2EOHA

Solution structure of the c2h2 type zinc finger (region 780-812) of human zinc finger protein 28 homolog
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
GSSGSSGSGKKPYECKECRKTFIQIGHLNQHKRVHTGERSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 780-812) of human Zinc finger protein 28 homolog
rcsb
molecule keywords Zinc finger protein 28 homolog
molecule tags Transcription
source organism Homo sapiens
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eohA00
2DLQA 1F2IG 1BB8A 2EMAA 2EOEA 1BBOA 2ENHA 1ZR9A 1YSAC 1TN9A 1KJKA 2EMLA 2EOSA 2J7JA 2JP9A 2EMXA 2YTPA 2HGHA 2RPCA 2EM7A 2WBUA 1YUJA 4R2AA 2YRMA 2YTDA 2ELYA 2EMCA 4IJDA 4WSGA 4R2QA 2LVHA 2GLIA 2EM4A 1G2FC 1TF6A 1MEYC 2EMKA 2EP3A 2YU5A 4R2PA 2EM5A 2EOOA 2NABA 2EOXA 2EMFA 2I13A 2EPRA 2EN8A 2EN3A 2YU8A 2EMHA 4IS1C 2EN2A 1A1JA 2EPZA 2EE8A 2YTNA 2EMGA 2EMYA 2VRDA 2EMIA 2EJ4A 2EM8A 2EL5A 2EMZA 5KL2A 2MDGA 3EPHA 4FK5C 1B69A 1A1FA 5KL7A 2EQ0A 2YTOA 2YSOA 2CSHA 2EPAA 2LO3A 2EOJA 2EM6A 1YUIA 3EPJA 2EM0A 1ZU1A 2EPCA 1X3CA 4GZNC 4F2JC 2A25A 5KL5A 2MKDA 1A1GA 1DGCA 1ZAAC 4R2RA 3EPKA 2YTGA 2EM9A 2EORA 2EL4A 1X5WA 2BB8A 1RMDA 2EN4A 2WBTA 3UK3C 1WJPA 3M99B 1UBDC 2EQ1A 2YTFA 1G2DC 1A1HA 2EOYA 2EM2A 2EN1A 2DRPA 5KL3A 2EN6A 1X6FA 2CT1A 4R2SA 1A1KA 2DGCA 2LCEA 2E72A 4F6MA 1AAYA 2EOMA 1P47A 2LT7A 1LLMC 2EPPA 2DMIA 2MKNA 2EOZA 2LV2A 2DLKA 2R1FA 1JK1A 3MHHC 2JPAA 4R2EA 2WBSA 1Z1BA 2EN7A 3VHTB 2YRKA 2EOFA 2EMWA 2EPUA 1JK2A 2YSPA 2CTDA 5KL4A 2EPXA 3EPLA 4R2DA 2EM3A 2YTEA 2EQ3A 2PRTA 2YTIA 2ENAA 2GHFA 2YRHA 2D9HA 2EMBA 5KL6A 4M9VC 2EOIA 2ADRA 2M9AA 2YTJA 1X6EA 2WCC3 4R2CA 1A1IA 2ENCA 2EOHA 1UN6B 4X9JA 2EOQA 2RSIA 4F6NA 3MHSC 2YTQA 1A1LA 1TF3A 2ELZA 1X6HA 1NCSA 2EL6A
chains in the Genus database with same CATH superfamily
