1J26A

Solution structure of a putative peptidyl-trna hydrolase domain in a mouse hypothetical protein
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
112
structure length
112
Chain Sequence
GSSGSSGEHAKQASSYIPLDRLSISYCRSSGPGGQNVNKVNSKAEVRFHLASADWIEEPVRQKIALTHKNKINKAGELVLTSESSRYQFRNLAECLQKIRDMIAEASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the catalytic domain of the mitochondrial protein ICT1 that is essential for cell vitality
pubmed doi rcsb
source organism Mus musculus
molecule tags Translation
molecule keywords immature colon carcinoma transcript 1
total genus 25
structure length 112
sequence length 112
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2002-12-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1j26A01
1EKZA 1RC7A 4B3SE 4LF8E 1FKAE 1QU6A 2RSMA 5LMUE 4JI2E 3ADLA 2L2NA 4DR4E 4JYAE 4WFTA 2UUBE 3LLHA 3C4TA 2RS6A 2HHHE 4LFBE 5BR8E 1WHQA 4JI5E 4NXNE 1PKPA 4LF6E 1FJGE 1UILA 4X66E 2KHXA 2LBSB 4DV3E 4YHHE 1J26A 1ZBTA 4DV7E 2B7VA 2NUGA 2VQEE 1N34E 2NUFA 1N36E 4LF7E 2EZ6A 2DB2A 3ADIA 2RTXA 1YZ9A 1UHZA 2LRSA 2L3JA 4DR2E 3P1XA 4OX9E 2L3CA 4DUZE 4JV5E 4AQYE 3OTOE 3T1HE 5IWAE 3J7Yp 4JI4E 2RS7A 2L2KB 4JI0E 4B3ME 1RQ0A 2DMYA 3VYXA 1HNXE 4DV1E 2LUQA 1XNQE 3HTXA 3ADJA 4DR7E 4WYQB 4DV6E 4YY3E 2NUEA 1T4NA 3T1YE 4DKKA 2NA2A 1XNRE 1YYKA 2JVAA 2UUCE 2UXBE 2LUPB 1HNZE 4LFAE 1YYWA 4DV4E 4JI1E 4JI3E 4DR3E 4DUYE 4GKJE 4DR5E 4X62E 3ADGA 1T4OA 1STUA 4DR1E 4LF5E 2UXDE 2B3TB 1T4LB 5CFFE 1YYOA 1I94E 1IBKE 3VYYA 1IBLE 2YT4A 1XMQE 4LFCE 4B3RE 5LMNE 2LTRA 2MDRA 4LF4E 4DV0E 2CPNA 2N3GA 1IBME 1HNWE 4M2ZA 4LF9E 1N33E 2LJHA 4X64E 4DV5E 4X65E 1O0WA 4OOGC 1GQEA 1N32E 4JI8E 4DR6E 2L33A 1J5EE 2DIXA 2F4VE 4JI6E 3C4BA 2L2MA 2IHR1 2JY9A 4B3TE 2B7TA 4KHPE 2N3HA 4X8WA 4GKKE 4M30A 2UXCE 4NXME 4JI7E 1X49A 2VQFE 2ZM6E 1HR0E 2UUAE 1XMOE 4DV2E 4K0KE 1X47A 1WHNA 2E5LE 2UU9E 1DI2A 2LTSA 1X48A
chains in the Genus database with same CATH superfamily
