2EOHA

Solution structure of the c2h2 type zinc finger (region 780-812) of human zinc finger protein 28 homolog
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
GSSGSSGSGKKPYECKECRKTFIQIGHLNQHKRVHTGERSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 780-812) of human Zinc finger protein 28 homolog
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 28 homolog
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eohA00
4WSGA 2VRDA 2EOQA 1A1IA 1MEYC 2DRPA 5KL3A 1Z1BA 2EPXA 1RMDA 2EMKA 2EMFA 5KL5A 2EN1A 2EL6A 3VHTB 2WCC3 4F6MA 1YSAC 2DMIA 2EN8A 2EQ0A 2RPCA 2EN3A 1TF3A 2EP3A 2EL4A 2YRHA 2EOJA 2YTGA 2JP9A 2BB8A 1UN6B 1LLMC 2LT7A 5KL7A 4M9VC 5KL4A 2EOEA 4R2AA 2EM3A 2E72A 2EN6A 1A1LA 2EOHA 2EPPA 2MDGA 2YSOA 2EMZA 2EM9A 2EJ4A 2EN2A 2EMLA 2EMIA 1X5WA 1ZAAC 2EM5A 2LCEA 1A1FA 2R1FA 2EM0A 2EM7A 2YTPA 1JK2A 2YRKA 2EOFA 4F6NA 4R2PA 2PRTA 2EE8A 2ADRA 2JPAA 2NABA 1X6FA 2MKDA 2RSIA 2YTOA 3MHSC 4R2DA 3EPJA 2EORA 2EMBA 2CTDA 2YTFA 3MHHC 1G2FC 2EM2A 2EOXA 4FK5C 3UK3C 1TF6A 2YU8A 1JK1A 1A1HA 1G2DC 2YSPA 1AAYA 2EMYA 2EQ1A 4IJDA 2CT1A 2EPCA 1TN9A 2WBUA 2A25A 2YTQA 3EPKA 1F2IG 2EQ3A 2EOSA 2YTEA 2GLIA 2YTJA 2LO3A 1P47A 1A1KA 1ZU1A 1UBDC 1A1JA 2DLKA 2EMCA 2LV2A 1B69A 1KJKA 3M99B 2ELZA 4R2SA 1NCSA 2YTIA 4R2EA 2EPZA 2EPAA 2EM8A 4X9JA 2EN7A 2EMWA 4R2RA 1DGCA 2EM4A 2EMXA 2YTNA 2MKNA 4F2JC 3EPLA 1ZR9A 3EPHA 2EOZA 2DGCA 2EOIA 1X3CA 2M9AA 2EM6A 1A1GA 2D9HA 1YUJA 2LVHA 2YTDA 4IS1C 2WBSA 2GHFA 2ELYA 1BBOA 2EPRA 5KL2A 2EOYA 4GZNC 2HGHA 2YU5A 2WBTA 2EN4A 2EMGA 2ENCA 2EPUA 1WJPA 1X6EA 2CSHA 2EMHA 2I13A 2DLQA 2EL5A 5KL6A 1YUIA 2EMAA 2YRMA 1X6HA 4R2CA 2ENAA 2EOMA 2J7JA 2EOOA 4R2QA 1BB8A 2ENHA
chains in the Genus database with same CATH superfamily
