1J26A

Solution structure of a putative peptidyl-trna hydrolase domain in a mouse hypothetical protein
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
112
structure length
112
Chain Sequence
GSSGSSGEHAKQASSYIPLDRLSISYCRSSGPGGQNVNKVNSKAEVRFHLASADWIEEPVRQKIALTHKNKINKAGELVLTSESSRYQFRNLAECLQKIRDMIAEASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords immature colon carcinoma transcript 1
publication title Solution structure of the catalytic domain of the mitochondrial protein ICT1 that is essential for cell vitality
pubmed doi rcsb
source organism Mus musculus
total genus 25
structure length 112
sequence length 112
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2002-12-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1j26A01
4DV4E 2N3HA 4WFTA 4LFBE 2B7TA 4DR7E 2F4VE 2LTRA 4DUYE 1HNXE 4LF7E 1IBKE 4GKKE 1O0WA 4DR6E 4JI3E 4LFCE 4DUZE 1YYOA 4DR2E 2JVAA 1YYWA 3OTOE 1HNZE 1PKPA 4GKJE 5LMNE 2RS7A 4WYQB 4LF5E 1RC7A 1FJGE 4JV5E 1EKZA 4LF6E 1XMOE 1I94E 2L33A 1X49A 1UILA 4B3TE 2B7VA 2RTXA 2LRSA 2L2MA 5BR8E 2LBSB 1ZBTA 2MDRA 3T1HE 2UXCE 2NUFA 4DV5E 2UXDE 2L3JA 4B3SE 4DR1E 1T4LB 1UHZA 4X65E 1X47A 4M2ZA 4AQYE 5CFFE 1N33E 4JI7E 3J7Yp 1XMQE 2NUEA 2IHR1 4B3ME 4DV2E 1J5EE 2HHHE 4DKKA 2RSMA 2VQEE 4DV0E 1N34E 4JYAE 4LF9E 4M30A 4DV1E 4NXNE 4JI0E 1N32E 1RQ0A 4YY3E 3LLHA 2NUGA 1YYKA 4K0KE 2ZM6E 1DI2A 1IBLE 4KHPE 1HNWE 2L2NA 4X64E 4DV6E 4DR3E 5IWAE 3HTXA 4OOGC 4LF4E 2JY9A 2NA2A 2UXBE 3ADIA 2DB2A 2DIXA 1YZ9A 1GQEA 2UUBE 2L2KB 2KHXA 4LFAE 2N3GA 4JI4E 4DR4E 3ADJA 1WHNA 1X48A 2LUQA 2LUPB 4DV7E 1T4OA 4JI2E 1HR0E 3C4BA 3VYXA 3ADGA 5LMUE 2VQFE 3VYYA 2CPNA 2LJHA 3P1XA 3C4TA 1T4NA 4JI1E 2L3CA 4NXME 4YHHE 4X66E 2B3TB 1XNRE 2UUAE 1STUA 2LTSA 3T1YE 4DR5E 4X62E 2UU9E 1QU6A 4JI8E 4JI5E 2YT4A 4X8WA 4DV3E 2RS6A 2E5LE 1XNQE 1J26A 1FKAE 3ADLA 4B3RE 1WHQA 1IBME 4OX9E 4JI6E 2EZ6A 2DMYA 1N36E 2UUCE 4LF8E
chains in the Genus database with same CATH superfamily