3HQ1A 5A6KA 2DLQA 2VE7C 1F2IG 2V88A 1X49A 1BB8A 2ODRD 2ENHA 1KJKA 2FV4B 3H09A 2E5LE 2L3CA 2EMXA 4Q35B 4KWYA 2HGHA 4LF4E 1XNRE 1EH7A 2YTDA 2ELYA 4WSGA 4F9CB 4JYAE 3EQ1A 1SFEA 5A6AA 4HEIA 1L4SA 1PDAA 1TF6A 2WZOA 4R2PA 2EM5A 4DUZE 2EOXA 2EMFA 4RHBB 2EN8A 4IS1C 4KZSA 2EPLX 4L5NC 4OOGC 4B3SE 3P1XA 4TUGA 4DV4E 3RMPA 5IT9C 1NEIA 4JI6E 4I8OA 2V8QB 3BIDA 5AC5A 5KL7A 1HNWE 2EQ0A 4DR3E 4ZYHA 4GEQB 1N3GA 1DQ3A 2CSHA 2G7HA 3C6MA 2LO3A 4LFBE 1YUIA 1AH5A 3IWDA 4BC7A 2N3HA 1N33E 5A6BD 5IV8B 4R2RA 1PJSA 3JTZA 1FJGE 2EORA 2EL4A 2EN4A 1N32E 2EQ1A 2YTFA 2B3TB 2V83A 2EM2A 4O4KA 2EN6A 1HNZE 2V87A 4R2SA 4DMIA 4F6MA 4F9BB 1N34E 1LLMC 2EPPA 4MLVA 3J7AG 2MKNA 2LV2A 2HHHE 2CPNA 2DLKA 2EZ6A 1IBLE 4R2EA 1ZBTA 3VHTB 3HPSA 1HR0E 2JWOA 2VQFE 4ZYDA 2JOBA 3EPLA 2YTEA 4F9AB 5LMUE 4M2ZA 2V86A 2GHFA 2EMBA 2EOIA 1PKPA 3BF2A 2ADRA 2YTJA 4DV0E 1N36E 2Q8UA 1YYWA 2F4VE 2ENCA 2EOHA 4LFCE 1UN6B 3ADGA 1TF3A 2YTQA 2EL6A 2M4IA 4P78A 2MC6A 4OX9E 2EMAA 2EOEA 1ZR9A 4DV5E 2N3GA 2L2KB 2MDRA 2JP9A 1YZ9A 4LF9E 2R76A 3LMLA 4O5GA 3THNA 4JI0E 4X66E 2WBUA 1XNQE 2YRMA 2GPIA 2L8TA 2EMCA 4R2QA 4IJDA 2JOXA 4LU9A 4WYQB 5AASA 2GLIA 4JI7E 2EP3A 2YU5A 3C4TA 2NABA 2K4VA 2VF1A 3T1YE 4DR6E 1XMQE 1STUA 5T6JA 2YU8A 2EPZA 2UXBE 3T1HE 4O43A 4WPYA 2RSMA 1X48A 3K6QA 2EMGA 5AE1A 2EMYA 4BS9A 2LMZA 2EM8A 2L2MA 5KL2A 1RQ0A 2MDGA 5LLQA 2B7VA 2L2NA 2YTOA 4X64E 4DR5E 4DV2E 4DR7E 1X3CA 2ODRC 4GZNC 2A25A 2MKDA 1DGCA 1ZAAC 2UUCE 1IQOA 1X47A 2LUPB 4X62E 2YZTA 3UK3C 3JU0A 4F54A 4J8ZA 3M99B 2BBGA 4DR2E 2EN1A 1GQEA 5KL3A 2CT1A 2YT4A 4BBYA 2EOMA 4B3TE 2LT7A 4LF8E 4HTGA 2KONA 2DMIA 3MHHC 1DI2A 2N8XA 3VYXA 2LUQA 1Z1BA 2NUGA 4M30A 2F8BA 5CFFE 2LBSB 4DKKA 2EMWA 2EPUA 2YSPA 5KL4A 1PJTA 4WXCA 4R2DA 1J26A 1SR9A 2EQ3A 3FIGA 4LF6E 2YTIA 2JR1A 4GKKE 1IMUA 2D9HA 2VQEE 3ECRA 2M9AA 5AE3A 3HTXA 4DV3E 4NXME 1PJQA 4ZYEA 4F6NA 1T38A 4JI3E 1X6HA 1NCSA 4JI1E 2JXPA 1YYOA 4DV1E 1YSAC 3J81C 2EMLA 4R03A 4BMJA 4ZYGA 2RPCA 4M0VA 2EPMX 2I9IA 2DB2A 4DV7E 4TUIA 2UUAE 4LF5E 3KWRA 1ZBQA 2UXCE 3HPZA 2LVHA 2EM4A 3ADIA 4WX9A 1MEYC 2EOOA 2HC5A 3VYYA 5A6BA 2NA2A 4JV5E 2EMHA 1IBKE 4LTYA 5A2QC 1I94E 2YTNA 4LF7E 5IWAE 3OTOE 1GZ6A 2EL5A 2V85A 2JY9A 5A69A 2IHR1 1XMOE 1B69A 5BR8E 3ADLA 1A1FA 4R8OA 2M1SA 1QU6A 3L00A 1T4NA 