2EOHA

Solution structure of the c2h2 type zinc finger (region 780-812) of human zinc finger protein 28 homolog
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
b'GSSGSSGSGKKPYECKECRKTFIQIGHLNQHKRVHTGERSSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 28 homolog
publication title Solution structure of the C2H2 type zinc finger (region 780-812) of human Zinc finger protein 28 homolog
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eohA00
2EMCA 2EQ0A 2YTOA 1UN6B 2YRMA 2YTNA 1A1IA 2VRDA 2J7JA 4IJDA 1TF3A 1A1JA 2D9HA 3EPHA 2YTIA 2EOEA 2EPPA 2DLKA 2ENAA 2EMLA 1BB8A 1X5WA 4R2QA 2GLIA 2I13A 2EM7A 2YTJA 2EL4A 1TN9A 1A1FA 2LCEA 5KL7A 2PRTA 2EMIA 2EJ4A 2EE8A 2EN7A 3EPJA 2YRHA 3MHHC 4GZNC 5KL4A 1WJPA 2EN2A 2LVHA 2RSIA 4R2RA 2YU5A 2EOIA 2EM2A 2EOYA 5KL2A 4R2AA 4R2SA 2EMBA 2EPXA 4R2DA 2EM9A 1G2DC 2EQ3A 4F2JC 5KL5A 1ZU1A 2EOXA 4IS1C 2RPCA 4F6NA 3EPKA 2EMAA 2LO3A 4R2PA 2WBSA 2YTQA 2EOHA 2ELZA 1LLMC 5KL3A 2EPUA 2YSOA 2YTFA 2CTDA 2EMKA 2EMGA 2EQ1A 1YSAC 1ZAAC 4FK5C 2YTDA 2EM8A 1JK2A 3M99B 2EPZA 2MKNA 1TF6A 2EN4A 4R2CA 2EORA 1P47A 1AAYA 1RMDA 2JP9A 2YSPA 1A1LA 2EMWA 2YRKA 3EPLA 2EL6A 2MKDA 2JPAA 2EN3A 2HGHA 2EOSA 5KL6A 2EPAA 2ENHA 2WCC3 2EM4A 2EOMA 2EM5A 2CSHA 1A1GA 2EPRA 1A1KA 1A1HA 2R1FA 2EP3A 2WBTA 2EN8A 1X6HA 2EPCA 2YTEA 2GHFA 2NABA 2LT7A 2ELYA 2EMYA 2YU8A 2EMXA 2A25A 3MHSC 1X3CA 2EOQA 2M9AA 2EMFA 2EN1A 1JK1A 4WSGA 2CT1A 2EN6A 1MEYC 2EMZA 1YUJA 1BBOA 2EM0A 1YUIA 2EOZA 2YTPA 1Z1BA 3UK3C 2ENCA 1DGCA 1X6FA 4X9JA 2DRPA 2E72A 2LV2A 1X6EA 2BB8A 2EOOA 4M9VC 2EM6A 2YTGA 2DGCA 2DMIA 1UBDC 2EM3A 1G2FC 2EL5A 1ZR9A 2WBUA 4R2EA 2ADRA 2DLQA 3VHTB 1F2IG 1B69A 2EOFA 2EOJA 1NCSA 4F6MA 2MDGA 1KJKA 2EMHA
chains in the Genus database with same CATH superfamily
1EH8A 2EQ0A 1NEIA 4RHBB 1A1IA 1A1JA 2D9HA 2K4VA 2NUFA 4GEQB 2EMLA 2GLIA 2YTJA 2KHXA 2EL4A 5LLQA 1A1FA 1QU6A 5KL7A 2PRTA 1N34E 2UUBE 1YYWA 4LF9E 3VYXA 4JI2E 3VK6A 2VE7C 4LTYA 4ZYDA 3EPJA 2YRHA 3MHHC 5AASA 2CPNA 1KYQA 4R8OA 2LE2A 2LVHA 2EM2A 5KL2A 4R2SA 1PJSA 2EPOA 3L00A 2EPXA 4R2DA 1IQOA 3OTOE 2JR1A 1IMUA 3KWRA 2RPCA 3FIGA 2EMAA 4LFBE 4LFAE 2WBSA 2YTQA 5A6KA 3JU0A 2WZOA 2EPUA 2G7HA 3T1HE 2RSMA 2ODRD 2LTSA 2YTFA 1XMQE 2CTDA 2EMKA 4DV7E 2DIXA 1ZAAC 2RS6A 2EPNA 2BBGA 2L2NA 4HTGA 3M99B 2HJJA 4JI8E 2JP9A 2UU9E 1ZBTA 1RC7A 2EL6A 2ZM6E 2MKDA 2F4VE 2EN3A 4DR2E 4OX9E 2HGHA 4L8NA 2E1MA 2EOSA 