1J26A

Solution structure of a putative peptidyl-trna hydrolase domain in a mouse hypothetical protein
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
112
structure length
112
Chain Sequence
GSSGSSGEHAKQASSYIPLDRLSISYCRSSGPGGQNVNKVNSKAEVRFHLASADWIEEPVRQKIALTHKNKINKAGELVLTSESSRYQFRNLAECLQKIRDMIAEASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the catalytic domain of the mitochondrial protein ICT1 that is essential for cell vitality
pubmed doi rcsb
source organism Mus musculus
molecule tags Translation
molecule keywords immature colon carcinoma transcript 1
total genus 25
structure length 112
sequence length 112
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2002-12-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1j26A01
4DR5E 4DKKA 4DV1E 2YT4A 1HR0E 1YZ9A 5LMUE 2UXDE 4JI6E 4AQYE 1J26A 5CFFE 1J5EE 4DV3E 4WFTA 4LF5E 4DR2E 2LJHA 2L2NA 3ADIA 4OOGC 1XMOE 2DMYA 3C4BA 1WHNA 4JI0E 2JY9A 1STUA 2B3TB 1T4LB 1YYKA 4K0KE 1HNZE 2LBSB 4JI7E 1O0WA 2LRSA 4LF8E 4DV6E 1DI2A 1ZBTA 1FJGE 4DR3E 4DUZE 1YYOA 1HNWE 4DV5E 4KHPE 2L3CA 4B3RE 4GKKE 1XMQE 5BR8E 2IHR1 2L3JA 2DB2A 1N32E 4JYAE 2UU9E 4NXME 2UUAE 2RTXA 1IBLE 4OX9E 1N33E 1X49A 1T4NA 4LF4E 4YHHE 2NUEA 1EKZA 1UHZA 2UUCE 2JVAA 2N3HA 4GKJE 2LTSA 4NXNE 4DR7E 4X8WA 1HNXE 2L33A 4JI2E 1N34E 3LLHA 1RQ0A 3HTXA 4X62E 2F4VE 2B7VA 2KHXA 2LUQA 2MDRA 2RSMA 1FKAE 4DV4E 2LTRA 4JI1E 1N36E 4DR1E 4JI3E 4JI8E 5IWAE 4DV2E 3OTOE 4JI4E 4X64E 4LFCE 1PKPA 2RS6A 4M30A 4DV7E 3ADGA 4YY3E 2E5LE 4DR6E 1GQEA 1XNRE 2UXCE 4LFBE 3J7Yp 4DR4E 4B3SE 4X66E 4WYQB 4JV5E 1WHQA 4B3ME 2L2MA 3T1HE 4LF6E 2UUBE 2LUPB 2RS7A 1IBKE 2EZ6A 3C4TA 3T1YE 2CPNA 2VQFE 1X47A 4X65E 2NUGA 3VYXA 3ADJA 2UXBE 1IBME 1X48A 2DIXA 4JI5E 3ADLA 1T4OA 4LF7E 4LFAE 2L2KB 4M2ZA 4DV0E 4DUYE 2ZM6E 1I94E 4LF9E 2NA2A 5LMNE 2N3GA 1UILA 2HHHE 3VYYA 2NUFA 1YYWA 2VQEE 1RC7A 4B3TE 1XNQE 1QU6A 3P1XA 2B7TA
chains in the Genus database with same CATH superfamily