4DV0E 2VRDA 2LRSA 3BBGA 4WYQB 1SFEA 3F6HA 3VHTB 1YSAC 2RPCA 2R76A 2RTXA 4TUGA 1PJSA 4I8OA 2ODRC 1LLMC 3ADLA 2YZTA 4GKJE 3EQ1A 3ADGA 4WXDA 5KL7A 3HQ1A 2RSMA 3HXLA 1YYOA 5KL4A 2EOEA 4R2AA 1FKAE 3IWBA 3ZOQB 4DR2E 2EN6A 2LJUA 4ZYHA 4KHPE 2L3JA 2YSOA 5T6JA 2KHXA 2RQLA 2EMIA 4X64E 2UXBE 1ZAAC 4LF6E 4DV5E 2YTPA 2NUGA 2YRKA 5FLXC 4LFCE 2PRTA 2EE8A 2JOBA 2DSYA 2I9IA 1DI2A 4YHHE 2M7QA 1DQ3A 2YTFA 4NHRA 1IBKE 2EM2A 3UK3C 1STUA 1JK1A 1A1HA 1GTKA 1XNRE 1G2DC 2YSPA 4X8WA 1AAYA 2EQ1A 2CT1A 1TN9A 2WBUA 1N33E 2YTQA 1F2IG 5LL6R 2VQFE 3VYYA 4DV1E 4K0KE 5F3WA 2B7VA 2GLIA 2NUEA 2LO3A 3ADJA 1A1KA 2DLKA 4BC9A 1B69A 1KJKA 5A6BD 1UILA 2EPOA 4L8NA 3T1YE 4HTGA 2LTRA 1J5EE 2GPIA 2MKNA 4F2JC 1ZR9A 2EOZA 3HPZA 2WBSA 4O24A 1N36E 1BBOA 2EPRA 1IBME 4GKKE 5KL2A 2E5LE 2N3HA 2M4IA 3MSWA 2HGHA 2EN4A 2EMGA 4X62E 4BC7A 1EH6A 2EMHA 1WXRA 1KYQA 5KL6A 1XNQE 2YRMA 3DF6A 1ZBQA 1GZ6A 2NA2A 3VYXA 2HHHE 1YYKA 2ENHA 3TQMA 2EOQA 3AUZA 1Z1BA 2L2NA 1UHZA 2VF1A 5KL5A 2EN1A 2V85A 2EP3A 2N3GA 2EL4A 2YTGA 4JI1E 2E1MA 2RS6A 2JP9A 2L33A 5A6BA 4WX9A 1T4OA 5ADZA 4Q28A 2F8BA 5AE1A 4JI2E 2UUCE 4LF9E 2JWOA 1J26A 2EOHA 2MDGA 3C4TA 2BBGA 2EMZA 1WHNA 4JI3E 2G7HA 4F9BB 1HNXE 2EMLA 1A1FA 1YFHA 2EM0A 4LFBE 1SR9A 3BGHA 2ADRA 4LTYA 4B3TE 1EKZA 1T38A 1L4SA 3EPJA 2EORA 1X47A 4HEIA 2CTDA 4WFTA 2EOXA 4X65E 2YU8A 4DKKA 2K4VA 4JI7E 2UUAE 4BCAA 4IJDA 3JAMC 1RC7A 1EH7A 4J8ZA 4DR3E 5TSEA 4OX9E 2YTJA 1ZU1A 1UBDC 2ODRD 2LV2A 4DUZE 1QNTA 1PDAA 2NUFA 4BBYA 4R03A 4LFAE 2FV4B 3IWDA 5AC4A 1IMUA 4R2EA 2EPZA 4JV5E 1YPNA 4P78A 2DB2A 4F9CB 1FJGE 1X3CA 4L5NC 3C4BA 1A1GA 2LVHA 2MDRA 2H36X 3C6KA 5A69A 2GHFA 1WHQA 2VQEE 4DV6E 4JI0E 2KONA 4ZYDA 2EOYA 2LMZA 4GZNC 2LUPB 2UXDE 1N3GA 4JYAE 2DLQA 2EMAA 2FGGA 4R2CA 3ADIA 4NZVA 2ENAA 1BBGA 4ZYEA 1RQ0A 4R2QA 1BB8A 2V8QB 2DRPA 3J81C 4LF4E 2EMKA 1IBLE 5A6AA 3LMLA 2L3CA 3JTZA 1TF3A 3AV0A 2YRHA 2YPNA 3C6MA 2LE2A 4BMJA 3HTXA 2V87A 4O4KA 3H09A 4M9VC 4DR6E 4M2ZA 5A6KA 2EM3A 2E72A 2L2MA 4M0VA 3OMLA 5LLQA 2EPPA 4RH8A 3KWRA 4DV2E 5IV8B 3J7Yp 2UUBE 4JI5E 2EJ4A 2EN2A 1X5WA 3HPSA 1WRJA 2L6MA 1PKPA 5AASA 2R1FA 3ECRA 1MGTA 3RMPA 3KZYA 2EM7A 2EPLX 2L92A 1ZBTA 4R2PA 1GQEA 2DIXA 2JPAA 1X6FA 2MKDA 2RSIA 2MC5A 3LLHA 3MHSC 2EPNA 3MHHC 1G2FC 4FK5C 4GEQB 2MC6A 3OTOE 3THNA 2RS7A 2EMYA 4F9AB 2EPCA 