2JVAA 2YSOA 2DIXA 4NXNE 5F3WA 3F6HA 3J80C 1ZU1A 3KZYA 2EPCA 2V89A 4DR1E 4F2JC 2L33A 5KL5A 2UXDE 4WXDA 1QNTA 2UUBE 2WBTA 2BB8A 1UBDC 3OMLA 3ZOQB 4K0KE 3BBGA 1X6FA 2FGGA 1A1KA 2DGCA 2YPNA 4BC9A 1WXRA 1KYQA 1JK1A 2JYAA 1EH6A 2DSYA 2EN7A 2YRKA 4NHRA 1IQSA 2EPXA 5AE2A 3LLHA 4NZVA 4GKJE 4JI8E 3J7Yp 4JI4E 2YRHA 2YWQA 1GTKA 4M9VC 3IWBA 1WRJA 4DR4E 4JI2E 1X6EA 2WCC3 2EWLA 2L92A 1HNXE 1WHQA 5DNYA 4DUYE 4X9JA 2EOQA 2RSIA 2YTGA 5ADZA 3AV0A 3QG5C 4DV6E 1BBOA 2FTXB 1TN9A 2EOSA 4X8WA 2J7JA 3C4BA 3C6KA 1WHNA 2YTPA 2LJHA 2LRSA 2EM7A 4N4RB 1YUJA 2LTRA 5LL6R 4R2AA 1T39A 2LTSA 4YHHE 1EKZA 1O0WA 1G2FC 3ADJA 2E1MA 2EMKA 5A6JA 2RTXA 4WSPA 4BHBA 1YPNA 2B7TA 3BGHA 2EPRA 2I13A 2EN3A 1A1JA 2EN2A 1BBGA 3F6GA 2EE8A 4P7DA 4WFTA 4JI5E 2VRDA 2EMIA 2EJ4A 2NUFA 2EMZA 3HXLA 1YFHA 3EPHA 4FK5C 5IXMB 4B3ME 4MLQA 2L3JA 2EPAA 5TSEA 2EOJA 2EM6A 3EPJA 4B3RE 3AUZA 2EM0A 4L8NA 4YY3E 2RQLA 4KHPE 4LFAE 1T4LB 1A1GA 2NUEA 3VK6A 1UHZA 3EPKA 5LMNE 2LE2A 2EM9A 2EPNA 1X5WA 3TQMA 1RMDA 2LJUA 1WJPA 2KOUA 2RS7A 1G2DC 1RC7A 1A1HA 2EOYA 2RS6A 2L6MA 2DRPA 1YYKA 3JAMC 2LCEA 2E72A 4BCAA 1AAYA 1P47A 4O24A 2KHXA 2EPKX 2EOZA 4RH8A 1FKAE 1MGTA 2R1FA 4Q28A 3MSWA 5FLXC 2JPAA 2WBSA 1T4OA 2EOFA 4X65E 2DMYA 1JK2A 2B9DA 3KZZA 2CTDA 2EM3A 2H36X 3IWCA 1IBME 2K7IA 2M7QA 4BHCA 5AC4A 3DJWA 2PRTA 2ENAA 3DF6A 5KL6A 4AQYE 2HJJA 2UU9E 1UILA 4R2CA 1EH8A 1J5EE 1A1LA 3THOB 3MHSC 2EPOA 2MC5A 2ELZA 1A1IA 2ZM6E
chains in the Genus database with same CATH topology
2DLQA 1F2IG 1BB8A 2EMAA 2EOEA 1BBOA 2ENHA 1ZR9A 1YSAC 1TN9A 1KJKA 2EMLA 2EOSA 2J7JA 2JP9A 2EMXA 2YTPA 2HGHA 2RPCA 2EM7A 2WBUA 1YUJA 4R2AA 2YRMA 2YTDA 2ELYA 2EMCA 4IJDA 4WSGA 4R2QA 2LVHA 2GLIA 2EM4A 1G2FC 1TF6A 1MEYC 2EMKA 2EP3A 2YU5A 4R2PA 2EM5A 2EOOA 2NABA 2EOXA 2EMFA 2I13A 2EPRA 2EN8A 2EN3A 2YU8A 2EMHA 4IS1C 2EN2A 1A1JA 2EPZA 2EE8A 2YTNA 2EMGA 2EMYA 2VRDA 2EMIA 2EJ4A 2EM8A 2EL5A 2EMZA 5KL2A 2MDGA 3EPHA 4FK5C 1B69A 1A1FA 5KL7A 2EQ0A 2YTOA 2YSOA 2CSHA 2EPAA 2LO3A 2EOJA 2EM6A 1YUIA 3EPJA 2EM0A 1ZU1A 