4DR5E 2FTXB 1GZ6A 4DKKA 4F9BB 2BB8A 1JK1A 2EN4A 5TSEA 2EN2A 4JI6E 2FGGA 1J5EE 4WFTA 4OOGC 2DMYA 2M1SA 4HEIA 2G7HA 2EM0A 2JP9A 2EOEA 2EPNA 3HXLA 1O0WA 2LRSA 1AAYA 4LF8E 2R1FA 1DI2A 1ZBTA 4DR3E 1RMDA 2V83A 4F2JC 1BB8A 3MHHC 2EJ4A 1HNWE 1PJQA 2L3CA 2MKNA 2EL6A 3HPZA 3THOB 4P7DA 2GHFA 3BF2A 2EPOA 2LVHA 2DMIA 2UUAE 4WX9A 1EKZA 1YUIA 2EMYA 2FV4B 4R2QA 5KL3A 1EH8A 1NCSA 2N8XA 1A1JA 4DR7E 1HNXE 4O5GA 4WPYA 4TUIA 2WZOA 3LLHA 2EOSA 1RQ0A 3K6QA 4X62E 2EN6A 2EPUA 5AE2A 2RSMA 2LTRA 1X5WA 2EMCA 4I8OA 4BBYA 2D9HA 4WXDA 4JI3E 4JI8E 2YTIA 4J8ZA 4DR6E 4YY3E 4R2CA 2EMXA 2UXCE 2EMKA 3J7Yp 2EMZA 4WSGA 1WRJA 4NHRA 1F2IG 2RS7A 2YTQA 1DGCA 2L8TA 2CPNA 2M9AA 2A25A 1SFEA 3MSWA 3VYXA 2EMIA 3J80C 1PJSA 5IV8B 3AV0A 5AE1A 2YTGA 2L2KB 4HTGA 4ZYHA 2LJUA 2ZM6E 4LTYA 3BIDA 5KL5A 1EH6A 5LMNE 3JTZA 2HHHE 1BBOA 3JU0A 3VYYA 2YSOA 2RQLA 2YRHA 1A1GA 4BCAA 2YRKA 2YTNA 5KL2A 2YT4A 4L8NA 1YZ9A 5KL6A 1N3GA 5CFFE 2YSPA 5AASA 2EL4A 3DJWA 4KZSA 1A1HA 1IQSA 2B3TB 2EN3A 2YTEA 5A2QC 1HNZE 5AE3A 2LBSB 1L4SA 3J81C 1FJGE 4IS1C 1WJPA 2V85A 4IJDA 2CSHA 1MGTA 2JWOA 1UN6B 2LV2A 2EP3A 5A6BA 3KWRA 2WBTA 2YTPA 2DB2A 1N32E 3THNA 4R2DA 4OX9E 4WSPA 4LF4E 2EOMA 4YHHE 5DNYA 4F9AB 1ZR9A 2JVAA 2EPXA 1SR9A 2EOHA 4Q35B 2E72A 3H09A 4F6MA 1YSAC 2KOUA 2WBSA 1Z1BA 5ADZA 2YTJA 4F54A 4BC7A 3HTXA 2F4VE 2ODRC 2EOIA 2EPLX 2KHXA 3IWDA 4BC9A 1FKAE 4DV4E 1X6HA 2V86A 3BBGA 4MLQA 2DGCA 2DRPA 1A1LA 4M30A 4DV7E 2E5LE 1ZU1A 2RSIA 3EPKA 2EMGA 4KWYA 2EMFA 4DR4E 1YPNA 3JAMC 2EOQA 3IWBA 2GPIA 3VK6A 4X66E 2NABA 2EMWA 2L2MA 3T1HE 4BHBA 2UUBE 5A6JA 2EMHA 2MKDA 4R8OA 2EQ0A 2DIXA 2EPRA 4JI5E 4L5NC 4LF7E 1A1IA 2HGHA 2EOYA 4LFAE 3OMLA 4R2PA 4DV0E 4M2ZA 2JYAA 2EN7A 4ZYEA 1I94E 2EQ1A 4R2SA 2EMAA 2EM9A 2B9DA 2EPKX 2N3GA 2R76A 2EPCA 2V88A 2V8QB 3M99B 2L92A 1YYWA 2YZTA 4BS9A 2EMLA 1RC7A 1XNQE 1P47A 1A1FA 2ENCA 2B7TA 5LLQA 1G2DC 2EOOA 2MC6A 1NEIA 1HR0E 2EOZA 2EL5A 4R2RA 3VHTB 2V89A 4AQYE 4RHBB 1EH7A 4DV3E 4DR2E 2LJHA 3C4BA 4O43A 2RPCA 2Q8UA 3DF6A 1T4LB 1YYKA 4K0KE 2YU5A 2CT1A 2EWLA 2EN1A 2ENHA 5A6AA 1KYQA 2JOBA 4DV5E 3UK3C 4P78A 2M7QA 2I13A 5BR8E 4O4KA 1TN9A 4MLVA 4JYAE 2V87A 2RTXA 1IBLE 2EM8A 1X49A 1T4NA 1X3CA 2NUEA 3TQMA 2EQ3A 2ENAA 2DSYA 2MC5A 2YU8A 2F8BA 2EM6A 4GKJE 1T39A 1LLMC 4NXNE 4JI2E 2YTDA 1G2FC 4FK5C 2VE7C 5A6KA 2DLQA 2LUQA 3J7AG 5IT9C 4JI1E 1KJKA 5IWAE 3OTOE 2EPZA 4O24A 1IMUA 2YPNA 1X6EA 4X64E 1PKPA 2RS6A 2ODRD 3ADGA 1XNRE 2LCEA 2HJJA 4WYQB 1WHQA 4B3ME 2EORA 2EM5A 4M0VA 2EN8A 