2F4VE 4NXME 2YT4A 2EQ3A 2EOSA 5AE2A 4F54A 2LJHA 1P47A 3P1XA 2L8TA 4R8OA 4RHBB 2ZM6E 2EMCA 2LUQA 3M99B 4R2SA 3IWCA 3BF2A 4AQYE 1NCSA 5IXMB 2UXCE 2EM8A 2EN7A 2B7TA 4R2RA 1N32E 2EM4A 2WZOA 2YTNA 4JI6E 2DGCA 2V83A 2EOIA 4DR4E 1YYWA 1XMOE 2EM6A 1YUJA 2D9HA 2YTDA 2EZ6A 1T4LB 4LU9A 4LF8E 4BS9A 3F6GA 1YZ9A 2Q8UA 1N34E 2YU5A 1AH5A 2WBTA 5AE3A 3VK6A 4KZSA 2EPUA 2JR1A 1X6EA 2CSHA 2I13A 2EL5A 4B3SE 1YUIA 2B9DA 2N8XA 3FIGA 1HNWE 4NXNE 4DV7E 2EOOA 2EM5A 5LMNE 4WSGA 1A1IA 1MEYC 4N4RB 5KL3A 1HNZE 2M1SA 2EPXA 5IWAE 1RMDA 1I94E 4ZYGA 2EMFA 2EL6A 1X49A 2WCC3 4F6MA 2DMIA 2EN8A 2EQ0A 2EN3A 2EOJA 3DJWA 2BB8A 1UN6B 3BIDA 4O5GA 2LT7A 1EH8A 3KZZA 1O0WA 2V88A 1HR0E 1PJTA 2V86A 1A1LA 4M30A 4BHCA 2HJJA 1IQSA 4Q35B 4X66E 1IQOA 2LTSA 2EM9A 1T39A 4JI8E 2KOUA 4MLQA 3QG5C 4B3ME 5AC5A 4OOGC 2LCEA 1T4NA 5CFFE 2LBSB 5LMUE 2FTXB 1JK2A 4LF5E 2EOFA 4B3RE 4F6NA 2CPNA 2NABA 4TUIA 2DMYA 2JYAA 2YTOA 2K7IA 4R2DA 4DR7E 3K6QA 2IHR1 4WSPA 4WXCA 2JOXA 2EMBA 2V89A 4P7DA 1QU6A 1TF6A 2JXPA 4DR1E 5DNYA 4JI4E 3J80C 2UU9E 3T1HE 2A25A 3EPKA 2L2KB 2YTEA 2VE7C 1A1JA 5BR8E 4DV3E 1XMQE 4DMIA 4LF7E 4DR5E 2ELZA 5A2QC 4KWYA 1NEIA 2YTIA 4WPYA 2EPMX 2EPAA 2JY9A 4X9JA 2EMWA 1DGCA 1X48A 2EPKX 3J7AG 2EMXA 3EPLA 3EPHA 2HC5A 3THOB 5A6JA 2M9AA 2B3TB 4BHBA 2JVAA 4O43A 4IS1C 1PJQA 2EWLA 2ELYA 4DV4E 4MLVA 2YWQA 5IT9C 3L00A 2ENCA 4YY3E 1WJPA 1X6HA 4DUYE 2EOMA 3JU0A 2J7JA
chains in the Genus database with same CATH topology
4WSGA 2VRDA 2EOQA 1A1IA 1MEYC 2DRPA 5KL3A 1Z1BA 2EPXA 1RMDA 2EMKA 2EMFA 5KL5A 2EN1A 2EL6A 3VHTB 2WCC3 4F6MA 1YSAC 2DMIA 2EN8A 2EQ0A 2RPCA 2EN3A 1TF3A 2EP3A 2EL4A 2YRHA 2EOJA 2YTGA 2JP9A 2BB8A 1UN6B 1LLMC 2LT7A 5KL7A 4M9VC 5KL4A 2EOEA 4R2AA 2EM3A 2E72A 2EN6A 1A1LA 2EOHA 2EPPA 2MDGA 2YSOA 2EMZA 2EM9A 2EJ4A 2EN2A 2EMLA 2EMIA 1X5WA 1ZAAC 2EM5A 2LCEA 1A1FA 2R1FA 2EM0A 2EM7A 2YTPA 1JK2A 2YRKA 2EOFA 4F6NA 4R2PA 2PRTA 2EE8A 2ADRA 2JPAA 2NABA 1X6FA 2MKDA 2RSIA 2YTOA 3MHSC 4R2DA 3EPJA 2EORA 2EMBA 2CTDA 2YTFA 3MHHC 1G2FC 2EM2A 2EOXA 4FK5C 