2EPCA 1X3CA 4GZNC 4F2JC 2A25A 5KL5A 2MKDA 1A1GA 1DGCA 1ZAAC 4R2RA 3EPKA 2YTGA 2EM9A 2EORA 2EL4A 1X5WA 2BB8A 1RMDA 2EN4A 2WBTA 3UK3C 1WJPA 3M99B 1UBDC 2EQ1A 2YTFA 1G2DC 1A1HA 2EOYA 2EM2A 2EN1A 2DRPA 5KL3A 2EN6A 1X6FA 2CT1A 4R2SA 1A1KA 2DGCA 2LCEA 2E72A 4F6MA 1AAYA 2EOMA 1P47A 2LT7A 1LLMC 2EPPA 2DMIA 2MKNA 2EOZA 2LV2A 2DLKA 2R1FA 1JK1A 3MHHC 2JPAA 4R2EA 2WBSA 1Z1BA 2EN7A 3VHTB 2YRKA 2EOFA 2EMWA 2EPUA 1JK2A 2YSPA 2CTDA 5KL4A 2EPXA 3EPLA 4R2DA 2EM3A 2YTEA 2EQ3A 2PRTA 2YTIA 2ENAA 2GHFA 2YRHA 2D9HA 2EMBA 5KL6A 4M9VC 2EOIA 2ADRA 2M9AA 2YTJA 1X6EA 2WCC3 4R2CA 1A1IA 2ENCA 2EOHA 1UN6B 4X9JA 2EOQA 2RSIA 4F6NA 3MHSC 2YTQA 1A1LA 1TF3A 2ELZA 1X6HA 1NCSA 2EL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DLQ A;  1F2I G;  1BB8 A;  2EMA A;  2EOE A;  1BBO A;  2ENH A;  1ZR9 A;  1YSA C;  1TN9 A;  1KJK A;  2EML A;  2EOS A;  2J7J A;  2JP9 A;  2EMX A;  2YTP A;  2HGH A;  2RPC A;  2EM7 A;  2WBU A;  1YUJ A;  4R2A A;  2YRM A;  2YTD A;  2ELY A;  2EMC A;  4IJD A;  4WSG A;  4R2Q A;  2LVH A;  2GLI A;  2EM4 A;  1G2F C;  1TF6 A;  1MEY C;  2EMK A;  2EP3 A;  2YU5 A;  4R2P A;  2EM5 A;  2EOO A;  2NAB A;  2EOX A;  2EMF A;  2I13 A;  2EPR A;  2EN8 A;  2EN3 A;  2YU8 A;  2EMH A;  4IS1 C;  2EN2 A;  1A1J A;  2EPZ A;  2EE8 A;  2YTN A;  2EMG A;  2EMY A;  2VRD A;  2EMI A;  2EJ4 A;  2EM8 A;  2EL5 A;  2EMZ A;  5KL2 A;  2MDG A;  3EPH A;  4FK5 C;  1B69 A;  1A1F A;  5KL7 A;  2EQ0 A;  2YTO A;  2YSO A;  2CSH A;  2EPA A;  2LO3 A;  2EOJ A;  2EM6 A;  1YUI A;  3EPJ A;  2EM0 A;  1ZU1 A;  2EPC A;  1X3C A;  4GZN C;  4F2J C;  2A25 A;  5KL5 A;  2MKD A;  1A1G A;  1DGC A;  1ZAA C;  4R2R A;  3EPK A;  2YTG A;  2EM9 A;  2EOR A;  2EL4 A;  1X5W A;  2BB8 A;  1RMD A;  2EN4 A;  2WBT A;  3UK3 C;  1WJP A;  3M99 B;  1UBD C;  2EQ1 A;  2YTF A;  1G2D C;  1A1H A;  2EOY A;  2EM2 A;  2EN1 A;  2DRP A;  5KL3 A;  2EN6 A;  1X6F A;  2CT1 A;  4R2S A;  1A1K A;  2DGC A;  2LCE A;  2E72 A;  4F6M A;  1AAY A;  2EOM A;  1P47 A;  2LT7 A;  1LLM C;  2EPP A;  2DMI A;  2MKN