3T1YE 2ELYA 3RMPA 2VQFE 1X47A 2CTDA 4X65E 4ZYDA 1YUJA 3F6HA 1B69A 1IBME 5AC5A 2LT7A 1A1KA 3C6KA 4LF9E 2NA2A 2EM2A 2M4IA 2EPAA 2EPPA 1UILA 4Q28A 2LE2A 5T6JA 2NUFA 1X6FA 2VQEE 2EOJA 2EM7A 5F3WA 2EM3A 2EM4A 3P1XA 3L00A 3EPHA 4DV1E 2K7IA 4DMIA 3BGHA 5LMUE 4X9JA 3MHSC 2UXDE 4BMJA 4M9VC 3LMLA 1TF3A 1J26A 2HC5A 4TUGA 4LF5E 2L2NA 3ADIA 2E1MA 5IXMB 1XMOE 1WHNA 4JI0E 2JY9A 5KL7A 1STUA 2PRTA 4F6NA 2EOXA 2DLKA 1BBGA 4NZVA 5FLXC 1ZAAC 4JI7E 2ELZA 1AH5A 3ECRA 4DV6E 4BHCA 1MEYC 2JOXA 4DUZE 1YYOA 2VF1A 1QNTA 1PJTA 4RH8A 2KONA 3F6GA 3QG5C 2YTOA 4KHPE 2MDGA 2K4VA 3FIGA 4B3RE 4GKKE 1XMQE 2IHR1 2LMZA 2L3JA 3KZZA 4GZNC 1UBDC 2UU9E 4NXME 1N33E 1GTKA 2JPAA 2WBUA 1UHZA 2UUCE 3IWCA 3EPJA 2J7JA 2N3HA 2LTSA 2YTFA 5AC4A 1DQ3A 2H36X 4X8WA 2L33A 4R2EA 2JXPA 1N34E 3C6MA 1TF6A 2B7VA 5A69A 2MDRA 5LL6R 1WXRA 1N36E 5A6BD 1YFHA 4DR1E 4DV2E 4JI4E 3ZOQB 4LFCE 2EOFA 4F9CB 3KZYA 1GQEA 4LFBE 4LU9A 4B3SE 4ZYGA 2BBGA 4JV5E 5KL4A 4LF6E 2EPMX 3HQ1A 2LUPB 1IBKE 2YWQA 2EZ6A 3C4TA 3AUZA 2WCC3 2JR1A 2NUGA 4GEQB 3ADJA 2UXBE 1X48A 3ADLA 1T4OA 2EE8A 3HPSA 1IQOA 4DUYE 2L6MA 2ADRA 2VRDA 1T38A 2LO3A 1PDAA 1JK2A 2YRMA 4N4RB 3EPLA 4WXCA 2GLIA 4B3TE 4R03A 3EQ1A 4R2AA 1ZBQA 1QU6A 2I9IA 2EMBA
chains in the Genus database with same CATH topology
4DR5E 2FTXB 1GZ6A 2MC6A 4DKKA 4F9BB 4DV1E 2YT4A 1HR0E 4DMIA 4L8NA 1YZ9A 5LMUE 2UXDE 4BMJA 2V89A 4JI6E 4AQYE 3LMLA 1J26A 2FGGA 5CFFE 1J5EE 4DV3E 4WFTA 4TUGA 5AASA 4LF5E 4DR2E 2LJHA 2L2NA 3ADIA 2E1MA 4OOGC 3DJWA 2DMYA 4KZSA 3C4BA 1WHNA 1XMOE 4JI0E 2JY9A 1STUA 2M1SA 2B3TB 3DF6A 2G7HA 1T4LB 1YYKA 5A2QC 4K0KE 5FLXC 1HNZE 5AE3A 2LBSB 3HXLA 4JI7E 1O0WA 2LRSA 4LF8E 4DV6E 1DI2A 2EWLA 1ZBTA 3J81C 1FJGE 4DR3E 2JOXA 2V83A 4DUZE 1YYOA 2VF1A 2V85A 2KONA 3F6GA 2JWOA 2JOBA 1HNWE 4DV5E 4KHPE 2K4VA 3FIGA 4P78A 2M7QA 2L3CA 4B3RE 4GKKE 1XMQE 3HPZA 5BR8E 4P7DA 2IHR1 2LMZA 2L3JA 3KWRA 2DB2A 1N32E 4JYAE 2UU9E 4NXME 2V87A 2RTXA 1IBLE 2UUAE 4OX9E 1X49A 4WSPA 1N33E 1T4NA 4LF4E 4YHHE 2NUEA 5DNYA 1EKZA 1UHZA 4F9AB 2DSYA 2JVAA 2FV4B 2MC5A 2F8BA 3IWCA 2UUCE 1SR9A 2N3HA 4GKJE 2LTSA 3H09A 4NXNE 4DR7E 1DQ3A 2H36X 4X8WA 1HNXE 2KOUA 4WPYA 4TUIA 2L33A 4JI2E 2WZOA 1N34E 3LLHA 5ADZA 1RQ0A 3K6QA 4BC7A 4F54A 4X62E 3HTXA 