2EM7A 2EQ1A 4B3SE 4L5NC 4BCAA 2Q8UA 5LMUE 5AC4A 2EMKA 2V86A 2EPUA 3JAMC 3C4TA 1KJKA 2HHHE 1GZ6A 5BR8E 2MKNA 1X5WA 4R2PA 2DLKA 2JPAA 4DV3E 4YHHE 5KL5A 2B7VA 1WXRA 1N34E 4LF7E 3ADIA 1DGCA 1EH8A 2RTXA 2EPOA 1EH7A 2LRSA 2N8XA 2YU8A 2DLQA 2L3JA 2EP3A 1MEYC 2EQ0A 3HPSA 5ADZA 5A6AA 3LMLA 4R8OA 3T1HE 4O4KA 4LTYA 1RQ0A 3ZOQB 2DMYA 2YTEA 3VYXA 1HNXE 3HPZA 2MC5A 3DF6A 3HTXA 5KL2A 4M9VC 2M1SA 4DKKA 1XNRE 2B9DA 2JVAA 2I13A 4LFAE 2EPKX 1HNZE 1PDAA 4JI1E 4JI3E 2EM2A 4DMIA 1A1LA 2YTIA 2EMAA 4DR5E 3ADGA 1STUA 2WBUA 2B3TB 3F6HA 1P47A 4L8NA 2YTOA 3JU0A 2M4IA 1YYOA 2EMYA 2F8BA 2EM4A 2DSYA 2FTXB 2EPXA 3J80C 3EPLA 4ZYEA 1EH6A 4LFCE 2EL5A 5A69A 2EPPA 1PJSA 1SR9A 4WXCA 5LMNE 2EMGA 2V87A 2LTRA 2MDRA 2EM9A 5KL4A 2EM8A 2ENHA 2H36X 2HC5A 2E72A 2LMZA 4KWYA 4DV5E 4LF9E 1BBGA 2JYAA 3C6MA 4X65E 3AV0A 4OOGC 1G2DC 2VF1A 4GZNC 5A2QC 2YTJA 4IS1C 2DGCA 4JI6E 4P78A 2CSHA 4F6NA 2WBTA 1ZAAC 4KHPE 2UXCE 2WCC3 1X49A 4O5GA 1HR0E 1GTKA 2R76A 2GLIA 4MLQA 1WHNA 2E5LE 2ODRD 2EOOA 2JP9A 2J7JA 2JOXA 1FKAE 2RSMA 1SFEA 5AC5A 2EMZA 3K6QA 2JR1A 1N33E 5KL7A 4BHBA 3BIDA 4LFBE 1WHQA 4NXNE 2V8QB 2M9AA 2LT7A 1UILA 2LCEA 1ZBTA 3KZYA 4F9BB 2NUGA 2EPCA 1N36E 2DB2A 5TSEA 2EOXA 4X9JA 3TQMA 2LO3A 4R2QA 3MSWA 3P1XA 1T38A 4OX9E 4JV5E 4AQYE 3AUZA 3OTOE 2GHFA 2L2KB 4KZSA 5KL6A 4B3ME 3EPJA 4TUIA 2LUQA 2EOHA 2V85A 2G7HA 1XNQE 2EPAA 4DR7E 1ZR9A 4BS9A 2EOQA 1YYKA 2UXBE 2MDGA 2LUPB 2LE2A 2YSPA 4DV4E 1B69A 4DR3E 5A6JA 2EM5A 4X62E 4R2AA 1T4OA 2EOZA 1F2IG 5CFFE 3VYYA 2CT1A 2EM6A 5LL6R 2FGGA 1XMQE 1A1JA 5FLXC 1UN6B 2YSOA 3MHSC 4R2SA 4F6MA 4ZYDA 2LV2A 4DV0E 2N3GA 2YTFA 2ELYA 2EN7A 2YWQA 2JOBA 1N32E 2LJUA 2MC6A 1TN9A 2EPRA 2L33A 1J5EE 2EJ4A 1PJQA 2E1MA 3HQ1A 4WPYA 2B7TA 2N3HA 5IT9C 4NXME 2UUAE 2EN8A 4DV2E 4NZVA 4IJDA 3M99B 3J7AG 3F6GA 4HEIA 2LTSA 3THOB 5AASA 1TF3A 2BBGA 3L00A 3EPKA 4LF8E 1QU6A 1WJPA 3BF2A 2D9HA 4R2EA 5DNYA 3H09A 2L2NA 1LLMC 1YUIA 4RHBB 2LVHA 4JYAE 4WFTA 2UUBE 3LLHA 3UK3C 3KWRA 1AH5A 1QNTA 4BHCA 2EL6A 4Q35B 4JI5E 4LF6E 4X66E 2KHXA 2LBSB 2ADRA 2EPZA 2ENCA 1J26A 4DV7E 2VQEE 2R1FA 2WBSA 1T39A 2NUFA 2EZ6A 1IQSA 1WRJA 2EOYA 2EM3A 3MHHC 1UHZA 3HXLA 1NCSA 4M0VA 4WXDA 5AE2A 1UBDC 2YTDA 2I9IA 2K7IA 1X6FA 5IV8B 4BC9A 5IWAE 3J7Yp 2RS7A 4GEQB 4DV1E 2RPCA 2EMIA 2L8TA 5A6BD 1IQOA 1AAYA 3ADJA 2ODRC 1T4NA 3T1YE 3ECRA 3DJWA 2YRMA 1YYWA 1X6HA 2V83A 2V88A 2YRHA 3IWBA 2M7QA 2EOMA 4P7DA 2UXDE 2YTNA 4LF5E 2KONA 4ZYGA 2VE7C 1T4LB 1PJTA 2JWOA 5AE1A 5T6JA 3IWDA 2YT4A 2EMBA 