A;  2EOZ A;  2LV2 A;  2DLK A;  2R1F A;  1JK1 A;  3MHH C;  2JPA A;  4R2E A;  2WBS A;  1Z1B A;  2EN7 A;  3VHT B;  2YRK A;  2EOF A;  2EMW A;  2EPU A;  1JK2 A;  2YSP A;  2CTD A;  5KL4 A;  2EPX A;  3EPL A;  4R2D A;  2EM3 A;  2YTE A;  2EQ3 A;  2PRT A;  2YTI A;  2ENA A;  2GHF A;  2YRH A;  2D9H A;  2EMB A;  5KL6 A;  4M9V C;  2EOI A;  2ADR A;  2M9A A;  2YTJ A;  1X6E A;  2WCC 3;  4R2C A;  1A1I A;  2ENC A;  2EOH A;  1UN6 B;  4X9J A;  2EOQ A;  2RSI A;  4F6N A;  3MHS C;  2YTQ A;  1A1L A;  1TF3 A;  2ELZ A;  1X6H A;  1NCS A;  2EL6 A; 
#chains in the Genus database with same CATH topology
 3HQ1 A;  5A6K A;  2DLQ A;  2VE7 C;  1F2I G;  2V88 A;  1X49 A;  1BB8 A;  2ODR D;  2ENH A;  1KJK A;  2FV4 B;  3H09 A;  2E5L E;  2L3C A;  2EMX A;  4Q35 B;  4KWY A;  2HGH A;  4LF4 E;  1XNR E;  1EH7 A;  2YTD A;  2ELY A;  4WSG A;  4F9C B;  4JYA E;  3EQ1 A;  1SFE A;  5A6A A;  4HEI A;  1L4S A;  1PDA A;  1TF6 A;  2WZO A;  4R2P A;  2EM5 A;  4DUZ E;  2EOX A;  2EMF A;  4RHB B;  2EN8 A;  4IS1 C;  4KZS A;  2EPL X;  4L5N C;  4OOG C;  4B3S E;  3P1X A;  4TUG A;  4DV4 E;  3RMP A;  5IT9 C;  1NEI A;  4JI6 E;  4I8O A;  2V8Q B;  3BID A;  5AC5 A;  5KL7 A;  1HNW E;  2EQ0 A;  4DR3 E;  4ZYH A;  4GEQ B;  1N3G A;  1DQ3 A;  2CSH A;  2G7H A;  3C6M A;  2LO3 A;  4LFB E;  1YUI A;  1AH5 A;  3IWD A;  4BC7 A;  2N3H A;  1N33 E;  5A6B D;  5IV8 B;  4R2R A;  1PJS A;  3JTZ A;  1FJG E;  2EOR A;  2EL4 A;  2EN4 A;  1N32 E;  2EQ1 A;  2YTF A;  2B3T B;  2V83 A;  2EM2 A;  4O4K A;  2EN6 A;  1HNZ E;  2V87 A;  4R2S A;  4DMI A;  4F6M A;  4F9B B;  1N34 E;  1LLM C;  2EPP A;  4MLV A;  3J7A G;  2MKN A;  2LV2 A;  2HHH E;  2CPN A;  2DLK A;  2EZ6 A;  1IBL E;  4R2E A;  1ZBT A;  3VHT B;  3HPS A;  1HR0 E;  2JWO A;  2VQF E;  4ZYD A;  2JOB A;  3EPL A;  2YTE A;  4F9A B;  5LMU E;  4M2Z A;  2V86 A;  2GHF A;  2EMB A;  2EOI A;  1PKP A;  3BF2 A;  2ADR A;  2YTJ A;  4DV0 E;  1N36 E;  2Q8U A;  1YYW A;  2F4V E;  2ENC A;  2EOH A;  4LFC E;  1UN6 B;  3ADG A;  1TF3 A;  2YTQ A;  2EL6 A;  2M4I A;  4P78 A;  2MC6 A;  4OX9 E;  2EMA A;  2EOE A;  1ZR9 A;  4DV5 E;  2N3G A;  2L2K B;  2MDR A;  2JP9 A;  1YZ9 A;  4LF9 E;  2R76 A;  3LML A;  4O5G A;  3THN A;  4JI0 E;  4X66 E;  2WBU A;  1XNQ E;  2YRM A;  2GPI A;  2L8T A;  2EMC A;  4R2Q A;  4IJD A;  2JOX A;  4LU9 A;  4WYQ B;  5AAS A;  2GLI A;  4JI7 E;  2EP3 A;  2YU5 A;  3C4T A;  2NAB A;  2K4V A;  2VF1 A;  3T1Y E;  4DR6 E;  1XMQ E;  1STU A;  5T6J A;  2YU8 A;  2EPZ A;  2UXB E;  3T1H E;  4O43 A;  4WPY A;  2RSM A;  1X48 A;  3K6Q A;  2EMG A;  5AE1 A;  2EMY A;  4BS9 A;  2LMZ A;  2EM8 A;  2L2M A;  5KL2 A;  1RQ0 A;  2MDG A;  5LLQ A;  2B7V A;  2L2N A;  2YTO A;  4X64 E;  4DR5 E;  4DV2 E;  4DR7 E;  1X3C A;  2ODR C;  4GZN C;  2A25 A;  2MKD A;  1DGC A;  1ZAA C;  2UUC E;  1IQO A;  1X47 A;  2LUP B;  4X62 E;  2YZT A;  3UK3 C;  3JU0 A;  4F54 A;  4J8Z A;  3M99 B;  2BBG A;  4DR2 E;  2EN1 A;  1GQE A;  5KL3 A;  2CT1 A;  2YT4 A;  4BBY A;  2EOM A;  4B3T E;  2LT7 A;  4LF8 E;  4HTG A;  2KON A;  2DMI A;  3MHH C;  1DI2 A;  2N8X A;  3VYX A;  2LUQ A;  1Z1B A;  2NUG A;  4M30 A;  2F8B A;  5CFF E;  2LBS B;  4DKK A;  2EMW A;  2EPU A;  2YSP A;  5KL4 A;  1PJT A;  4WXC A;  4R2D A;  1J26 A;  1SR9 A;  2EQ3 A;  3FIG A;  4LF6 E;  2YTI A;  2JR1 A;  4GKK E;  1IMU A;  2D9H A;  2VQE E;  3ECR A;  2M9A A;  5AE3 A;  3HTX A;  4DV3 E;  4NXM E;  1PJQ A;  4ZYE A;  4F6N A;  1T38 A;  4JI3 E;  1X6H A;  1NCS A;  4JI1 E;  2JXP A;  1YYO A;  4DV1 E;  1YSA C;  3J81 C;  2EML A;  4R03 A;  4BMJ A;  4ZYG A;  2RPC A;  4M0V A;  2EPM X;  2I9I A;  2DB2 A;  4DV7 E;  4TUI A;  2UUA E;  4LF5 E;  3KWR A;  1ZBQ A;  2UXC E;  3HPZ A;  2LVH A;  2EM4 A;  3ADI A;  4WX9 A;  1MEY C;  2EOO A;  2HC5 A;  3VYY A;  5A6B A;  2NA2 A;  4JV5 E;  2EMH A;  1IBK E;  4LTY A;  5A2Q C;  1I94 E;  2YTN A;  4LF7 E;  5IWA E;  3OTO E;  1GZ6 A;  2EL5 A;  2V85 A;  2JY9 A;  5A69 A;  2IHR 1;  1XMO E;  1B69 A;  5BR8 E;  3ADL A;  1A1F A;  4R8O A;  2M1S A;  1QU6 A;  3L00 A;  1T4N A;  2JVA A;  2YSO A;  2DIX A;  4NXN E;  5F3W A;  