A;  4BS9 A;  2DSY A;  1X6H A;  2EQ3 A;  3BGH A;  1YYO A;  3F6G A;  4JI4 E;  2CTD A;  2UUA E;  1NCS A;  2YTE A;  1IBL E;  1WHQ A;  3BF2 A;  1BBG A;  4JI6 E;  4BMJ A;  5AE2 A;  2WBS A;  4RHB B;  2K4V A;  4WX9 A;  4B3R E;  3T1Y E;  1AH5 A;  1B69 A;  4X62 E;  4LTY A;  2N3H A;  2RQL A;  4MLQ A;  3J7Y p;  2JWO A;  2UUB E;  2CPN A;  2EPK X;  1PJT A;  3IWD A;  2EM9 A;  1WRJ A;  2L2K B;  3KZY A;  2VRD A;  4DV1 E;  1T39 A;  2M1S A;  2EML A;  5BR8 E;  5LMU E;  4L5N C;  4R2C A;  5T6J A;  4P7D A;  3TQM A;  4O5G A;  4R2P A;  1XNQ E;  5LLQ A;  2B7V A;  2HGH A;  2FV4 B;  5AAS A;  2EL4 A;  2EPZ A;  1SR9 A;  3J80 C;  2EMX A;  1PJQ A;  1N34 E;  2MDG A;  2YTF A;  2V89 A;  4M2Z A;  2JY9 A;  4DMI A;  2DLK A;  1MEY C;  4DV5 E;  2I13 A;  4HTG A;  1UN6 B;  5IV8 B;  3AV0 A;  2YTQ A;  2NAB A;  3EQ1 A;  1YSA C;  3HPS A;  3THO B;  4R2S A;  4X8W A;  1A1I A;  5FLX C;  2L8T A;  4B3S E;  4LF8 E;  2B7T A;  1HNW E;  2EMI A;  2EOY A;  3ADL A;  2EPL X;  1FJG E;  5CFF E;  1BBO A;  1X49 A;  1I94 E;  4WYQ B;  3JU0 A;  2ODR C;  3C6K A;  1X6E A;  4DR6 E;  2EN7 A;  2YRH A;  1WJP A;  4F9B B;  2YTJ A;  1X6F A;  3EPL A;  4NXM E;  2MDR A;  5ADZ A;  2EM3 A;  1STU A;  4JI8 E;  3DF6 A;  2DB2 A;  1L4S A;  4F54 A;  1UIL A;  4RH8 A;  4NZV A;  5AC5 A;  1WHN A;  4YY3 E;  4KZS A;  4DR7 E;  2JYA A;  2EPP A;  2ENH A;  2LMZ A;  1RQ0 A;  2YT4 A;  2YTI A;  2R1F A;  5LL6 R;  3C6M A;  2N8X A;  2V86 A;  3F6H A;  1O0W A;  1X3C A;  3C4T A;  2LO3 A;  4F2J C;  1G2F C;  3HXL A;  2LE2 A;  4R2Q A;  1TF6 A;  4O24 A;  1IBM E;  4O4K A;  3P1X A;  2EOQ A;  2EMB A;  2H36 X;  4X66 E;  2DLQ A;  1N36 E;  5LMN E;  2KOU A;  2EMY A;  2B9D A;  4OOG C;  3VK6 A;  1X48 A;  5AE1 A;  2EM5 A;  2EMW A;  2MKN A;  1YFH A;  1A1G A;  1AAY A;  3ADI A;  3J81 C;  2YTP A;  3HQ1 A;  1XMO E;  1N3G A;  3EPJ A;  2HJJ A;  4DUY E;  1KYQ A;  4LF6 E;  1GTK A;  4KHP E;  2B3T B;  4DV0 E;  3VHT B;  1QU6 A;  4JI5 E;  2EOR A;  2EPO A;  2Q8U A;  5A6J A;  2UXD E;  1GZ6 A;  1TN9 A;  5A6B A;  4WPY A;  4R2A A;  1A1K A;  2EOX A;  2DMI A;  3M99 B;  2EN3 A;  4BHC A;  2EOI A;  5KL2 A;  1X5W A;  3HPZ A;  1JK2 A;  2HC5 A;  3LLH A;  1A1J A;  1YUI A;  4WXC A;  4F6N A;  2L3C A;  1YPN A;  2R76 A;  4FK5 C;  5IWA E;  2ELY A;  1BB8 A;  2EQ1 A;  2BBG A;  1F2I G;  2LRS A;  2EPU A;  3LML A;  5A6A A;  1EH6 A;  4NXN E;  2D9H A;  2MC5 A;  2EJ4 A;  2YWQ A;  2J7J A;  4WSP A;  2EZ6 A;  3EPK A;  4BHB A;  2V85 A;  2EE8 A;  1T4L B;  2RSM A;  3ADG A;  1YYW A;  2LT7 A;  3IWC A;  1J26 A;  1EKZ A;  2IHR 1;  2WCC 3;  4GKJ E;  1WXR A;  2EPA A;  2BB8 A;  4LF9 E;  1SFE