2EOSA 4F9AB 4LF4E 5A6BA 1YPNA 4F9CB 4N4RB 1ZBQA 3RMPA 1HNWE 1NEIA 1O0WA 3VHTB 2HGHA 4DR6E 2YTGA 2F4VE 2NABA 4I8OA 2EQ3A 2YZTA 3C4BA 2L2MA 4NHRA 2DRPA 4R2RA 5AE3A 5LLQA 2IHR1 2JY9A 5F3WA 4B3TE 1YUJA 4X8WA 4M30A 1RMDA 4Q28A 4JI7E 1ZU1A 2EMFA 2VQFE 1XMOE 1N3GA 2EMLA 1G2FC 2UU9E 3IWCA 1DI2A 2YRKA 1X48A 2EE8A 4RH8A 4O43A 4ZYHA 1EKZA 1A1GA 1RC7A 2EN3A 4JI2E 3ADLA 4DR4E 2FV4B 1A1KA 1BB8A 2RQLA 2RS6A 4F54A 4MLVA 2CTDA 1PKPA 1FJGE 1A1FA 2EOEA 2EMXA 2PRTA 1X6EA 3FIGA 2EN6A 2HJJA 2V89A 1YZ9A 4WX9A 4DR2E 3BGHA 2L3CA 3EQ1A 4DUZE 2EMCA 4WSPA 2A25A 2EMHA 4JI4E 4JI0E 2EPLX 1YSAC 2ELZA 2JXPA 3QG5C 2EM0A 4WYQB 4DV6E 4YY3E 2NUEA 1IMUA 2EPMX 4HTGA 2NA2A 2GPIA 2YTPA 2KOUA 1YFHA 1JK1A 2UUCE 4BC7A 2VRDA 2EOJA 4R2DA 4DUYE 1JK2A 2L92A 4GKJE 2ENAA 2L6MA 4WSGA 4DR1E 4BBYA 3OMLA 4R03A 2K4VA 3J81C 1A1IA 2EN2A 4O24A 2EORA 5IXMB 2WZOA 1I94E 2YPNA 1IBKE 5A6KA 1IBLE 3VK6A 2DMIA 4J8ZA 4B3RE 3C6KA 3JTZA 1KYQA 1Z1BA 2MKDA 2EN4A 2EMWA 4BMJA 2CPNA 1IBME 3THNA 4FK5C 2EPNA 2EOIA 4M2ZA 2LJHA 4X64E 1DQ3A 2EWLA 1GQEA 4JI8E 4R2CA 2EN1A 2DIXA 2BB8A 5KL3A 1TF6A 4TUGA 4F2JC 2YU5A 4GKKE 1A1HA 4LU9A 1MGTA 2ZM6E 3EPHA 1X3CA 2RSIA 2YTQA 4K0KE 1X47A 3KZZA 1BBOA 2EOFA 1L4SA 2EL4A 3BBGA
chains in the Genus database with same CATH topology
5AASA 1EKZA 1RC7A 4B3SE 2JOXA 4L5NC 4LF8E 4BCAA 1FKAE 1QU6A 2RSMA 5DNYA 5LMUE 3H09A 4JI2E 3ADLA 2L2NA 3K6QA 2V86A 4DR4E 4JYAE 2JR1A 4WFTA 2FV4B 3LLHA 2UUBE 3KWRA 3JAMC 3C4TA 2RS6A 4F54A 2HHHE 4LFBE 1GZ6A 5BR8E 1WHQA 4JI5E 4NXNE 1PKPA 2V8QB 4LF6E 1FJGE 1UILA 4X66E 2KHXA 2LBSB 4DV3E 4YHHE 1J26A 1ZBTA 4DV7E 3FIGA 2B7VA 4F9BB 2VQEE 1WXRA 1N34E 2NUGA 2NUFA 1N36E 4LF7E 2EZ6A 2V89A 2DB2A 3ADIA 2RTXA 1YZ9A 2UXDE 1UHZA 3HXLA 4M0VA 2LRSA 5AE2A 2L3JA 4DR2E 3MSWA 3P1XA 4OX9E 3HPSA 2L3CA 5ADZA 4DUZE 4AQYE 3AUZA 3LMLA 4R8OA 3OTOE 3T1HE 4WSPA 4BC9A 5IWAE 3J7Yp 4JI4E 2RS7A 2L2KB 4KZSA 4JI0E 4LTYA 4B3ME 1RQ0A 3ZOQB 2DMYA 3VYXA 4GEQB 1HNXE 3HPZA 2MC5A 4DV1E 4TUIA 2LUQA 2L8TA 2V85A 3DF6A 2G7HA 1XNQE 3HTXA 3ADJA 4DR7E 2ODRC 4WYQB 4DV6E 4YY3E 2NUEA 1T4NA 4BS9A 2M1SA 3T1YE 4DKKA 2NA2A 1XNRE 1YYKA 2B9DA 2KOUA 2JVAA 3DJWA 4BC7A 2UUCE 2UXBE 2LUPB 1HNZE 4LFAE 2LE2A 1YYWA 4DV4E 4JI1E 4JI3E 2V83A 4DMIA 4DR3E 