3F6H A;  3J80 C;  1ZU1 A;  3KZY A;  2EPC A;  2V89 A;  4DR1 E;  4F2J C;  2L33 A;  5KL5 A;  2UXD E;  4WXD A;  1QNT A;  2UUB E;  2WBT A;  2BB8 A;  1UBD C;  3OML A;  3ZOQ B;  4K0K E;  3BBG A;  1X6F A;  2FGG A;  1A1K A;  2DGC A;  2YPN A;  4BC9 A;  1WXR A;  1KYQ A;  1JK1 A;  2JYA A;  1EH6 A;  2DSY A;  2EN7 A;  2YRK A;  4NHR A;  1IQS A;  2EPX A;  5AE2 A;  3LLH A;  4NZV A;  4GKJ E;  4JI8 E;  3J7Y p;  4JI4 E;  2YRH A;  2YWQ A;  1GTK A;  4M9V C;  3IWB A;  1WRJ A;  4DR4 E;  4JI2 E;  1X6E A;  2WCC 3;  2EWL A;  2L92 A;  1HNX E;  1WHQ A;  5DNY A;  4DUY E;  4X9J A;  2EOQ A;  2RSI A;  2YTG A;  5ADZ A;  3AV0 A;  3QG5 C;  4DV6 E;  1BBO A;  2FTX B;  1TN9 A;  2EOS A;  4X8W A;  2J7J A;  3C4B A;  3C6K A;  1WHN A;  2YTP A;  2LJH A;  2LRS A;  2EM7 A;  4N4R B;  1YUJ A;  2LTR A;  5LL6 R;  4R2A A;  1T39 A;  2LTS A;  4YHH E;  1EKZ A;  1O0W A;  1G2F C;  3ADJ A;  2E1M A;  2EMK A;  5A6J A;  2RTX A;  4WSP A;  4BHB A;  1YPN A;  2B7T A;  3BGH A;  2EPR A;  2I13 A;  2EN3 A;  1A1J A;  2EN2 A;  1BBG A;  3F6G A;  2EE8 A;  4P7D A;  4WFT A;  4JI5 E;  2VRD A;  2EMI A;  2EJ4 A;  2NUF A;  2EMZ A;  3HXL A;  1YFH A;  3EPH A;  4FK5 C;  5IXM B;  4B3M E;  4MLQ A;  2L3J A;  2EPA A;  5TSE A;  2EOJ A;  2EM6 A;  3EPJ A;  4B3R E;  3AUZ A;  2EM0 A;  4L8N A;  4YY3 E;  2RQL A;  4KHP E;  4LFA E;  1T4L B;  1A1G A;  2NUE A;  3VK6 A;  1UHZ A;  3EPK A;  5LMN E;  2LE2 A;  2EM9 A;  2EPN A;  1X5W A;  3TQM A;  1RMD A;  2LJU A;  1WJP A;  2KOU A;  2RS7 A;  1G2D C;  1RC7 A;  1A1H A;  2EOY A;  2RS6 A;  2L6M A;  2DRP A;  1YYK A;  3JAM C;  2LCE A;  2E72 A;  4BCA A;  1AAY A;  1P47 A;  4O24 A;  2KHX A;  2EPK X;  2EOZ A;  4RH8 A;  1FKA E;  1MGT A;  2R1F A;  4Q28 A;  3MSW A;  5FLX C;  2JPA A;  2WBS A;  1T4O A;  2EOF A;  4X65 E;  2DMY A;  1JK2 A;  2B9D A;  3KZZ A;  2CTD A;  2EM3 A;  2H36 X;  3IWC A;  1IBM E;  2K7I A;  2M7Q A;  4BHC A;  5AC4 A;  3DJW A;  2PRT A;  2ENA A;  3DF6 A;  5KL6 A;  4AQY E;  2HJJ A;  2UU9 E;  1UIL A;  4R2C A;  1EH8 A;  1J5E E;  1A1L A;  3THO B;  3MHS C;  2EPO A;  2MC5 A;  2ELZ A;  1A1I A;  2ZM6 E; 