3UK3C 1TF6A 2YU8A 1JK1A 1A1HA 1G2DC 2YSPA 1AAYA 2EMYA 2EQ1A 4IJDA 2CT1A 2EPCA 1TN9A 2WBUA 2A25A 2YTQA 3EPKA 1F2IG 2EQ3A 2EOSA 2YTEA 2GLIA 2YTJA 2LO3A 1P47A 1A1KA 1ZU1A 1UBDC 1A1JA 2DLKA 2EMCA 2LV2A 1B69A 1KJKA 3M99B 2ELZA 4R2SA 1NCSA 2YTIA 4R2EA 2EPZA 2EPAA 2EM8A 4X9JA 2EN7A 2EMWA 4R2RA 1DGCA 2EM4A 2EMXA 2YTNA 2MKNA 4F2JC 3EPLA 1ZR9A 3EPHA 2EOZA 2DGCA 2EOIA 1X3CA 2M9AA 2EM6A 1A1GA 2D9HA 1YUJA 2LVHA 2YTDA 4IS1C 2WBSA 2GHFA 2ELYA 1BBOA 2EPRA 5KL2A 2EOYA 4GZNC 2HGHA 2YU5A 2WBTA 2EN4A 2EMGA 2ENCA 2EPUA 1WJPA 1X6EA 2CSHA 2EMHA 2I13A 2DLQA 2EL5A 5KL6A 1YUIA 2EMAA 2YRMA 1X6HA 4R2CA 2ENAA 2EOMA 2J7JA 2EOOA 4R2QA 1BB8A 2ENHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WSG A;  2VRD A;  2EOQ A;  1A1I A;  1MEY C;  2DRP A;  5KL3 A;  1Z1B A;  2EPX A;  1RMD A;  2EMK A;  2EMF A;  5KL5 A;  2EN1 A;  2EL6 A;  3VHT B;  2WCC 3;  4F6M A;  1YSA C;  2DMI A;  2EN8 A;  2EQ0 A;  2RPC A;  2EN3 A;  1TF3 A;  2EP3 A;  2EL4 A;  2YRH A;  2EOJ A;  2YTG A;  2JP9 A;  2BB8 A;  1UN6 B;  1LLM C;  2LT7 A;  5KL7 A;  4M9V C;  5KL4 A;  2EOE A;  4R2A A;  2EM3 A;  2E72 A;  2EN6 A;  1A1L A;  2EOH A;  2EPP A;  2MDG A;  2YSO A;  2EMZ A;  2EM9 A;  2EJ4 A;  2EN2 A;  2EML A;  2EMI A;  1X5W A;  1ZAA C;  2EM5 A;  2LCE A;  1A1F A;  2R1F A;  2EM0 A;  2EM7 A;  2YTP A;  1JK2 A;  2YRK A;  2EOF A;  4F6N A;  4R2P A;  2PRT A;  2EE8 A;  2ADR A;  2JPA A;  2NAB A;  1X6F A;  2MKD A;  2RSI A;  2YTO A;  3MHS C;  4R2D A;  3EPJ A;  2EOR A;  2EMB A;  2CTD A;  2YTF A;  3MHH C;  1G2F C;  2EM2 A;  2EOX A;  4FK5 C;  3UK3 C;  1TF6 A;  2YU8 A;  1JK1 A;  1A1H A;  1G2D C;  2YSP A;  1AAY A;  2EMY A;  2EQ1 A;  4IJD A;  2CT1 A;  2EPC A;  1TN9 A;  2WBU A;  2A25 A;  2YTQ A;  3EPK A;  1F2I G;  2EQ3 A;  2EOS A;  2YTE A;  2GLI A;  2YTJ A;  2LO3 A;  1P47 A;  1A1K A;  1ZU1 A;  1UBD C;  1A1J A;  2DLK A;  2EMC A;  2LV2 A;  1B69 A;  1KJK A;  3M99 B;  2ELZ A;  4R2S A;  1NCS A;  2YTI A;  4R2E A;  2EPZ A;  2EPA A;  2EM8 A;  4X9J A;  2EN7 A;  2EMW A;  4R2R A;  