2V88A 4DUYE 3IWBA 2M7QA 2L92A 4P7DA 4GKJE 4DR5E 2L6MA 4X62E 3ADGA 1T4OA 1STUA 3OMLA 4BBYA 4DR1E 4LF5E 2B3TB 3F6HA 4R03A 2KONA 2K4VA 2VE7C 1T4LB 3J81C 4L8NA 5CFFE 2JWOA 3JU0A 4JV5E 2M4IA 1YYOA 2WZOA 2F8BA 5T6JA 5AE1A 2DSYA 2FTXB 1I94E 3VYYA 1IBKE 3J80C 1IBLE 3IWDA 2YT4A 2FGGA 5LL6R 3VK6A 1XMQE 4LFCE 4J8ZA 4B3RE 5FLXC 3JTZA 1SR9A 4F9AB 5LMNE 2V87A 2LTRA 2MDRA 4LF4E 4F9CB 4BMJA 2CPNA 2H36X 2N3GA 1ZBQA 4DV0E 3RMPA 1IBME 1HNWE 4M2ZA 2LMZA 4LF9E 1N33E 2LJHA 4X64E 4DV5E 1DQ3A 1O0WA 3AV0A 2EWLA 4OOGC 4X65E 2VF1A 1GQEA 2JOBA 1N32E 4JI8E 2MC6A 5A2QC 2L33A 1J5EE 2DIXA 4DR6E 2F4VE 4I8OA 2YZTA 4JI6E 3C4BA 2L2MA 4P78A 2E1MA 5AE3A 3HQ1A 4WPYA 2IHR1 2JY9A 4TUGA 5F3WA 4B3TE 2B7TA 4KHPE 2N3HA 4X8WA 5IT9C 4M30A 4GKKE 2UXCE 4LU9A 4NXME 4Q28A 4JI7E 1X49A 2VQFE 2ZM6E 1HR0E 2UUAE 1XMOE 4DV2E 4K0KE 1X47A 1WHNA 3IWCA 2ODRD 2E5LE 3F6GA 2UU9E 3J7AG 1DI2A 2LTSA 1X48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EKZ A;  1RC7 A;  4B3S E;  4LF8 E;  1FKA E;  1QU6 A;  2RSM A;  5LMU E;  4JI2 E;  3ADL A;  2L2N A;  4DR4 E;  4JYA E;  4WFT A;  2UUB E;  3LLH A;  3C4T A;  2RS6 A;  2HHH E;  4LFB E;  5BR8 E;  1WHQ A;  4JI5 E;  4NXN E;  1PKP A;  4LF6 E;  1FJG E;  1UIL A;  4X66 E;  2KHX A;  2LBS B;  4DV3 E;  4YHH E;  1J26 A;  1ZBT A;  4DV7 E;  2B7V A;  2NUG A;  2VQE E;  1N34 E;  2NUF A;  1N36 E;  4LF7 E;  2EZ6 A;  2DB2 A;  3ADI A;  2RTX A;  1YZ9 A;  1UHZ A;  2LRS A;  2L3J A;  4DR2 E;  3P1X A;  4OX9 E;  2L3C A;  4DUZ E;  4JV5 E;  4AQY E;  3OTO E;  3T1H E;  5IWA E;  3J7Y p;  4JI4 E;  2RS7 A;  2L2K B;  4JI0 E;  4B3M E;  1RQ0 A;  2DMY A;  3VYX A;  1HNX E;  4DV1 E;  2LUQ A;  1XNQ E;  3HTX A;  3ADJ A;  4DR7 E;  4WYQ B;  4DV6 E;  4YY3 E;  2NUE A;  1T4N A;  3T1Y E;  4DKK A;  2NA2 A;  1XNR E;  1YYK A;  2JVA A;  2UUC E;  2UXB E;  2LUP B;  1HNZ E;  4LFA E;  1YYW A;  4DV4 E;  4JI1 E;  4JI3 E;  4DR3 E;  4DUY E;  4GKJ E;  4DR5 E;  4X62 E;  3ADG A;  1T4O A;  1STU A;  4DR1 E;  4LF5 E;  2UXD E;  2B3T B;  1T4L B;  5CFF E;  1YYO A;  1I94 E;  1IBK E;  3VYY A;  1IBL E;  2YT4 A;  1XMQ E;  4LFC E;  4B3R E;  5LMN E;  2LTR A;  2MDR A;  4LF4 E;  4DV0 E;  2CPN A;  2N3G A;  1IBM E;  1HNW E;  4M2Z A;  4LF9 E;  1N33 E;  2LJH