#chains in the Genus database with same CATH homology
 2DLQ A;  1F2I G;  1BB8 A;  2EMA A;  2EOE A;  1BBO A;  2ENH A;  1ZR9 A;  1YSA C;  1TN9 A;  1KJK A;  2EML A;  2EOS A;  2J7J A;  2JP9 A;  2EMX A;  2YTP A;  2HGH A;  2RPC A;  2EM7 A;  2WBU A;  1YUJ A;  4R2A A;  2YRM A;  2YTD A;  2ELY A;  2EMC A;  4IJD A;  4WSG A;  4R2Q A;  2LVH A;  2GLI A;  2EM4 A;  1G2F C;  1TF6 A;  1MEY C;  2EMK A;  2EP3 A;  2YU5 A;  4R2P A;  2EM5 A;  2EOO A;  2NAB A;  2EOX A;  2EMF A;  2I13 A;  2EPR A;  2EN8 A;  2EN3 A;  2YU8 A;  2EMH A;  4IS1 C;  2EN2 A;  1A1J A;  2EPZ A;  2EE8 A;  2YTN A;  2EMG A;  2EMY A;  2VRD A;  2EMI A;  2EJ4 A;  2EM8 A;  2EL5 A;  2EMZ A;  5KL2 A;  2MDG A;  3EPH A;  4FK5 C;  1B69 A;  1A1F A;  5KL7 A;  2EQ0 A;  2YTO A;  2YSO A;  2CSH A;  2EPA A;  2LO3 A;  2EOJ A;  2EM6 A;  1YUI A;  3EPJ A;  2EM0 A;  1ZU1 A;  2EPC A;  1X3C A;  4GZN C;  4F2J C;  2A25 A;  5KL5 A;  2MKD A;  1A1G A;  1DGC A;  1ZAA C;  4R2R A;  3EPK A;  2YTG A;  2EM9 A;  2EOR A;  2EL4 A;  1X5W A;  2BB8 A;  1RMD A;  2EN4 A;  2WBT A;  3UK3 C;  1WJP A;  3M99 B;  1UBD C;  2EQ1 A;  2YTF A;  1G2D C;  1A1H A;  2EOY A;  2EM2 A;  2EN1 A;  2DRP A;  5KL3 A;  2EN6 A;  1X6F A;  2CT1 A;  4R2S A;  1A1K A;  2DGC A;  2LCE A;  2E72 A;  4F6M A;  1AAY A;  2EOM A;  1P47 A;  2LT7 A;  1LLM C;  2EPP A;  2DMI A;  2MKN A;  2EOZ A;  2LV2 A;  2DLK A;  2R1F A;  1JK1 A;  3MHH C;  2JPA A;  4R2E A;  2WBS A;  1Z1B A;  2EN7 A;  3VHT B;  2YRK A;  2EOF A;  2EMW A;  2EPU A;  1JK2 A;  2YSP A;  2CTD A;  5KL4 A;  2EPX A;  3EPL A;  4R2D A;  2EM3 A;  2YTE A;  2EQ3 A;  2PRT A;  2YTI A;  2ENA A;  2GHF A;  2YRH A;  2D9H A;  2EMB A;  5KL6 A;  4M9V C;  2EOI A;  2ADR A;  2M9A A;  2YTJ A;  1X6E A;  2WCC 3;  4R2C A;  1A1I A;  2ENC A;  2EOH A;  1UN6 B;  4X9J A;  2EOQ A;  2RSI A;  4F6N A;  3MHS C;  2YTQ A;  1A1L A;  1TF3 A;  2ELZ A;  1X6H A;  1NCS A;  2EL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...