4DV4E 2ENHA 2EN3A 2VE7C 1PDAA 1QNTA 2V85A 5LL6R 2F4VE 2E1MA 2ELYA 3J80C 5A6BA 4LFCE 1YYOA 1X6EA 4RHBB 1HNZE 3DF6A 4R2EA 1PKPA 1TN9A 2RS7A 2MC5A 4M9VC 1EKZA 2EMCA 2EOSA 2D9HA 2YTOA 2B7VA 2L2MA 5BR8E 1RMDA 1ZBTA 5FLXC 3HPZA 1A1JA 4M2ZA 2Q8UA 2EPKX 3J7Yp 1XMQE 5A6AA 2DMIA 2EMWA 2EOMA 2YRKA 3BBGA 3EQ1A 1YFHA 3BIDA 4LF9E 1KJKA 3JU0A 2EOEA 3MSWA 4NXNE 1X5WA 2EPCA 1P47A 4YY3E 2EN4A 2LV2A 1YSAC 1NEIA 4BHCA 2WZOA 1EH6A 1A1HA 4HEIA 4IS1C 4X64E 5F3WA 2ADRA 1X3CA 2LO3A 2JY9A 2NA2A 1F2IG 3K6QA 3ADIA 4BBYA 2EPLX 2YWQA 1GQEA 2UUBE 2EMBA 2YTNA 4LFAE 3ECRA 2EOOA 2WCC3 3UK3C 1WHNA 2LUPB 2JP9A 2EMIA 1ZR9A 3HPSA 5AE3A 2FV4B 1MEYC 3VYXA 3ADGA 2VQFE 3C4TA 4NXME 2YU5A 4YHHE 4X66E 2B3TB 2YTDA 4KZSA 2LTSA 2EPXA 2V86A 5AE1A 4DR5E 4FK5C 2ODRC 2V87A 2EORA 3RMPA 2JR1A 5KL4A 4O5GA 2YTFA 1IMUA 2EMXA 2EM0A 2EMAA 5KL7A 4JI6E 1N36E 4GKKE 3THNA 4BHBA 2M7QA 2CSHA 2ELZA 2J7JA 4GZNC 2DGCA 3KZYA 3MHSC 4ZYEA 4DR6E 1YPNA 2EMHA 1YYWA 4BCAA 2EPAA 2B9DA 2WBUA 2EE8A 2YTQA 4WYQB 2EQ0A 2L33A 1T39A 3HQ1A 2M4IA 2EM8A 5IV8B 1PJQA 1UILA 2EL6A 3M99B 1BBOA 4R2AA 2LBSB 2CTDA 2YTPA 2M1SA 4O24A 2JOBA 2EL5A 1B69A 4DV5E 2UXDE 4BS9A 2L3JA 4F6NA 4LTYA 4DR1E 1X47A 5CFFE 1N33E 4KWYA 2V83A 5ADZA 4DV2E 1UN6B 2EPZA 4ZYDA 2HHHE 2RSMA 4DV0E 2EOQA 5A6JA 2YRHA 2FGGA 4JYAE 5KL3A 1KYQA 4WXCA 4DV1E 1N32E 1G2FC 5LLQA 4WXDA 5KL2A 1YYKA 2EJ4A 2ZM6E 1DI2A 1IBLE 1HNWE 4MLQA 2EQ3A 4DV6E 2JOXA 4LF4E 4BMJA 2EMFA 2ENAA 2YTJA 1PJSA 2DB2A 2RPCA 2KHXA 2N3GA 2F8BA 2ODRD 2LUQA 1X48A 3LMLA 4DV7E 1T4OA 4JI2E 2EPMX 4R2PA 4L5NC 3VYYA 2CPNA 2LJUA 5AC4A 1T4NA 4JI1E 2YU8A 2R76A 2UUAE 1STUA 2NABA 1EH7A 2EM3A 1YUIA 4TUIA 4DMIA 4JI8E 1MGTA 2WBSA 4R8OA 1UBDC 4B3RE 2EPUA 2DLQA 4X9JA 3DJWA 2EZ6A 5TSEA 1SFEA 2EMZA 3BGHA 5A2QC 2N3HA 4WFTA 2B7TA 2YZTA 2EM6A 4DUYE 1IBKE 2CT1A 4M0VA 1DGCA 2YSPA 2EWLA 2L92A 4DUZE 1X6FA 4JI3E 4DR2E 1BBGA 3OTOE 4P7DA 2GHFA 4F2JC 3IWCA 1TF3A 1AH5A 4LF5E 4JV5E 1RC7A 1FJGE 4LF6E 1I94E 2EOFA 5A6KA 1GTKA 5AASA 2EN8A 2LRSA 2V89A 2M9AA 5A69A 2GLIA 1ZAAC 4R2CA 1ZU1A 3T1HE 3JAMC 2GPIA 3KWRA 4B3SE 1T4LB 4X65E 2BBGA 3EPKA 2MC6A 1BB8A 2LCEA 2HC5A 2LE2A 4JI7E 4IJDA 2NUEA 2IHR1 2V8QB 2HGHA 1A1GA 1J5EE 1JK2A 2EMKA 2JYAA 2H36X 4WPYA 4LU9A 4BC9A 2EN6A 4R2DA 4M30A 2R1FA 4JI0E 2MKDA 2K7IA 5AC5A 5KL6A 2PRTA 4K0KE 1A1KA 3C6MA 4N4RB 1TF6A 3MHHC 4TUGA 3VK6A 3HXLA 4P78A 5IWAE 2FTXB 2DRPA 4OOGC 2VF1A 3BF2A 3THOB 2EMYA 3JTZA 2VRDA 5KL5A 1YZ9A 2MDGA 2KOUA 3ZOQB 1PJTA 4GEQB 4WX9A 4O4KA 