2ODRC 2F4VE 2B7VA 2VE7C 2KHXA 3IWDA 2LUQA 2MDRA 5AE2A 2RSMA 4BC9A 1FKAE 5LL6R 4DV4E 3J7AG 2LTRA 5IT9C 4JI1E 4I8OA 2V86A 1WXRA 1N36E 4BBYA 4DR1E 4JI3E 4JI8E 5IWAE 4DV2E 3OTOE 4JI4E 3ZOQB 4J8ZA 4X64E 4LFCE 1PKPA 2RS6A 2ODRD 4M30A 3ADGA 4YY3E 4DV7E 2E5LE 4DR6E 4F9CB 1GQEA 1XNRE 2UXCE 4LFBE 3J7Yp 4DR4E 3JAMC 4LU9A 4B3SE 3IWBA 3VK6A 4WYQB 4X66E 4JV5E 1WHQA 4B3ME 2L2MA 3T1HE 4M0VA 4LF6E 3HQ1A 2UUBE 2LUPB 2RS7A 1IBKE 2EZ6A 3C4TA 3AUZA 3T1YE 2L8TA 2JR1A 2CPNA 3RMPA 2VQFE 1X47A 3MSWA 4X65E 2NUGA 3VYXA 4GEQB 4R8OA 3ADJA 3F6HA 2UXBE 1IBME 1X48A 2DIXA 3J80C 4JI5E 4L5NC 1T4OA 3AV0A 5AE1A 4LF7E 3ADLA 4LFAE 2L2KB 3OMLA 3HPSA 4DV0E 4M2ZA 4DUYE 2ZM6E 1I94E 2L6MA 4LTYA 4LF9E 2NA2A 2M4IA 2B9DA 5LMNE 2N3GA 1UILA 2V88A 2V8QB 3JTZA 2HHHE 2L92A 3JU0A 4Q28A 2LE2A 5T6JA 3VYYA 2NUFA 1YYWA 2YZTA 4BS9A 2VQEE 5F3WA 1RC7A 4B3TE 4R03A 1ZBQA 1XNQE 1QU6A 4BCAA 3P1XA 2B7TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR5 E;  4DKK A;  4DV1 E;  2YT4 A;  1HR0 E;  1YZ9 A;  5LMU E;  2UXD E;  4JI6 E;  4AQY E;  1J26 A;  5CFF E;  1J5E E;  4DV3 E;  4WFT A;  4LF5 E;  4DR2 E;  2LJH A;  2L2N A;  3ADI A;  4OOG C;  1XMO E;  2DMY A;  3C4B A;  1WHN A;  4JI0 E;  2JY9 A;  1STU A;  2B3T B;  1T4L B;  1YYK A;  4K0K E;  1HNZ E;  2LBS B;  4JI7 E;  1O0W A;  2LRS A;  4LF8 E;  4DV6 E;  1DI2 A;  1ZBT A;  1FJG E;  4DR3 E;  4DUZ E;  1YYO A;  1HNW E;  4DV5 E;  4KHP E;  2L3C A;  4B3R E;  4GKK E;  1XMQ E;  5BR8 E;  2IHR 1;  2L3J A;  2DB2 A;  1N32 E;  4JYA E;  2UU9 E;  4NXM E;  2UUA E;  2RTX A;  1IBL E;  4OX9 E;  1N33 E;  1X49 A;  1T4N A;  4LF4 E;  4YHH E;  2NUE A;  1EKZ A;  1UHZ A;  2UUC E;  2JVA A;  2N3H A;  4GKJ E;  2LTS A;  4NXN E;  4DR7 E;  4X8W A;  1HNX E;  2L33 A;  4JI2 E;  1N34 E;  3LLH A;  1RQ0 A;  3HTX A;  4X62 E;  2F4V E;  2B7V A;  2KHX A;  2LUQ A;  2MDR A;  2RSM A;  1FKA E;  4DV4 E;  2LTR A;  4JI1 E;  1N36 E;  4DR1 E;  4JI3 E;  4JI8 E;  5IWA E;  4DV2 E;  3OTO E;  4JI4 E;  4X64 E;  4LFC E;  1PKP A;  2RS6 A;  4M30 A;  4DV7 E;  3ADG A;  4YY3 E;  2E5L E;  4DR6 E;  1GQE A;  1XNR E;  2UXC E;  4LFB E;  3J7Y p;  4DR4 E;  4B3S E;  4X66 E;  4WYQ B;  4JV5 E;  1WHQ A;  4B3M E;  2L2M A;  3T1H E;  4LF6 E;  2UUB E;  2LUP B;  