A;  1ZBQ A;  2JXP A;  2EPM X;  2K7I A;  2WZO A;  2YRM A;  2YU5 A;  2ELZ A;  4HEI A;  2RS6 A;  3OML A;  4LF4 E;  4I8O A;  4BBY A;  1YUJ A;  4OX9 E;  2EN4 A;  2PRT A;  2EPN A;  1N32 E;  4ZYG A;  4IJD A;  2L33 A;  2JPA A;  4DV2 E;  1QNT A;  1HNZ E;  2LJH A;  4NHR A;  1YYK A;  2DIX A;  2N3G A;  4LF5 E;  2EOH A;  4R2D A;  2L92 A;  1P47 A;  4B3M E;  1ZR9 A;  2LV2 A;  1XNR E;  2EOE A;  2EQ0 A;  1KJK A;  1MGT A;  4Q35 B;  2EOZ A;  2YTO A;  1PDA A;  4ZYE A;  4Q28 A;  1Z1B A;  4X9J A;  1DQ3 A;  2EN8 A;  2ADR A;  4DV4 E;  1DI2 A;  2EM7 A;  5DNY A;  2RSI A;  4M9V C;  2NA2 A;  2FTX B;  2VQF E;  2EOS A;  4X64 E;  4F9A B;  2E5L E;  2EN2 A;  2YPN A;  3KZZ A;  2E72 A;  2EOJ A;  2WBT A;  3ECR A;  4WFT A;  4JV5 E;  1G2D C;  2F4V E;  4GKK E;  4L8N A;  4GEQ B;  1A1H A;  2JP9 A;  2EN6 A;  1TF3 A;  1T38 A;  2YTN A;  2YZT A;  1J5E E;  3VYY A;  1X47 A;  4JI3 E;  3J7A G;  2EMK A;  1PKP A;  3C4B A;  1PJS A;  4DR2 E;  2EPX A;  4GZN C;  2EMZ A;  4R8O A;  3RMP A;  3BID A;  4R2R A;  4DR1 E;  2JVA A;  2EM4 A;  2JOX A;  1EH7 A;  2LCE A;  4P78 A;  5AC4 A;  1UBD C;  2EM0 A;  2EM6 A;  4YHH E;  5A6K A;  5A2Q C;  3MHH C;  3DJW A;  4JI7 E;  2EOF A;  4JI1 E;  3MSW A;  4DR3 E;  2M4I A;  1RC7 A;  2LVH A;  2LJU A;  1ZBT A;  4DKK A;  4K0K E;  1UHZ A;  4JI2 E;  2YU8 A;  1XMQ E;  3OTO E;  2RPC A;  2EN1 A;  2I9I A;  2YRK A;  2ZM6 E;  4M0V A;  1LLM C;  2GPI A;  4MLV A;  1IMU A;  3AUZ A;  2VE7 C;  1RMD A;  1GQE A;  1JK1 A;  3EPH A;  3K6Q A;  2YTD A;  2M9A A;  1DGC A;  3T1H E;  1ZAA C;  1T4N A;  1IBK E;  3ZOQ B;  4F9C B;  5IXM B;  2A25 A;  2EL5 A;  2DMY A;  2YTG A;  2JR1 A;  2ODR D;  2EP3 A;  4LFB E;  2MC6 A;  4LU9 A;  5KL4 A;  2CT1 A;  3JAM C;  3UK3 C;  4BC9 A;  3L00 A;  2UU9 E;  3BBG A;  2NUE A;  2MKD A;  4BCA A;  4F6M A;  4DV3 E;  4DR5 E;  4M30 A;  3IWB A;  2ENA A;  2EPC A;  5A6B D;  2LUP B;  1HNX E;  2VQE E;  1NEI A;  4JYA E;  2UUC E;  5KL7 A;  3ADJ A;  4ZYH A;  4AQY E;  2V83 A;  3FIG A;  2WBU A;  2UXB E;  4R03 A;  1IQO A;  4J8Z A;  4LF7 E;  2JOB A;  3QG5 C;  5A69 A;  2EMA A;  4X65 E;  2V8Q B;  2LTS A;  5KL3 A;  4LFC E;  1HR0 E;  4LFA E;  4N4R B;  4TUG A;  2HHH E;  3HTX A;  1N33 E;  4TUI A;  4ZYD A;  3KWR A;  2LUQ A;  2F8B A;  1YZ9 A;  2RTX A;  2YSP A;  5IT9 C;  2NUF A;  4WXD A;  1FKA E;  2GHF A;  2M7Q A;  1ZU1 A; 
#chains in the Genus database with same CATH homology