1HR0E 3C4BA 4I8OA 5LMUE 2G7HA 2EOIA 3L00A 2LT7A 4ZYGA 2DLKA 2EL4A 2L3CA 3EPJA 1NCSA 2KONA 2BB8A 3T1YE 2YTEA 2UU9E 1LLMC 3QG5C 1WJPA 4DV3E 4F54A 2EPNA 1XNQE 1J26A 1WRJA 2MKNA 3ADLA 2I9IA 1IBME 5IXMB 4RH8A 1JK1A 4JI5E 4LF8E 2JXPA 3J81C 2RSIA 1WXRA 3H09A 4LFBE 4F6MA 4DR7E 3J7AG 3AUZA 2LTRA 1HNXE 5DNYA 2EN2A 4LF7E 4F9BB 1O0WA 2JVAA 2EOYA 1AAYA 5IT9C 3FIGA 2EN1A 4GKJE 3AV0A 2EOZA 5LMNE 2EPRA 2I13A 1XMOE 3EPLA 3IWBA 4WSPA 1X49A 2EMGA 4R2QA 1T38A 2L6MA 4B3TE 5AE2A 2EQ1A 4O43A 2EN7A 4R2RA 2RTXA 2LVHA 1ZBQA 2K4VA 2LMZA 1EH8A 1SR9A 2MDRA 2UXCE 4R03A 2NUFA 3EPHA 1UHZA 4NHRA 2EM4A 1A1IA 3F6HA 4AQYE 4Q28A 3OMLA 4B3ME 1YUJA 4DKKA 2VQEE 1N34E 2EPPA 1IQOA 4R2SA 4MLVA 1IQSA 2EOJA 4F9AB 4NZVA 2YTIA 4ZYHA 1RQ0A 3LLHA 2NUGA 2WBTA 4Q35B 2EM2A 2A25A 4KHPE 3F6GA 2L2NA 4DR3E 1GZ6A 1A1LA 4WSGA 2JPAA 3HTXA 2UXBE 2EMLA 3IWDA 2EM7A 2DIXA 2YSOA 1X6HA 2L2KB 2EM5A 1Z1BA 4JI4E 4DR4E 3ADJA 1A1FA 2EM9A 2L8TA 5A6BD 2DSYA 1DQ3A 3C6KA 2EOXA 2LJHA 3P1XA 2HJJA 2EP3A 2V88A 3TQMA 2N8XA 1N3GA 1XNRE 2YTGA 5T6JA 1L4SA 2ENCA 2JWOA 4X62E 4BC7A 2RQLA 1QU6A 2EOHA 2YT4A 4J8ZA 4X8WA 1G2DC 2E5LE 2E72A 2RS6A 2YRMA 4L8NA 3VHTB 1FKAE 1WHQA 3KZZA 4OX9E 2EPOA 4F9CB 2DMYA 4HTGA 2UUCE 2YPNA
chains in the Genus database with same CATH topology
4DV4E 3J81C 5A2QC 1WXRA 2N3HA 3H09A 2VE7C 4WFTA 2M7QA 4LFBE 2B7TA 2V85A 5LL6R 3J7AG 2F4VE 2YZTA 2E1MA 3AUZA 4DR7E 2LTRA 4DUYE 5DNYA 1HNXE 1IBKE 4M0VA 3J80C 4F9BB 1O0WA 4LF7E 4DR6E 2EWLA 2L92A 4DUZE 1YYOA 4JI3E 4DR2E 4LFCE 2JVAA 1YYWA 4BCAA 3OTOE 3FIGA 4P7DA 3DF6A 5IT9C 1HNZE 1PKPA 2B9DA 3IWCA 4GKJE 3AV0A 5LMNE 2RS7A 4WYQB 2MC5A 1RC7A 4LF5E 1FJGE 4JV5E 1EKZA 4LF6E 1XMOE 1I94E 2L33A 3HQ1A 2M4IA 3IWBA 4WSPA 1X49A 2L6MA 1UILA 5AASA 5AE2A 4B3TE 2B7VA 2RTXA 2LRSA 2V89A 2L2MA 5BR8E 2LBSB 1ZBQA 2K4VA 1ZBTA 2LMZA 2M1SA 2JOBA 5FLXC 1SR9A 2MDRA 3HPZA 3T1HE 2UXCE 4R03A 2NUFA 4DV5E 2UXDE 4BS9A 3JAMC 2L3JA 3KWRA 4LTYA 4DR1E 1T4LB 1UHZA 4X65E 4B3SE 1X47A 2MC6A 4M2ZA 3F6HA 4AQYE 4Q28A 5CFFE 2LE2A 3OMLA 2V83A 4JI7E 3J7Yp 5ADZA 1XMQE 2IHR1 2V8QB 4B3ME 4DV2E 2NUEA 1J5EE 2HHHE 4DKKA 2RSMA 2VQEE 4DV0E 1N34E 2H36X 4WPYA 4LU9A 2FGGA 4JYAE 4BC9A 4LF9E 3JU0A 3MSWA 4M30A 4DV1E 4JI0E 4NXNE 1N32E 4F9AB 1RQ0A 