2RS7 A;  1IBK E;  2EZ6 A;  3C4T A;  3T1Y E;  2CPN A;  2VQF E;  1X47 A;  4X65 E;  2NUG A;  3VYX A;  3ADJ A;  2UXB E;  1IBM E;  1X48 A;  2DIX A;  4JI5 E;  3ADL A;  1T4O A;  4LF7 E;  4LFA E;  2L2K B;  4M2Z A;  4DV0 E;  4DUY E;  2ZM6 E;  1I94 E;  4LF9 E;  2NA2 A;  5LMN E;  2N3G A;  1UIL A;  2HHH E;  3VYY A;  2NUF A;  1YYW A;  2VQE E;  1RC7 A;  4B3T E;  1XNQ E;  1QU6 A;  3P1X A;  2B7T A; 
#chains in the Genus database with same CATH topology
 4DR5 E;  2FTX B;  1GZ6 A;  4DKK A;  4F9B B;  2BB8 A;  1JK1 A;  2EN4 A;  5TSE A;  2EN2 A;  4JI6 E;  2FGG A;  1J5E E;  4WFT A;  4OOG C;  2DMY A;  2M1S A;  4HEI A;  2G7H A;  2EM0 A;  2JP9 A;  2EOE A;  2EPN A;  3HXL A;  1O0W A;  2LRS A;  1AAY A;  4LF8 E;  2R1F A;  1DI2 A;  1ZBT A;  4DR3 E;  1RMD A;  2V83 A;  4F2J C;  1BB8 A;  3MHH C;  2EJ4 A;  1HNW E;  1PJQ A;  2L3C A;  2MKN A;  2EL6 A;  3HPZ A;  3THO B;  4P7D A;  2GHF A;  3BF2 A;  2EPO A;  2LVH A;  2DMI A;  2UUA E;  4WX9 A;  1EKZ A;  1YUI A;  2EMY A;  2FV4 B;  4R2Q A;  5KL3 A;  1EH8 A;  1NCS A;  2N8X A;  1A1J A;  4DR7 E;  1HNX E;  4O5G A;  4WPY A;  4TUI A;  2WZO A;  3LLH A;  2EOS A;  1RQ0 A;  3K6Q A;  4X62 E;  2EN6 A;  2EPU A;  5AE2 A;  2RSM A;  2LTR A;  1X5W A;  2EMC A;  4I8O A;  4BBY A;  2D9H A;  4WXD A;  4JI3 E;  4JI8 E;  2YTI A;  4J8Z A;  4DR6 E;  4YY3 E;  4R2C A;  2EMX A;  2UXC E;  2EMK A;  3J7Y p;  2EMZ A;  4WSG A;  1WRJ A;  4NHR A;  1F2I G;  2RS7 A;  2YTQ A;  1DGC A;  2L8T A;  2CPN A;  2M9A A;  2A25 A;  1SFE A;  3MSW A;  3VYX A;  2EMI A;  3J80 C;  1PJS A;  5IV8 B;  3AV0 A;  5AE1 A;  2YTG A;  2L2K B;  4HTG A;  4ZYH A;  2LJU A;  2ZM6 E;  4LTY A;  3BID A;  5KL5 A;  1EH6 A;  5LMN E;  3JTZ A;  2HHH E;  1BBO A;  3JU0 A;  3VYY A;  2YSO A;  2RQL A;  2YRH A;  1A1G A;  4BCA A;  2YRK A;  2YTN A;  5KL2 A;  2YT4 A;  4L8N A;  1YZ9 A;  5KL6 A;  1N3G A;  5CFF E;  2YSP A;  5AAS A;  2EL4 A;  3DJW A;  4KZS A;  1A1H A;  1IQS A;  2B3T B;  2EN3 A;  2YTE A;  5A2Q C;  1HNZ E;  5AE3 A;  2LBS B;  1L4S A;  3J81 C;  1FJG E;  4IS1 C;  1WJP A;  2V85 A;  4IJD A;  2CSH A;  1MGT A;  2JWO A;  1UN6 B;  2LV2 A;  2EP3 A;  5A6B A;  3KWR A;  2WBT A;  2YTP A;  2DB2 A;  1N32 E;  3THN A;  4R2D A;  4OX9 E;  4WSP