1DGC A;  2EM4 A;  2EMX A;  2YTN A;  2MKN A;  4F2J C;  3EPL A;  1ZR9 A;  3EPH A;  2EOZ A;  2DGC A;  2EOI A;  1X3C A;  2M9A A;  2EM6 A;  1A1G A;  2D9H A;  1YUJ A;  2LVH A;  2YTD A;  4IS1 C;  2WBS A;  2GHF A;  2ELY A;  1BBO A;  2EPR A;  5KL2 A;  2EOY A;  4GZN C;  2HGH A;  2YU5 A;  2WBT A;  2EN4 A;  2EMG A;  2ENC A;  2EPU A;  1WJP A;  1X6E A;  2CSH A;  2EMH A;  2I13 A;  2DLQ A;  2EL5 A;  5KL6 A;  1YUI A;  2EMA A;  2YRM A;  1X6H A;  4R2C A;  2ENA A;  2EOM A;  2J7J A;  2EOO A;  4R2Q A;  1BB8 A;  2ENH A; 
#chains in the Genus database with same CATH topology
 4DV0 E;  2VRD A;  2LRS A;  3BBG A;  4WYQ B;  1SFE A;  3F6H A;  3VHT B;  1YSA C;  2RPC A;  2R76 A;  2RTX A;  4TUG A;  1PJS A;  4I8O A;  2ODR C;  1LLM C;  3ADL A;  2YZT A;  4GKJ E;  3EQ1 A;  3ADG A;  4WXD A;  5KL7 A;  3HQ1 A;  2RSM A;  3HXL A;  1YYO A;  5KL4 A;  2EOE A;  4R2A A;  1FKA E;  3IWB A;  3ZOQ B;  4DR2 E;  2EN6 A;  2LJU A;  4ZYH A;  4KHP E;  2L3J A;  2YSO A;  5T6J A;  2KHX A;  2RQL A;  2EMI A;  4X64 E;  2UXB E;  1ZAA C;  4LF6 E;  4DV5 E;  2YTP A;  2NUG A;  2YRK A;  5FLX C;  4LFC E;  2PRT A;  2EE8 A;  2JOB A;  2DSY A;  2I9I A;  1DI2 A;  4YHH E;  2M7Q A;  1DQ3 A;  2YTF A;  4NHR A;  1IBK E;  2EM2 A;  3UK3 C;  1STU A;  1JK1 A;  1A1H A;  1GTK A;  1XNR E;  1G2D C;  2YSP A;  4X8W A;  1AAY A;  2EQ1 A;  2CT1 A;  1TN9 A;  2WBU A;  1N33 E;  2YTQ A;  1F2I G;  5LL6 R;  2VQF E;  3VYY A;  4DV1 E;  4K0K E;  5F3W A;  2B7V A;  2GLI A;  2NUE A;  2LO3 A;  3ADJ A;  1A1K A;  2DLK A;  4BC9 A;  1B69 A;  1KJK A;  5A6B D;  1UIL A;  2EPO A;  4L8N A;  3T1Y E;  4HTG A;  2LTR A;  1J5E E;  2GPI A;  2MKN A;  4F2J C;  1ZR9 A;  2EOZ A;  3HPZ A;  2WBS A;  4O24 A;  1N36 E;  1BBO A;  2EPR A;  1IBM E;  4GKK E;  5KL2 A;  2E5L E;  2N3H A;  2M4I A;  3MSW A;  2HGH A;  2EN4 A;  2EMG A;  4X62 E;  4BC7 A;  1EH6 A;  2EMH A;  1WXR A;  1KYQ A;  5KL6 A;  1XNQ E;  2YRM A;  3DF6 A;  1ZBQ A;  1GZ6 A;  2NA2 A;  3VYX A;  2HHH E;  1YYK A;  2ENH A;  3TQM A;  2EOQ A;  3AUZ A;  1Z1B A;  2L2N A;  1UHZ A;  2VF1 A;  5KL5 A;  2EN1 A;  2V85 A;  2EP3 A;  2N3G A;  2EL4 A;  2YTG A;  4JI1 E;  2E1M A;  2RS6 A;  2JP9 A;  2L33 A;  5A6B A;  4WX9 A;  1T4O A;  5ADZ A;  4Q28 A;  2F8B A;  5AE1 A;  4JI2 E;  2UUC E;  4LF9 E;  2JWO A;  1J26 A;  2EOH A;  2MDG A;  3C4T A;  2BBG A;  2EMZ A;  1WHN A;  4JI3 E;  2G7H A;  4F9B B;  1HNX E;  2EML A;  1A1F A;  1YFH A;  2EM0 A;  4LFB E;  1SR9 A;  3BGH A;  2ADR A;  4LTY A;  4B3T E;  1EKZ A;  1T38 A;  1L4S A;  3EPJ A;  2EOR A;  1X47 A;  4HEI A;  2CTD A;  4WFT A;  2EOX A;  4X65 E;  2YU8 A;  4DKK A;  2K4V A;  4JI7 E;  2UUA E;  4BCA A;  4IJD A;  3JAM C;  1RC7 A;  1EH7 A;  4J8Z A;  4DR3 E;  5TSE A;  4OX9 E;  2YTJ A;  1ZU1 A;  1UBD C;  2ODR D;  2LV2 A;  4DUZ E;  1QNT A;  1PDA A;  2NUF A;  4BBY A;  4R03 A;  4LFA E;  2FV4 B;  3IWD A;  5AC4 A;  1IMU A;  4R2E A;  2EPZ A;  4JV5 E;  1YPN A;  4P78 A;  2DB2 A;  4F9C B;  1FJG E;  1X3C A;  4L5N C;  3C4B A;  1A1G A;  2LVH A;  2MDR A;  2H36 X;  3C6K A;  5A69 A;  2GHF A;  1WHQ A;  2VQE E;  4DV6 E;  4JI0 E;  2KON A;  4ZYD A;  2EOY A;  2LMZ A;  4GZN C;  2LUP B;  2UXD E;  1N3G A;  4JYA E;  2DLQ A;  2EMA A;  2FGG A;  4R2C A;  3ADI A;  4NZV A;  2ENA A;  1BBG A;  4ZYE A;  1RQ0 A;  4R2Q A;  1BB8 A;  2V8Q B;  2DRP A;  3J81 C;  4LF4 E;  2EMK A;  1IBL E;  5A6A A;  3LML A;  2L3C A;  3JTZ A;  1TF3 A;  3AV0 A;  2YRH A;  2YPN A;  3C6M A;  2LE2 A;  4BMJ A;  3HTX A;  2V87 A;  4O4K A;  3H09 A;  4M9V C;  4DR6 E;  4M2Z A;  5A6K A;  2EM3 A;  2E72 A;  2L2M A;  4M0V A;  3OML A;  5LLQ A;  2EPP A;  4RH8 A;  3KWR A;  4DV2 E;  5IV8 B;  3J7Y p;  2UUB E;  4JI5 E;  2EJ4 A;  2EN2 A;  1X5W A;  3HPS A;  1WRJ A;  2L6M A;  1PKP A;  5AAS A;  2R1F A;  3ECR A;  1MGT A;  3RMP A;  3KZY A;  2EM7 A;  2EPL X;  2L92 A;  1ZBT A;  4R2P A;  1GQE A;  2DIX A;  2JPA A;  1X6F A;  2MKD A;  2RSI A;  2MC5 A;  3LLH A;  3MHS C;  2EPN A;  3MHH C;  1G2F C;  4FK5 C;  4GEQ B;  2MC6 A;  3OTO E;  3THN A;  2RS7 A;  2EMY A;  4F9A B;  2EPC A;  2F4V E;  4NXM