4YY3E 3LLHA 2NUGA 1YYKA 4K0KE 2WZOA 2ZM6E 1DI2A 4TUGA 1IBLE 4KHPE 1HNWE 3VK6A 3F6GA 2L2NA 3HXLA 1GZ6A 4X64E 4DV6E 4P78A 5IWAE 4DR3E 5F3WA 3HTXA 2FTXB 4GKKE 2JOXA 4OOGC 2JY9A 2NA2A 4LF4E 2UXBE 2VF1A 4BMJA 3IWDA 3K6QA 3ADIA 4BBYA 2DB2A 2DIXA 1YZ9A 3JTZA 1GQEA 2UUBE 2KOUA 2L2KB 2KHXA 3ZOQB 4LFAE 2N3GA 4GEQB 4JI4E 3ADJA 4DR4E 2F8BA 2ODRD 1WHNA 1X48A 2LUQA 2LUPB 3LMLA 2L8TA 1T4OA 3HPSA 2DSYA 5AE3A 4DV7E 2FV4B 4JI2E 1HR0E 3C4BA 3VYXA 4I8OA 3ADGA 5LMUE 1DQ3A 2VQFE 4L5NC 2G7HA 3VYYA 2CPNA 2LJHA 3P1XA 3C4TA 1T4NA 4JI1E 2L3CA 4NXME 2V88A 1N33E 4YHHE 4X66E 2B3TB 4KZSA 2KONA 1XNRE 2UUAE 1STUA 5T6JA 2LTSA 2V86A 3T1YE 5AE1A 2JWOA 4DR5E 4X62E 4TUIA 4BC7A 2UU9E 1QU6A 2ODRC 2V87A 4JI8E 4DMIA 2YT4A 4J8ZA 3RMPA 4JI5E 4X8WA 2JR1A 4R8OA 2RS6A 4F54A 4DV3E 2E5LE 1XNQE 4L8NA 1J26A 1FKAE 3ADLA 4B3RE 1WHQA 1IBME 4OX9E 3DJWA 4JI6E 4F9CB 2EZ6A 2DMYA 1N36E 2UUCE 4LF8E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV4 E;  2N3H A;  4WFT A;  4LFB E;  2B7T A;  4DR7 E;  2F4V E;  2LTR A;  4DUY E;  1HNX E;  4LF7 E;  1IBK E;  4GKK E;  1O0W A;  4DR6 E;  4JI3 E;  4LFC E;  4DUZ E;  1YYO A;  4DR2 E;  2JVA A;  1YYW A;  3OTO E;  1HNZ E;  1PKP A;  4GKJ E;  5LMN E;  2RS7 A;  4WYQ B;  4LF5 E;  1RC7 A;  1FJG E;  4JV5 E;  1EKZ A;  4LF6 E;  1XMO E;  1I94 E;  2L33 A;  1X49 A;  1UIL A;  4B3T E;  2B7V A;  2RTX A;  2LRS A;  2L2M A;  5BR8 E;  2LBS B;  1ZBT A;  2MDR A;  3T1H E;  2UXC E;  2NUF A;  4DV5 E;  2UXD E;  2L3J A;  4B3S E;  4DR1 E;  1T4L B;  1UHZ A;  4X65 E;  1X47 A;  4M2Z A;  4AQY E;  5CFF E;  1N33 E;  4JI7 E;  3J7Y p;  1XMQ E;  2NUE A;  2IHR 1;  4B3M E;  4DV2 E;  1J5E E;  2HHH E;  4DKK A;  2RSM A;  2VQE E;  4DV0 E;  1N34 E;  4JYA E;  4LF9 E;  4M30 A;  4DV1 E;  4NXN E;  4JI0 E;  1N32 E;  1RQ0 A;  4YY3 E;  3LLH A;  2NUG A;  1YYK A;  4K0K E;  2ZM6 E;  1DI2 A;  1IBL E;  4KHP E;  1HNW E;  2L2N A;  4X64 E;  4DV6 E;  4DR3 E;  5IWA E;  3HTX A;  4OOG C;  4LF4 E;  2JY9 A;  2NA2 A;  2UXB E;  3ADI A;  2DB2 A;  2DIX A;  1YZ9 A;  1GQE A;  2UUB E;  2L2K B;  2KHX A;  4LFA E;  2N3G A;  4JI4 E;  4DR4 E;  3ADJ A;  1WHN A;  1X48 A;  2LUQ A;  2LUP B;  4DV7 E;  1T4O A;  4JI2 E;  1HR0 E;  3C4B A;  3VYX A;  3ADG A;  5LMU