A;  4LF4 E;  2EOM A;  4YHH E;  5DNY A;  4F9A B;  1ZR9 A;  2JVA A;  2EPX A;  1SR9 A;  2EOH A;  4Q35 B;  2E72 A;  3H09 A;  4F6M A;  1YSA C;  2KOU A;  2WBS A;  1Z1B A;  5ADZ A;  2YTJ A;  4F54 A;  4BC7 A;  3HTX A;  2F4V E;  2ODR C;  2EOI A;  2EPL X;  2KHX A;  3IWD A;  4BC9 A;  1FKA E;  4DV4 E;  1X6H A;  2V86 A;  3BBG A;  4MLQ A;  2DGC A;  2DRP A;  1A1L A;  4M30 A;  4DV7 E;  2E5L E;  1ZU1 A;  2RSI A;  3EPK A;  2EMG A;  4KWY A;  2EMF A;  4DR4 E;  1YPN A;  3JAM C;  2EOQ A;  3IWB A;  2GPI A;  3VK6 A;  4X66 E;  2NAB A;  2EMW A;  2L2M A;  3T1H E;  4BHB A;  2UUB E;  5A6J A;  2EMH A;  2MKD A;  4R8O A;  2EQ0 A;  2DIX A;  2EPR A;  4JI5 E;  4L5N C;  4LF7 E;  1A1I A;  2HGH A;  2EOY A;  4LFA E;  3OML A;  4R2P A;  4DV0 E;  4M2Z A;  2JYA A;  2EN7 A;  4ZYE A;  1I94 E;  2EQ1 A;  4R2S A;  2EMA A;  2EM9 A;  2B9D A;  2EPK X;  2N3G A;  2R76 A;  2EPC A;  2V88 A;  2V8Q B;  3M99 B;  2L92 A;  1YYW A;  2YZT A;  4BS9 A;  2EML A;  1RC7 A;  1XNQ E;  1P47 A;  1A1F A;  2ENC A;  2B7T A;  5LLQ A;  1G2D C;  2EOO A;  2MC6 A;  1NEI A;  1HR0 E;  2EOZ A;  2EL5 A;  4R2R A;  3VHT B;  2V89 A;  4AQY E;  4RHB B;  1EH7 A;  4DV3 E;  4DR2 E;  2LJH A;  3C4B A;  4O43 A;  2RPC A;  2Q8U A;  3DF6 A;  1T4L B;  1YYK A;  4K0K E;  2YU5 A;  2CT1 A;  2EWL A;  2EN1 A;  2ENH A;  5A6A A;  1KYQ A;  2JOB A;  4DV5 E;  3UK3 C;  4P78 A;  2M7Q A;  2I13 A;  5BR8 E;  4O4K A;  1TN9 A;  4MLV A;  4JYA E;  2V87 A;  2RTX A;  1IBL E;  2EM8 A;  1X49 A;  1T4N A;  1X3C A;  2NUE A;  3TQM A;  2EQ3 A;  2ENA A;  2DSY A;  2MC5 A;  2YU8 A;  2F8B A;  2EM6 A;  4GKJ E;  1T39 A;  1LLM C;  4NXN E;  4JI2 E;  2YTD A;  1G2F C;  4FK5 C;  2VE7 C;  5A6K A;  2DLQ A;  2LUQ A;  3J7A G;  5IT9 C;  4JI1 E;  1KJK A;  5IWA E;  3OTO E;  2EPZ A;  4O24 A;  1IMU A;  2YPN A;  1X6E A;  4X64 E;  1PKP A;  2RS6 A;  2ODR D;  3ADG A;  1XNR E;  2LCE A;  2HJJ A;  4WYQ B;  1WHQ A;  4B3M E;  2EOR A;  2EM5 A;  4M0V A;  2EN8 A;  3T1Y E;  2ELY A;  3RMP A;  2VQF E;  1X47 A;  2CTD A;  4X65 E;  4ZYD A;  1YUJ A;  3F6H A;  1B69 A;  1IBM E;  5AC5 A;  2LT7 A;  1A1K A;  3C6K A;  4LF9 E;  2NA2 A;  2EM2 A;  2M4I A;  2EPA A;  2EPP A;  1UIL A;  4Q28 A;  2LE2 A;  5T6J A;  2NUF A;  1X6F A;  2VQE