E;  2YT4 A;  2EQ3 A;  2EOS A;  5AE2 A;  4F54 A;  2LJH A;  1P47 A;  3P1X A;  2L8T A;  4R8O A;  4RHB B;  2ZM6 E;  2EMC A;  2LUQ A;  3M99 B;  4R2S A;  3IWC A;  3BF2 A;  4AQY E;  1NCS A;  5IXM B;  2UXC E;  2EM8 A;  2EN7 A;  2B7T A;  4R2R A;  1N32 E;  2EM4 A;  2WZO A;  2YTN A;  4JI6 E;  2DGC A;  2V83 A;  2EOI A;  4DR4 E;  1YYW A;  1XMO E;  2EM6 A;  1YUJ A;  2D9H A;  2YTD A;  2EZ6 A;  1T4L B;  4LU9 A;  4LF8 E;  4BS9 A;  3F6G A;  1YZ9 A;  2Q8U A;  1N34 E;  2YU5 A;  1AH5 A;  2WBT A;  5AE3 A;  3VK6 A;  4KZS A;  2EPU A;  2JR1 A;  1X6E A;  2CSH A;  2I13 A;  2EL5 A;  4B3S E;  1YUI A;  2B9D A;  2N8X A;  3FIG A;  1HNW E;  4NXN E;  4DV7 E;  2EOO A;  2EM5 A;  5LMN E;  4WSG A;  1A1I A;  1MEY C;  4N4R B;  5KL3 A;  1HNZ E;  2M1S A;  2EPX A;  5IWA E;  1RMD A;  1I94 E;  4ZYG A;  2EMF A;  2EL6 A;  1X49 A;  2WCC 3;  4F6M A;  2DMI A;  2EN8 A;  2EQ0 A;  2EN3 A;  2EOJ A;  3DJW A;  2BB8 A;  1UN6 B;  3BID A;  4O5G A;  2LT7 A;  1EH8 A;  3KZZ A;  1O0W A;  2V88 A;  1HR0 E;  1PJT A;  2V86 A;  1A1L A;  4M30 A;  4BHC A;  2HJJ A;  1IQS A;  4Q35 B;  4X66 E;  1IQO A;  2LTS A;  2EM9 A;  1T39 A;  4JI8 E;  2KOU A;  4MLQ A;  3QG5 C;  4B3M E;  5AC5 A;  4OOG C;  2LCE A;  1T4N A;  5CFF E;  2LBS B;  5LMU E;  2FTX B;  1JK2 A;  4LF5 E;  2EOF A;  4B3R E;  4F6N A;  2CPN A;  2NAB A;  4TUI A;  2DMY A;  2JYA A;  2YTO A;  2K7I A;  4R2D A;  4DR7 E;  3K6Q A;  2IHR 1;  4WSP A;  4WXC A;  2JOX A;  2EMB A;  2V89 A;  4P7D A;  1QU6 A;  1TF6 A;  2JXP A;  4DR1 E;  5DNY A;  4JI4 E;  3J80 C;  2UU9 E;  3T1H E;  2A25 A;  3EPK A;  2L2K B;  2YTE A;  2VE7 C;  1A1J A;  5BR8 E;  4DV3 E;  1XMQ E;  4DMI A;  4LF7 E;  4DR5 E;  2ELZ A;  5A2Q C;  4KWY A;  1NEI A;  2YTI A;  4WPY A;  2EPM X;  2EPA A;  2JY9 A;  4X9J A;  2EMW A;  1DGC A;  1X48 A;  2EPK X;  3J7A G;  2EMX A;  3EPL A;  3EPH A;  2HC5 A;  3THO B;  5A6J A;  2M9A A;  2B3T B;  4BHB A;  2JVA A;  4O43 A;  4IS1 C;  1PJQ A;  2EWL A;  2ELY A;  4DV4 E;  4MLV A;  2YWQ A;  5IT9 C;  3L00 A;  2ENC A;  4YY3 E;  1WJP A;  1X6H A;  4DUY E;  2EOM A;  3JU0 A;  2J7J A; 