E;  2VQF E;  3VYY A;  2CPN A;  2LJH A;  3P1X A;  3C4T A;  1T4N A;  4JI1 E;  2L3C A;  4NXM E;  4YHH E;  4X66 E;  2B3T B;  1XNR E;  2UUA E;  1STU A;  2LTS A;  3T1Y E;  4DR5 E;  4X62 E;  2UU9 E;  1QU6 A;  4JI8 E;  4JI5 E;  2YT4 A;  4X8W A;  4DV3 E;  2RS6 A;  2E5L E;  1XNQ E;  1J26 A;  1FKA E;  3ADL A;  4B3R E;  1WHQ A;  1IBM E;  4OX9 E;  4JI6 E;  2EZ6 A;  2DMY A;  1N36 E;  2UUC E;  4LF8 E; 
#chains in the Genus database with same CATH topology
 4DV4 E;  2ENH A;  2EN3 A;  2VE7 C;  1PDA A;  1QNT A;  2V85 A;  5LL6 R;  2F4V E;  2E1M A;  2ELY A;  3J80 C;  5A6B A;  4LFC E;  1YYO A;  1X6E A;  4RHB B;  1HNZ E;  3DF6 A;  4R2E A;  1PKP A;  1TN9 A;  2RS7 A;  2MC5 A;  4M9V C;  1EKZ A;  2EMC A;  2EOS A;  2D9H A;  2YTO A;  2B7V A;  2L2M A;  5BR8 E;  1RMD A;  1ZBT A;  5FLX C;  3HPZ A;  1A1J A;  4M2Z A;  2Q8U A;  2EPK X;  3J7Y p;  1XMQ E;  5A6A A;  2DMI A;  2EMW A;  2EOM A;  2YRK A;  3BBG A;  3EQ1 A;  1YFH A;  3BID A;  4LF9 E;  1KJK A;  3JU0 A;  2EOE A;  3MSW A;  4NXN E;  1X5W A;  2EPC A;  1P47 A;  4YY3 E;  2EN4 A;  2LV2 A;  1YSA C;  1NEI A;  4BHC A;  2WZO A;  1EH6 A;  1A1H A;  4HEI A;  4IS1 C;  4X64 E;  5F3W A;  2ADR A;  1X3C A;  2LO3 A;  2JY9 A;  2NA2 A;  1F2I G;  3K6Q A;  3ADI A;  4BBY A;  2EPL X;  2YWQ A;  1GQE A;  2UUB E;  2EMB A;  2YTN A;  4LFA E;  3ECR A;  2EOO A;  2WCC 3;  3UK3 C;  1WHN A;  2LUP B;  2JP9 A;  2EMI A;  1ZR9 A;  3HPS A;  5AE3 A;  2FV4 B;  1MEY C;  3VYX A;  3ADG A;  2VQF E;  3C4T A;  4NXM E;  2YU5 A;  4YHH E;  4X66 E;  2B3T B;  2YTD A;  4KZS A;  2LTS A;  2EPX A;  2V86 A;  5AE1 A;  4DR5 E;  4FK5 C;  2ODR C;  2V87 A;  2EOR A;  3RMP A;  2JR1 A;  5KL4 A;  4O5G A;  2YTF A;  1IMU A;  2EMX A;  2EM0 A;  2EMA A;  5KL7 A;  4JI6 E;  1N36 E;  4GKK E;  3THN A;  4BHB A;  2M7Q A;  2CSH A;  2ELZ A;  2J7J A;  4GZN C;  2DGC A;  3KZY A;  3MHS C;  4ZYE A;  4DR6 E;  1YPN A;  2EMH A;  1YYW A;  4BCA A;  2EPA A;  2B9D A;  2WBU A;  2EE8 A;  2YTQ A;  4WYQ B;  2EQ0 A;  2L33 A;  1T39 A;  3HQ1 A;  2M4I A;  2EM8 A;  5IV8 B;  1PJQ A;  1UIL A;  2EL6 A;  3M99 B;  1BBO A;  4R2A A;  2LBS B;  2CTD A;  2YTP A;  2M1S A;  4O24 A;  2JOB A;  2EL5 A;  1B69 A;  4DV5 E;  2UXD E;  4BS9 A;  2L3J A;  4F6N