E;  2EOJ A;  2EM7 A;  5F3W A;  2EM3 A;  2EM4 A;  3P1X A;  3L00 A;  3EPH A;  4DV1 E;  2K7I A;  4DMI A;  3BGH A;  5LMU E;  4X9J A;  3MHS C;  2UXD E;  4BMJ A;  4M9V C;  3LML A;  1TF3 A;  1J26 A;  2HC5 A;  4TUG A;  4LF5 E;  2L2N A;  3ADI A;  2E1M A;  5IXM B;  1XMO E;  1WHN A;  4JI0 E;  2JY9 A;  5KL7 A;  1STU A;  2PRT A;  4F6N A;  2EOX A;  2DLK A;  1BBG A;  4NZV A;  5FLX C;  1ZAA C;  4JI7 E;  2ELZ A;  1AH5 A;  3ECR A;  4DV6 E;  4BHC A;  1MEY C;  2JOX A;  4DUZ E;  1YYO A;  2VF1 A;  1QNT A;  1PJT A;  4RH8 A;  2KON A;  3F6G A;  3QG5 C;  2YTO A;  4KHP E;  2MDG A;  2K4V A;  3FIG A;  4B3R E;  4GKK E;  1XMQ E;  2IHR 1;  2LMZ A;  2L3J A;  3KZZ A;  4GZN C;  1UBD C;  2UU9 E;  4NXM E;  1N33 E;  1GTK A;  2JPA A;  2WBU A;  1UHZ A;  2UUC E;  3IWC A;  3EPJ A;  2J7J A;  2N3H A;  2LTS A;  2YTF A;  5AC4 A;  1DQ3 A;  2H36 X;  4X8W A;  2L33 A;  4R2E A;  2JXP A;  1N34 E;  3C6M A;  1TF6 A;  2B7V A;  5A69 A;  2MDR A;  5LL6 R;  1WXR A;  1N36 E;  5A6B D;  1YFH A;  4DR1 E;  4DV2 E;  4JI4 E;  3ZOQ B;  4LFC E;  2EOF A;  4F9C B;  3KZY A;  1GQE A;  4LFB E;  4LU9 A;  4B3S E;  4ZYG A;  2BBG A;  4JV5 E;  5KL4 A;  4LF6 E;  2EPM X;  3HQ1 A;  2LUP B;  1IBK E;  2YWQ A;  2EZ6 A;  3C4T A;  3AUZ A;  2WCC 3;  2JR1 A;  2NUG A;  4GEQ B;  3ADJ A;  2UXB E;  1X48 A;  3ADL A;  1T4O A;  2EE8 A;  3HPS A;  1IQO A;  4DUY E;  2L6M A;  2ADR A;  2VRD A;  1T38 A;  2LO3 A;  1PDA A;  1JK2 A;  2YRM A;  4N4R B;  3EPL A;  4WXC A;  2GLI A;  4B3T E;  4R03 A;  3EQ1 A;  4R2A A;  1ZBQ A;  1QU6 A;  2I9I A;  2EMB A; 
#chains in the Genus database with same CATH homology
 4DR5 E;  2FTX B;  1GZ6 A;  2MC6 A;  4DKK A;  4F9B B;  4DV1 E;  2YT4 A;  1HR0 E;  4DMI A;  4L8N A;  1YZ9 A;  5LMU E;  2UXD E;  4BMJ A;  2V89 A;  4JI6 E;  4AQY E;  3LML A;  1J26 A;  2FGG A;  5CFF E;  1J5E E;  4DV3 E;  4WFT A;  4TUG A;  5AAS A;  4LF5 E;  4DR2 E;  2LJH A;  2L2N A;  3ADI A;  2E1M A;  4OOG C;  3DJW A;  2DMY A;  4KZS A;  3C4B A;  1WHN A;  1XMO E;  4JI0 E;  2JY9 A;  1STU A;  2M1S A;  2B3T B;  3DF6 A;  2G7H A;  1T4L B;  1YYK A;  5A2Q C;  4K0K E;  5FLX C;  1HNZ E;  5AE3 A;  2LBS B;  3HXL A;  4JI7 E;  1O0W A;  2LRS A;  4LF8 E;  4DV6 E;  1DI2 A;  2EWL A;  1ZBT