A;  4X64 E;  4DV5 E;  4X65 E;  1O0W A;  4OOG C;  1GQE A;  1N32 E;  4JI8 E;  4DR6 E;  2L33 A;  1J5E E;  2DIX A;  2F4V E;  4JI6 E;  3C4B A;  2L2M A;  2IHR 1;  2JY9 A;  4B3T E;  2B7T A;  4KHP E;  2N3H A;  4X8W A;  4GKK E;  4M30 A;  2UXC E;  4NXM E;  4JI7 E;  1X49 A;  2VQF E;  2ZM6 E;  1HR0 E;  2UUA E;  1XMO E;  4DV2 E;  4K0K E;  1X47 A;  1WHN A;  2E5L E;  2UU9 E;  1DI2 A;  2LTS A;  1X48 A; 
#chains in the Genus database with same CATH topology
 2EM7 A;  2EQ1 A;  4B3S E;  4L5N C;  4BCA A;  2Q8U A;  5LMU E;  5AC4 A;  2EMK A;  2V86 A;  2EPU A;  3JAM C;  3C4T A;  1KJK A;  2HHH E;  1GZ6 A;  5BR8 E;  2MKN A;  1X5W A;  4R2P A;  2DLK A;  2JPA A;  4DV3 E;  4YHH E;  5KL5 A;  2B7V A;  1WXR A;  1N34 E;  4LF7 E;  3ADI A;  1DGC A;  1EH8 A;  2RTX A;  2EPO A;  1EH7 A;  2LRS A;  2N8X A;  2YU8 A;  2DLQ A;  2L3J A;  2EP3 A;  1MEY C;  2EQ0 A;  3HPS A;  5ADZ A;  5A6A A;  3LML A;  4R8O A;  3T1H E;  4O4K A;  4LTY A;  1RQ0 A;  3ZOQ B;  2DMY A;  2YTE A;  3VYX A;  1HNX E;  3HPZ A;  2MC5 A;  3DF6 A;  3HTX A;  5KL2 A;  4M9V C;  2M1S A;  4DKK A;  1XNR E;  2B9D A;  2JVA A;  2I13 A;  4LFA E;  2EPK X;  1HNZ E;  1PDA A;  4JI1 E;  4JI3 E;  2EM2 A;  4DMI A;  1A1L A;  2YTI A;  2EMA A;  4DR5 E;  3ADG A;  1STU A;  2WBU A;  2B3T B;  3F6H A;  1P47 A;  4L8N A;  2YTO A;  3JU0 A;  2M4I A;  1YYO A;  2EMY A;  2F8B A;  2EM4 A;  2DSY A;  2FTX B;  2EPX A;  3J80 C;  3EPL A;  4ZYE A;  1EH6 A;  4LFC E;  2EL5 A;  5A69 A;  2EPP A;  1PJS A;  1SR9 A;  4WXC A;  5LMN E;  2EMG A;  2V87 A;  2LTR A;  2MDR A;  2EM9 A;  5KL4 A;  2EM8 A;  2ENH A;  2H36 X;  2HC5 A;  2E72 A;  2LMZ A;  4KWY A;  4DV5 E;  4LF9 E;  1BBG A;  2JYA A;  3C6M A;  4X65 E;  3AV0 A;  4OOG C;  1G2D C;  2VF1 A;  4GZN C;  5A2Q C;  2YTJ A;  4IS1 C;  2DGC A;  4JI6 E;  4P78 A;  2CSH A;  4F6N A;  2WBT A;  1ZAA C;  4KHP E;  2UXC E;  2WCC 3;  1X49 A;  4O5G A;  1HR0 E;  1GTK A;  2R76 A;  2GLI A;  4MLQ A;  1WHN A;  2E5L E;  2ODR D;  2EOO A;  2JP9 A;  2J7J A;  2JOX A;  1FKA E;  2RSM A;  1SFE A;  5AC5 A;  2EMZ A;  3K6Q A;  2JR1 A;  1N33 E;  5KL7 A;  4BHB A;  3BID A;  4LFB E;  1WHQ A;  4NXN E;  2V8Q B;  2M9A A;  2LT7 A;  1UIL A;  2LCE A;  1ZBT A;  3KZY A;  4F9B B;  2NUG