A;  4LTY A;  4DR1 E;  1X47 A;  5CFF E;  1N33 E;  4KWY A;  2V83 A;  5ADZ A;  4DV2 E;  1UN6 B;  2EPZ A;  4ZYD A;  2HHH E;  2RSM A;  4DV0 E;  2EOQ A;  5A6J A;  2YRH A;  2FGG A;  4JYA E;  5KL3 A;  1KYQ A;  4WXC A;  4DV1 E;  1N32 E;  1G2F C;  5LLQ A;  4WXD A;  5KL2 A;  1YYK A;  2EJ4 A;  2ZM6 E;  1DI2 A;  1IBL E;  1HNW E;  4MLQ A;  2EQ3 A;  4DV6 E;  2JOX A;  4LF4 E;  4BMJ A;  2EMF A;  2ENA A;  2YTJ A;  1PJS A;  2DB2 A;  2RPC A;  2KHX A;  2N3G A;  2F8B A;  2ODR D;  2LUQ A;  1X48 A;  3LML A;  4DV7 E;  1T4O A;  4JI2 E;  2EPM X;  4R2P A;  4L5N C;  3VYY A;  2CPN A;  2LJU A;  5AC4 A;  1T4N A;  4JI1 E;  2YU8 A;  2R76 A;  2UUA E;  1STU A;  2NAB A;  1EH7 A;  2EM3 A;  1YUI A;  4TUI A;  4DMI A;  4JI8 E;  1MGT A;  2WBS A;  4R8O A;  1UBD C;  4B3R E;  2EPU A;  2DLQ A;  4X9J A;  3DJW A;  2EZ6 A;  5TSE A;  1SFE A;  2EMZ A;  3BGH A;  5A2Q C;  2N3H A;  4WFT A;  2B7T A;  2YZT A;  2EM6 A;  4DUY E;  1IBK E;  2CT1 A;  4M0V A;  1DGC A;  2YSP A;  2EWL A;  2L92 A;  4DUZ E;  1X6F A;  4JI3 E;  4DR2 E;  1BBG A;  3OTO E;  4P7D A;  2GHF A;  4F2J C;  3IWC A;  1TF3 A;  1AH5 A;  4LF5 E;  4JV5 E;  1RC7 A;  1FJG E;  4LF6 E;  1I94 E;  2EOF A;  5A6K A;  1GTK A;  5AAS A;  2EN8 A;  2LRS A;  2V89 A;  2M9A A;  5A69 A;  2GLI A;  1ZAA C;  4R2C A;  1ZU1 A;  3T1H E;  3JAM C;  2GPI A;  3KWR A;  4B3S E;  1T4L B;  4X65 E;  2BBG A;  3EPK A;  2MC6 A;  1BB8 A;  2LCE A;  2HC5 A;  2LE2 A;  4JI7 E;  4IJD A;  2NUE A;  2IHR 1;  2V8Q B;  2HGH A;  1A1G A;  1J5E E;  1JK2 A;  2EMK A;  2JYA A;  2H36 X;  4WPY A;  4LU9 A;  4BC9 A;  2EN6 A;  4R2D A;  4M30 A;  2R1F A;  4JI0 E;  2MKD A;  2K7I A;  5AC5 A;  5KL6 A;  2PRT A;  4K0K E;  1A1K A;  3C6M A;  4N4R B;  1TF6 A;  3MHH C;  4TUG A;  3VK6 A;  3HXL A;  4P78 A;  5IWA E;  2FTX B;  2DRP A;  4OOG C;  2VF1 A;  3BF2 A;  3THO B;  2EMY A;  3JTZ A;  2VRD A;  5KL5 A;  1YZ9 A;  2MDG A;  2KOU A;  3ZOQ B;  1PJT A;  4GEQ B;  4WX9 A;  4O4K A;  1HR0 E;  3C4B A;  4I8O A;  5LMU E;  2G7H A;  2EOI A;  3L00 A;  2LT7 A;  4ZYG A;  2DLK A;  2EL4 A;  2L3C A;  3EPJ A;  1NCS A;  2KON A;  2BB8 A;  3T1Y E;  2YTE A;  2UU9 E;  1LLM C;  3QG5 C;  1WJP A;  4DV3 E;  4F54 A;  2EPN A;  1XNQ E;  1J26 A;  1WRJ A;  2MKN