#chains in the Genus database with same CATH homology
 4WSG A;  2VRD A;  2EOQ A;  1A1I A;  1MEY C;  2DRP A;  5KL3 A;  1Z1B A;  2EPX A;  1RMD A;  2EMK A;  2EMF A;  5KL5 A;  2EN1 A;  2EL6 A;  3VHT B;  2WCC 3;  4F6M A;  1YSA C;  2DMI A;  2EN8 A;  2EQ0 A;  2RPC A;  2EN3 A;  1TF3 A;  2EP3 A;  2EL4 A;  2YRH A;  2EOJ A;  2YTG A;  2JP9 A;  2BB8 A;  1UN6 B;  1LLM C;  2LT7 A;  5KL7 A;  4M9V C;  5KL4 A;  2EOE A;  4R2A A;  2EM3 A;  2E72 A;  2EN6 A;  1A1L A;  2EOH A;  2EPP A;  2MDG A;  2YSO A;  2EMZ A;  2EM9 A;  2EJ4 A;  2EN2 A;  2EML A;  2EMI A;  1X5W A;  1ZAA C;  2EM5 A;  2LCE A;  1A1F A;  2R1F A;  2EM0 A;  2EM7 A;  2YTP A;  1JK2 A;  2YRK A;  2EOF A;  4F6N A;  4R2P A;  2PRT A;  2EE8 A;  2ADR A;  2JPA A;  2NAB A;  1X6F A;  2MKD A;  2RSI A;  2YTO A;  3MHS C;  4R2D A;  3EPJ A;  2EOR A;  2EMB A;  2CTD A;  2YTF A;  3MHH C;  1G2F C;  2EM2 A;  2EOX A;  4FK5 C;  3UK3 C;  1TF6 A;  2YU8 A;  1JK1 A;  1A1H A;  1G2D C;  2YSP A;  1AAY A;  2EMY A;  2EQ1 A;  4IJD A;  2CT1 A;  2EPC A;  1TN9 A;  2WBU A;  2A25 A;  2YTQ A;  3EPK A;  1F2I G;  2EQ3 A;  2EOS A;  2YTE A;  2GLI A;  2YTJ A;  2LO3 A;  1P47 A;  1A1K A;  1ZU1 A;  1UBD C;  1A1J A;  2DLK A;  2EMC A;  2LV2 A;  1B69 A;  1KJK A;  3M99 B;  2ELZ A;  4R2S A;  1NCS A;  2YTI A;  4R2E A;  2EPZ A;  2EPA A;  2EM8 A;  4X9J A;  2EN7 A;  2EMW A;  4R2R A;  1DGC A;  2EM4 A;  2EMX A;  2YTN A;  2MKN A;  4F2J C;  3EPL A;  1ZR9 A;  3EPH A;  2EOZ A;  2DGC A;  2EOI A;  1X3C A;  2M9A A;  2EM6 A;  1A1G A;  2D9H A;  1YUJ A;  2LVH A;  2YTD A;  4IS1 C;  2WBS A;  2GHF A;  2ELY A;  1BBO A;  2EPR A;  5KL2 A;  2EOY A;  4GZN C;  2HGH A;  2YU5 A;  2WBT A;  2EN4 A;  2EMG A;  2ENC A;  2EPU A;  1WJP A;  1X6E A;  2CSH A;  2EMH A;  2I13 A;  2DLQ A;  2EL5 A;  5KL6 A;  1YUI A;  2EMA A;  2YRM A;  1X6H A;  4R2C A;  2ENA A;  2EOM A;  2J7J A;  2EOO A;  4R2Q A;  1BB8 A;  2ENH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...