 1T4O A;  2YZT A;  3AV0 A;  1YYW A;  1J5E E;  3VYY A;  1X47 A;  4JI3 E;  3J7A G;  2G7H A;  4DV6 E;  3HPZ A;  1PKP A;  4DUZ E;  5AE3 A;  3HPS A;  3C4B A;  4DR2 E;  4X8W A;  3LLH A;  5FLX C;  2V87 A;  2L8T A;  4B3S E;  4R8O A;  4LF8 E;  3VYX A;  2L3C A;  2B7T A;  3RMP A;  2LBS B;  2L6M A;  5F3W A;  4DR1 E;  1HNW E;  2JVA A;  2JOX A;  2LTR A;  5IWA E;  3ADL A;  3H09 A;  4P78 A;  2NUG A;  2L2N A;  4DR4 E;  2EWL A;  1FJG E;  5CFF E;  2L2M A;  4YHH E;  1X49 A;  1I94 E;  2LRS A;  4WYQ B;  2FGG A;  2ODR C;  3JU0 A;  3LML A;  4NXN E;  2MC5 A;  4DV7 E;  4B3T E;  2RS7 A;  5A2Q C;  4WSP A;  2EZ6 A;  3DJW A;  4JI7 E;  4DR6 E;  1T4L B;  2V85 A;  2L3J A;  2RSM A;  2VF1 A;  3ADG A;  3MSW A;  4F9B B;  4DR3 E;  4JI1 E;  2M4I A;  1RC7 A;  2UXC E;  3IWC A;  1J26 A;  1EKZ A;  1ZBT A;  4DKK A;  2IHR 1;  4K0K E;  1UHZ A;  4JI2 E;  4NXM E;  2MDR A;  1XMQ E;  4GKJ E;  2KON A;  5ADZ A;  1WXR A;  4LF9 E;  3OTO E;  1ZBQ A;  1STU A;  4JI8 E;  3DF6 A;  2DB2 A;  2ZM6 E;  2V88 A;  1UIL A;  2WZO A;  4M0V A;  4F54 A;  1WHN A;  4JI0 E;  3AUZ A;  2VE7 C;  4YY3 E;  4KZS A;  1GQE A;  2E1M A;  2RS6 A;  3OML A;  3JTZ A;  4LF4 E;  4DR7 E;  3K6Q A;  2LMZ A;  4I8O A;  4BBY A;  1RQ0 A;  4OX9 E;  2YT4 A;  3T1H E;  4BC7 A;  2KHX A;  5LL6 R;  4BS9 A;  1T4N A;  2DSY A;  1N32 E;  1IBK E;  2V86 A;  3ZOQ B;  4F9C B;  3F6H A;  2L33 A;  2DMY A;  1O0W A;  3C4T A;  2JR1 A;  2ODR D;  4DV2 E;  1YYO A;  4LFB E;  3F6G A;  4JI4 E;  2MC6 A;  4LU9 A;  2UUA E;  1HNZ E;  3HXL A;  2LE2 A;  2LJH A;  1YYK A;  2DIX A;  2N3G A;  1IBM E;  1IBL E;  1WHQ A;  4JI6 E;  4LF5 E;  3JAM C;  3P1X A;  4BMJ A;  2H36 X;  4BC9 A;  5AE2 A;  4X66 E;  1N36 E;  2K4V A;  2UU9 E;  5LMN E;  2NUE A;  4B3R E;  2L92 A;  4BCA A;  3T1Y E;  4DV3 E;  4DR5 E;  4B3M E;  2KOU A;  1XNR E;  4X62 E;  4LTY A;  3IWB A;  2B9D A;  2N3H A;  4M30 A;  4OOG C;  3J7Y p;  2LUP B;  2JWO A;  1HNX E;  2UUB E;  2CPN A;  3IWD A;  3VK6 A;  2VQE E;  1X48 A;  5AE1 A;  2UUC E;  4JYA E;  3ADJ A;  4AQY E;  4Q28 A;  2L2K B;  2V83 A;  3FIG A;  4DV1 E;  2UXB E;  2M1S A;  5LMU E;  1DQ3 A;  5BR8 E;  3ADI A;  4L5N C;  4R03 A;  5T6J A;  4J8Z A;  4P7D A;  3J81 C;  2JOB A;  3HQ1 A;  4DV4 E;  4LF7 E;  1DI2 A;  5DNY A;  2NA2 A;  1XMO E;  2FTX B;  2VQF E;  1XNQ E;  4X65 E;  2B7V A;  4X64 E;  4DUY E;  4F9A B;  4LF6 E;  4KHP E;  2E5L E;  2FV4 B;  2B3T B;  2V8Q B;  2LTS A;  5AAS A;  1QU6 A;  4DV0 E;  4JI5 E;  4LFC E;  1SR9 A;  3J80 C;  1HR0 E;  2UXD E;  4WFT A;  4LFA E;  1GZ6 A;  4TUG A;  1N34 E;  2HHH E;  2V89 A;  3HTX A;  4JV5 E;  4TUI A;  1N33 E;  3KWR A;  2LUQ A;  4WPY A;  4M2Z A;  2F8B A;  2JY9 A;  4DMI A;  1YZ9 A;  2RTX A;  5IT9 C;  2F4V E;  4GKK E;  2NUF A;  4DV5 E;  4L8N A;  1FKA E;  4GEQ B;  2M7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...