A;  2EPC A;  1N36 E;  2DB2 A;  5TSE A;  2EOX A;  4X9J A;  3TQM A;  2LO3 A;  4R2Q A;  3MSW A;  3P1X A;  1T38 A;  4OX9 E;  4JV5 E;  4AQY E;  3AUZ A;  3OTO E;  2GHF A;  2L2K B;  4KZS A;  5KL6 A;  4B3M E;  3EPJ A;  4TUI A;  2LUQ A;  2EOH A;  2V85 A;  2G7H A;  1XNQ E;  2EPA A;  4DR7 E;  1ZR9 A;  4BS9 A;  2EOQ A;  1YYK A;  2UXB E;  2MDG A;  2LUP B;  2LE2 A;  2YSP A;  4DV4 E;  1B69 A;  4DR3 E;  5A6J A;  2EM5 A;  4X62 E;  4R2A A;  1T4O A;  2EOZ A;  1F2I G;  5CFF E;  3VYY A;  2CT1 A;  2EM6 A;  5LL6 R;  2FGG A;  1XMQ E;  1A1J A;  5FLX C;  1UN6 B;  2YSO A;  3MHS C;  4R2S A;  4F6M A;  4ZYD A;  2LV2 A;  4DV0 E;  2N3G A;  2YTF A;  2ELY A;  2EN7 A;  2YWQ A;  2JOB A;  1N32 E;  2LJU A;  2MC6 A;  1TN9 A;  2EPR A;  2L33 A;  1J5E E;  2EJ4 A;  1PJQ A;  2E1M A;  3HQ1 A;  4WPY A;  2B7T A;  2N3H A;  5IT9 C;  4NXM E;  2UUA E;  2EN8 A;  4DV2 E;  4NZV A;  4IJD A;  3M99 B;  3J7A G;  3F6G A;  4HEI A;  2LTS A;  3THO B;  5AAS A;  1TF3 A;  2BBG A;  3L00 A;  3EPK A;  4LF8 E;  1QU6 A;  1WJP A;  3BF2 A;  2D9H A;  4R2E A;  5DNY A;  3H09 A;  2L2N A;  1LLM C;  1YUI A;  4RHB B;  2LVH A;  4JYA E;  4WFT A;  2UUB E;  3LLH A;  3UK3 C;  3KWR A;  1AH5 A;  1QNT A;  4BHC A;  2EL6 A;  4Q35 B;  4JI5 E;  4LF6 E;  4X66 E;  2KHX A;  2LBS B;  2ADR A;  2EPZ A;  2ENC A;  1J26 A;  4DV7 E;  2VQE E;  2R1F A;  2WBS A;  1T39 A;  2NUF A;  2EZ6 A;  1IQS A;  1WRJ A;  2EOY A;  2EM3 A;  3MHH C;  1UHZ A;  3HXL A;  1NCS A;  4M0V A;  4WXD A;  5AE2 A;  1UBD C;  2YTD A;  2I9I A;  2K7I A;  1X6F A;  5IV8 B;  4BC9 A;  5IWA E;  3J7Y p;  2RS7 A;  4GEQ B;  4DV1 E;  2RPC A;  2EMI A;  2L8T A;  5A6B D;  1IQO A;  1AAY A;  3ADJ A;  2ODR C;  1T4N A;  3T1Y E;  3ECR A;  3DJW A;  2YRM A;  1YYW A;  1X6H A;  2V83 A;  2V88 A;  2YRH A;  3IWB A;  2M7Q A;  2EOM A;  4P7D A;  2UXD E;  2YTN A;  4LF5 E;  2KON A;  4ZYG A;  2VE7 C;  1T4L B;  1PJT A;  2JWO A;  5AE1 A;  5T6J A;  3IWD A;  2YT4 A;  2EMB A;  2EOS A;  4F9A B;  4LF4 E;  5A6B A;  1YPN A;  4F9C B;  4N4R B;  1ZBQ A;  3RMP A;  1HNW E;  1NEI A;  1O0W A;  3VHT B;  2HGH A;  4DR6 E;  2YTG A;  2F4V E;  2NAB A;  4I8O A;  2EQ3 A;  2YZT A;  3C4B A;  2L2M A;  4NHR A;  2DRP A;  4R2R A;  5AE3 A;  5LLQ A;  2IHR 