A;  3J81 C;  1FJG E;  4DR3 E;  2JOX A;  2V83 A;  4DUZ E;  1YYO A;  2VF1 A;  2V85 A;  2KON A;  3F6G A;  2JWO A;  2JOB A;  1HNW E;  4DV5 E;  4KHP E;  2K4V A;  3FIG A;  4P78 A;  2M7Q A;  2L3C A;  4B3R E;  4GKK E;  1XMQ E;  3HPZ A;  5BR8 E;  4P7D A;  2IHR 1;  2LMZ A;  2L3J A;  3KWR A;  2DB2 A;  1N32 E;  4JYA E;  2UU9 E;  4NXM E;  2V87 A;  2RTX A;  1IBL E;  2UUA E;  4OX9 E;  1X49 A;  4WSP A;  1N33 E;  1T4N A;  4LF4 E;  4YHH E;  2NUE A;  5DNY A;  1EKZ A;  1UHZ A;  4F9A B;  2DSY A;  2JVA A;  2FV4 B;  2MC5 A;  2F8B A;  3IWC A;  2UUC E;  1SR9 A;  2N3H A;  4GKJ E;  2LTS A;  3H09 A;  4NXN E;  4DR7 E;  1DQ3 A;  2H36 X;  4X8W A;  1HNX E;  2KOU A;  4WPY A;  4TUI A;  2L33 A;  4JI2 E;  2WZO A;  1N34 E;  3LLH A;  5ADZ A;  1RQ0 A;  3K6Q A;  4BC7 A;  4F54 A;  4X62 E;  3HTX A;  2ODR C;  2F4V E;  2B7V A;  2VE7 C;  2KHX A;  3IWD A;  2LUQ A;  2MDR A;  5AE2 A;  2RSM A;  4BC9 A;  1FKA E;  5LL6 R;  4DV4 E;  3J7A G;  2LTR A;  5IT9 C;  4JI1 E;  4I8O A;  2V86 A;  1WXR A;  1N36 E;  4BBY A;  4DR1 E;  4JI3 E;  4JI8 E;  5IWA E;  4DV2 E;  3OTO E;  4JI4 E;  3ZOQ B;  4J8Z A;  4X64 E;  4LFC E;  1PKP A;  2RS6 A;  2ODR D;  4M30 A;  3ADG A;  4YY3 E;  4DV7 E;  2E5L E;  4DR6 E;  4F9C B;  1GQE A;  1XNR E;  2UXC E;  4LFB E;  3J7Y p;  4DR4 E;  3JAM C;  4LU9 A;  4B3S E;  3IWB A;  3VK6 A;  4WYQ B;  4X66 E;  4JV5 E;  1WHQ A;  4B3M E;  2L2M A;  3T1H E;  4M0V A;  4LF6 E;  3HQ1 A;  2UUB E;  2LUP B;  2RS7 A;  1IBK E;  2EZ6 A;  3C4T A;  3AUZ A;  3T1Y E;  2L8T A;  2JR1 A;  2CPN A;  3RMP A;  2VQF E;  1X47 A;  3MSW A;  4X65 E;  2NUG A;  3VYX A;  4GEQ B;  4R8O A;  3ADJ A;  3F6H A;  2UXB E;  1IBM E;  1X48 A;  2DIX A;  3J80 C;  4JI5 E;  4L5N C;  1T4O A;  3AV0 A;  5AE1 A;  4LF7 E;  3ADL A;  4LFA E;  2L2K B;  3OML A;  3HPS A;  4DV0 E;  4M2Z A;  4DUY E;  2ZM6 E;  1I94 E;  2L6M A;  4LTY A;  4LF9 E;  2NA2 A;  2M4I A;  2B9D A;  5LMN E;  2N3G A;  1UIL A;  2V88 A;  2V8Q B;  3JTZ A;  2HHH E;  2L92 A;  3JU0 A;  4Q28 A;  2LE2 A;  5T6J A;  3VYY A;  2NUF A;  1YYW A;  2YZT A;  4BS9 A;  2VQE E;  5F3W A;  1RC7 A;  4B3T E;  4R03 A;  1ZBQ A;  1XNQ E;  1QU6 A;  4BCA A;  3P1X A;  2B7T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...