A;  3ADL A;  2I9I A;  1IBM E;  5IXM B;  4RH8 A;  1JK1 A;  4JI5 E;  4LF8 E;  2JXP A;  3J81 C;  2RSI A;  1WXR A;  3H09 A;  4LFB E;  4F6M A;  4DR7 E;  3J7A G;  3AUZ A;  2LTR A;  1HNX E;  5DNY A;  2EN2 A;  4LF7 E;  4F9B B;  1O0W A;  2JVA A;  2EOY A;  1AAY A;  5IT9 C;  3FIG A;  2EN1 A;  4GKJ E;  3AV0 A;  2EOZ A;  5LMN E;  2EPR A;  2I13 A;  1XMO E;  3EPL A;  3IWB A;  4WSP A;  1X49 A;  2EMG A;  4R2Q A;  1T38 A;  2L6M A;  4B3T E;  5AE2 A;  2EQ1 A;  4O43 A;  2EN7 A;  4R2R A;  2RTX A;  2LVH A;  1ZBQ A;  2K4V A;  2LMZ A;  1EH8 A;  1SR9 A;  2MDR A;  2UXC E;  4R03 A;  2NUF A;  3EPH A;  1UHZ A;  4NHR A;  2EM4 A;  1A1I A;  3F6H A;  4AQY E;  4Q28 A;  3OML A;  4B3M E;  1YUJ A;  4DKK A;  2VQE E;  1N34 E;  2EPP A;  1IQO A;  4R2S A;  4MLV A;  1IQS A;  2EOJ A;  4F9A B;  4NZV A;  2YTI A;  4ZYH A;  1RQ0 A;  3LLH A;  2NUG A;  2WBT A;  4Q35 B;  2EM2 A;  2A25 A;  4KHP E;  3F6G A;  2L2N A;  4DR3 E;  1GZ6 A;  1A1L A;  4WSG A;  2JPA A;  3HTX A;  2UXB E;  2EML A;  3IWD A;  2EM7 A;  2DIX A;  2YSO A;  1X6H A;  2L2K B;  2EM5 A;  1Z1B A;  4JI4 E;  4DR4 E;  3ADJ A;  1A1F A;  2EM9 A;  2L8T A;  5A6B D;  2DSY A;  1DQ3 A;  3C6K A;  2EOX A;  2LJH A;  3P1X A;  2HJJ A;  2EP3 A;  2V88 A;  3TQM A;  2N8X A;  1N3G A;  1XNR E;  2YTG A;  5T6J A;  1L4S A;  2ENC A;  2JWO A;  4X62 E;  4BC7 A;  2RQL A;  1QU6 A;  2EOH A;  2YT4 A;  4J8Z A;  4X8W A;  1G2D C;  2E5L E;  2E72 A;  2RS6 A;  2YRM A;  4L8N A;  3VHT B;  1FKA E;  1WHQ A;  3KZZ A;  4OX9 E;  2EPO A;  4F9C B;  2DMY A;  4HTG A;  2UUC E;  2YPN A; 
#chains in the Genus database with same CATH homology
 4DV4 E;  3J81 C;  5A2Q C;  1WXR A;  2N3H A;  3H09 A;  2VE7 C;  4WFT A;  2M7Q A;  4LFB E;  2B7T A;  2V85 A;  5LL6 R;  3J7A G;  2F4V E;  2YZT A;  2E1M A;  3AUZ A;  4DR7 E;  2LTR A;  4DUY E;  5DNY A;  1HNX E;  1IBK E;  4M0V A;  3J80 C;  4F9B B;  1O0W A;  4LF7 E;  4DR6 E;  2EWL A;  2L92 A;  4DUZ E;  1YYO A;  4JI3 E;  4DR2 E;  4LFC E;  2JVA A;  1YYW A;  4BCA A;  3OTO E;  3FIG A;  4P7D A;  3DF6 A;  5IT9 C;  1HNZ E;  1PKP A;  2B9D A;  3IWC A;  4GKJ E;  3AV0 A;  5LMN E;  2RS7 A;  4WYQ B;  2MC5 A;  1RC7 A;  4LF5 E;  1FJG E;  4JV5 E;  1EKZ A;  4LF6 E;  1XMO E;  1I94 E;  2L33 