1;  2JY9 A;  5F3W A;  4B3T E;  1YUJ A;  4X8W A;  4M30 A;  1RMD A;  4Q28 A;  4JI7 E;  1ZU1 A;  2EMF A;  2VQF E;  1XMO E;  1N3G A;  2EML A;  1G2F C;  2UU9 E;  3IWC A;  1DI2 A;  2YRK A;  1X48 A;  2EE8 A;  4RH8 A;  4O43 A;  4ZYH A;  1EKZ A;  1A1G A;  1RC7 A;  2EN3 A;  4JI2 E;  3ADL A;  4DR4 E;  2FV4 B;  1A1K A;  1BB8 A;  2RQL A;  2RS6 A;  4F54 A;  4MLV A;  2CTD A;  1PKP A;  1FJG E;  1A1F A;  2EOE A;  2EMX A;  2PRT A;  1X6E A;  3FIG A;  2EN6 A;  2HJJ A;  2V89 A;  1YZ9 A;  4WX9 A;  4DR2 E;  3BGH A;  2L3C A;  3EQ1 A;  4DUZ E;  2EMC A;  4WSP A;  2A25 A;  2EMH A;  4JI4 E;  4JI0 E;  2EPL X;  1YSA C;  2ELZ A;  2JXP A;  3QG5 C;  2EM0 A;  4WYQ B;  4DV6 E;  4YY3 E;  2NUE A;  1IMU A;  2EPM X;  4HTG A;  2NA2 A;  2GPI A;  2YTP A;  2KOU A;  1YFH A;  1JK1 A;  2UUC E;  4BC7 A;  2VRD A;  2EOJ A;  4R2D A;  4DUY E;  1JK2 A;  2L92 A;  4GKJ E;  2ENA A;  2L6M A;  4WSG A;  4DR1 E;  4BBY A;  3OML A;  4R03 A;  2K4V A;  3J81 C;  1A1I A;  2EN2 A;  4O24 A;  2EOR A;  5IXM B;  2WZO A;  1I94 E;  2YPN A;  1IBK E;  5A6K A;  1IBL E;  3VK6 A;  2DMI A;  4J8Z A;  4B3R E;  3C6K A;  3JTZ A;  1KYQ A;  1Z1B A;  2MKD A;  2EN4 A;  2EMW A;  4BMJ A;  2CPN A;  1IBM E;  3THN A;  4FK5 C;  2EPN A;  2EOI A;  4M2Z A;  2LJH A;  4X64 E;  1DQ3 A;  2EWL A;  1GQE A;  4JI8 E;  4R2C A;  2EN1 A;  2DIX A;  2BB8 A;  5KL3 A;  1TF6 A;  4TUG A;  4F2J C;  2YU5 A;  4GKK E;  1A1H A;  4LU9 A;  1MGT A;  2ZM6 E;  3EPH A;  1X3C A;  2RSI A;  2YTQ A;  4K0K E;  1X47 A;  3KZZ A;  1BBO A;  2EOF A;  1L4S A;  2EL4 A;  3BBG A; 
#chains in the Genus database with same CATH homology
 5AAS A;  1EKZ A;  1RC7 A;  4B3S E;  2JOX A;  4L5N C;  4LF8 E;  4BCA A;  1FKA E;  1QU6 A;  2RSM A;  5DNY A;  5LMU E;  3H09 A;  4JI2 E;  3ADL A;  2L2N A;  3K6Q A;  2V86 A;  4DR4 E;  4JYA E;  2JR1 A;  4WFT A;  2FV4 B;  3LLH A;  2UUB E;  3KWR A;  3JAM C;  3C4T A;  2RS6 A;  4F54 A;  2HHH E;  4LFB E;  1GZ6 A;  5BR8 E;  1WHQ A;  4JI5 E;  4NXN E;  1PKP A;  2V8Q B;  4LF6 E;  1FJG E;  1UIL A;  4X66 E;  2KHX A;  2LBS B;  4DV3 E;  4YHH E;  1J26 A;  1ZBT A;  4DV7 E;  3FIG A;  2B7V A;  4F9B B;  2VQE E;  1WXR A;  1N34 E;  2NUG A;  2NUF A;  1N36 E;  4LF7 E;  2EZ6 A;  2V89 A;  2DB2 A;  3ADI A;  2RTX A;  1YZ9 A;  2UXD E;  1UHZ A;  3HXL A;  4M0V A;  2LRS A;  5AE2 A;  2L3J A;  4DR2 E;  3MSW A;  3P1X A;  4OX9 E;  3HPS A;  2L3C A;  5ADZ A;  4DUZ E;  4AQY E;  3AUZ A;  3LML A;  4R8O A;  3OTO E;  3T1H E;  4WSP A;  4BC9 A;  5IWA E;  3J7Y p;  4JI4 E;  2RS7 A;  2L2K B;  4KZS A;  4JI0 E;  4LTY A;  4B3M E;  1RQ0 A;  3ZOQ B;  2DMY A;  3VYX A;  4GEQ B;  1HNX E;  3HPZ A;  2MC5 A;  4DV1 E;  4TUI A;  2LUQ A;  2L8T A;  2V85 A;  3DF6 A;  2G7H A;  1XNQ E;  3HTX A;  3ADJ A;  4DR7 E;  2ODR C;  4WYQ B;  4DV6 E;  4YY3 E;  2NUE A;  1T4N A;  4BS9 A;  2M1S A;  3T1Y E;  4DKK A;  2NA2 A;  1XNR E;  1YYK A;  2B9D A;  2KOU A;  2JVA A;  3DJW A;  4BC7 A;  2UUC E;  2UXB E;  2LUP B;  1HNZ E;  4LFA E;  2LE2 A;  1YYW A;  4DV4 E;  4JI1 E;  4JI3 E;  2V83 A;  4DMI A;  4DR3 E;  2V88 A;  4DUY E;  3IWB A;  2M7Q A;  2L92 A;  4P7D A;  4GKJ E;  4DR5 E;  2L6M A;  4X62 E;  3ADG A;  1T4O A;  1STU A;  3OML A;  4BBY A;  4DR1 E;  4LF5 E;  2B3T B;  3F6H A;  4R03 A;  2KON A;  2K4V A;  2VE7 C;  1T4L B;  3J81 C;  4L8N A;  5CFF E;  2JWO A;  3JU0 A;  4JV5 E;  2M4I A;  1YYO A;  2WZO A;  2F8B A;  5T6J A;  5AE1 A;  2DSY A;  2FTX B;  1I94 E;  3VYY A;  1IBK E;  3J80 C;  1IBL E;  3IWD A;  2YT4 A;  2FGG A;  5LL6 R;  3VK6 A;  1XMQ E;  4LFC E;  4J8Z A;  4B3R E;  5FLX C;  3JTZ A;  1SR9 A;  4F9A B;  5LMN E;  2V87 A;  2LTR A;  2MDR A;  4LF4 E;  4F9C B;  4BMJ A;  2CPN A;  2H36 X;  2N3G A;  1ZBQ A;  4DV0 E;  3RMP A;  1IBM E;  1HNW E;  4M2Z A;  2LMZ A;  4LF9 E;  1N33 E;  2LJH A;  4X64 E;  4DV5 E;  1DQ3 A;  1O0W A;  3AV0 A;  2EWL A;  4OOG C;  4X65 E;  2VF1 A;  1GQE A;  2JOB A;  1N32 E;  4JI8 E;  2MC6 A;  5A2Q C;  2L33 A;  1J5E E;  2DIX A;  4DR6 E;  2F4V E;  4I8O A;  2YZT A;  4JI6 E;  3C4B A;  2L2M A;  4P78 A;  2E1M A;  5AE3 A;  3HQ1 A;  4WPY A;  2IHR 1;  2JY9 A;  4TUG A;  5F3W A;  4B3T E;  2B7T A;  4KHP E;  2N3H A;  4X8W A;  5IT9 C;  4M30 A;  4GKK E;  2UXC E;  4LU9 A;  4NXM E;  4Q28 A;  4JI7 E;  1X49 A;  2VQF E;  2ZM6 E;  1HR0 E;  2UUA E;  1XMO E;  4DV2 E;  4K0K E;  1X47 A;  1WHN A;  3IWC A;  2ODR D;  2E5L E;  3F6G A;  2UU9 E;  3J7A G;  1DI2 A;  2LTS A;  1X48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...