A;  3HQ1 A;  2M4I A;  3IWB A;  4WSP A;  1X49 A;  2L6M A;  1UIL A;  5AAS A;  5AE2 A;  4B3T E;  2B7V A;  2RTX A;  2LRS A;  2V89 A;  2L2M A;  5BR8 E;  2LBS B;  1ZBQ A;  2K4V A;  1ZBT A;  2LMZ A;  2M1S A;  2JOB A;  5FLX C;  1SR9 A;  2MDR A;  3HPZ A;  3T1H E;  2UXC E;  4R03 A;  2NUF A;  4DV5 E;  2UXD E;  4BS9 A;  3JAM C;  2L3J A;  3KWR A;  4LTY A;  4DR1 E;  1T4L B;  1UHZ A;  4X65 E;  4B3S E;  1X47 A;  2MC6 A;  4M2Z A;  3F6H A;  4AQY E;  4Q28 A;  5CFF E;  2LE2 A;  3OML A;  2V83 A;  4JI7 E;  3J7Y p;  5ADZ A;  1XMQ E;  2IHR 1;  2V8Q B;  4B3M E;  4DV2 E;  2NUE A;  1J5E E;  2HHH E;  4DKK A;  2RSM A;  2VQE E;  4DV0 E;  1N34 E;  2H36 X;  4WPY A;  4LU9 A;  2FGG A;  4JYA E;  4BC9 A;  4LF9 E;  3JU0 A;  3MSW A;  4M30 A;  4DV1 E;  4JI0 E;  4NXN E;  1N32 E;  4F9A B;  1RQ0 A;  4YY3 E;  3LLH A;  2NUG A;  1YYK A;  4K0K E;  2WZO A;  2ZM6 E;  1DI2 A;  4TUG A;  1IBL E;  4KHP E;  1HNW E;  3VK6 A;  3F6G A;  2L2N A;  3HXL A;  1GZ6 A;  4X64 E;  4DV6 E;  4P78 A;  5IWA E;  4DR3 E;  5F3W A;  3HTX A;  2FTX B;  4GKK E;  2JOX A;  4OOG C;  2JY9 A;  2NA2 A;  4LF4 E;  2UXB E;  2VF1 A;  4BMJ A;  3IWD A;  3K6Q A;  3ADI A;  4BBY A;  2DB2 A;  2DIX A;  1YZ9 A;  3JTZ A;  1GQE A;  2UUB E;  2KOU A;  2L2K B;  2KHX A;  3ZOQ B;  4LFA E;  2N3G A;  4GEQ B;  4JI4 E;  3ADJ A;  4DR4 E;  2F8B A;  2ODR D;  1WHN A;  1X48 A;  2LUQ A;  2LUP B;  3LML A;  2L8T A;  1T4O A;  3HPS A;  2DSY A;  5AE3 A;  4DV7 E;  2FV4 B;  4JI2 E;  1HR0 E;  3C4B A;  3VYX A;  4I8O A;  3ADG A;  5LMU E;  1DQ3 A;  2VQF E;  4L5N C;  2G7H A;  3VYY A;  2CPN A;  2LJH A;  3P1X A;  3C4T A;  1T4N A;  4JI1 E;  2L3C A;  4NXM E;  2V88 A;  1N33 E;  4YHH E;  4X66 E;  2B3T B;  4KZS A;  2KON A;  1XNR E;  2UUA E;  1STU A;  5T6J A;  2LTS A;  2V86 A;  3T1Y E;  5AE1 A;  2JWO A;  4DR5 E;  4X62 E;  4TUI A;  4BC7 A;  2UU9 E;  1QU6 A;  2ODR C;  2V87 A;  4JI8 E;  4DMI A;  2YT4 A;  4J8Z A;  3RMP A;  4JI5 E;  4X8W A;  2JR1 A;  4R8O A;  2RS6 A;  4F54 A;  4DV3 E;  2E5L E;  1XNQ E;  4L8N A;  1J26 A;  1FKA E;  3ADL A;  4B3R E;  1WHQ A;  1IBM E;  4OX9 E;  3DJW A;  4JI6 E;  4F9C B;  2EZ6 A;  2DMY A;  1N36 E;  2UUC E;  4LF8 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...