4X65E 2M1SA 2EM4A 2V87A 2V8QB 1A1GA 1A1HA 2R1FA 3ZOQB 2WBTA 3C6MA 2EN8A 2EPCA 5IV8B 1N36E 2ELYA 4KHPE 2EMYA 2N8XA 2YPNA 2A25A 1BBGA 3MHSC 4WX9A 3ADGA 1N3GA 2LUQA 1JK1A 2HHHE 1BBOA 2L33A 4GKJE 1Z1BA 3AUZA 2ENCA 4LU9A 1X6EA 2EOOA 2I9IA 2DMIA 2MC5A 3C6KA 2LUPB 2JVAA 3J81C 2DLQA 1B69A 4JI6E 4F54A 3T1YE 4F6MA 4X64E 1RQ0A 2MDGA 1KJKA 1UN6B 3MSWA 1XNRE 4KWYA 2VRDA 2J7JA 3J7Yp 4JI4E 3JTZA 2MC6A 2YTIA 4WXCA 2RS7A 2E5LE 1WHQA 1WXRA 1BB8A 1X5WA 4BS9A 4R2QA 2I13A 2LJHA 2EM7A 2L3CA 1TN9A 1IBME 4MLQA 3C4BA 4O5GA 3THOB 2EN7A 3LLHA 1WJPA 2EN2A 2DSYA 2RSIA 2NUEA 2EOIA 3DJWA 2EPKX 4MLVA 2NA2A 4ZYEA 1HNXE 2V88A 2EM9A 3AV0A 1ZU1A 4F9BB 4R2PA 2EOHA 4NHRA 1LLMC 1IQSA 4BMJA 2L92A 4WSPA 4B3TE 2EMGA 1PJQA 1YSAC 4FK5C 2YTDA 2EM8A 2L3JA 1PKPA 2EPZA 2MKNA 2B9DA 4TUGA 4N4RB 4NZVA 2YRKA 3IWDA 5LMUE 5AE1A 2R76A 4DV2E 1I94E 4BC7A 2EPAA 4I8OA 4JYAE 1ZBQA 2F8BA 1A1KA 2UXDE 2EP3A 3BGHA 5DNYA 2JXPA 1X6HA 3EQ1A 1PJTA 1UHZA 4JI1E 4M30A 4LF5E 4X62E 2YU8A 2V83A 3IWCA 2L8TA 2UUAE 2EOQA 2M9AA 2JY9A 5IXMB 1T38A 2K7IA 4DR6E 1GTKA 2EM0A 4Q28A 4YHHE 1YUIA 2YT4A 4OOGC 1YFHA 3H09A 3JAMC 1STUA 4DMIA 2DGCA 4DV1E 4LFCE 2EPMX 4BCAA 1SR9A 2EL5A 2JYAA 1X48A 1ZR9A 4KZSA 3QG5C 4JV5E 4WXDA 4YY3E 2WBUA 4R2EA 3VHTB 3IWBA 2L6MA 1T39A 1F2IG 3K6QA 1YZ9A 1NCSA 3HPZA 2EMHA 2V85A 2YRMA 2DMYA 4IJDA 1TF3A 3ADJA 3TQMA 1XMOE 2M7QA 2EOEA 4DV4E 2DLKA 2ENAA 5TSEA 3BIDA 1XNQE 4ZYHA 5ADZA 4GKKE 5AC4A 2M4IA 2LCEA 4LF8E 2EMIA 4P78A 4LF4E 3J7AG 2EPLX 4WPYA 1GZ6A 2MDRA 4GZNC 5KL4A 4JI0E 4DR7E 2YU5A 3THNA 3ADIA 2L2MA 2EMBA 4Q35B 2LBSB 1G2DC 4F2JC 2UUCE 1N32E 5LMNE 3DF6A 4DV0E 4P7DA 2LO3A 5CFFE 5IWAE 2ELZA 3P1XA 5KL3A 3VYYA 3C4TA 1JK2A 4B3ME 4F9CB 2V86A 4R2CA 5A6BD 2EMWA 2RQLA 1UILA 1O0WA 2L2KB 2LTRA 4BHBA 4DV6E 2HC5A 2JPAA 4K0KE 1FJGE 1T4OA 5KL6A 5AE2A 3KZYA 2EOMA 2EM5A 3HQ1A 2CSHA 2VQEE 4F9AB 2Q8UA 2EPRA 1AH5A 5AC5A 2YTEA 2GHFA 2NABA 2EMXA 1YYKA 1X3CA 1DI2A 2VQFE 1X47A 4M0VA 2EMFA 4B3RE 2EN1A 2H36X 1QNTA 4WSGA 2CT1A 2EN6A 2NUGA 2EMZA 2V89A 1YUJA 4JI3E 2KOUA 5IT9C 4NXME 2EOZA 2YTPA 2IHR1 1X49A 4O24A 4WFTA 2FGGA 3ECRA 4X8WA 4X9JA 2DRPA 2E72A 2LV2A 5AE3A 3KZZA 4M9VC 2B3TB 2YTGA 4O43A 1WHNA 2EM3A 4DV5E 4NXNE 2ADRA 4JI7E 2UXCE 3HTXA 2EOJA 4DR4E 3HPSA 1SFEA 1YPNA 4J8ZA 2EMCA 1EH6A 2YTOA 4B3SE 3ADLA 2YTNA 4HEIA 3J80C 2JWOA 3EPHA 4M2ZA 5A6AA 2FV4B 3BF2A 2KONA 4DUYE 2EJ4A 1HNWE 2GPIA 1EKZA 2EE8A 2FTXB 4BC9A 5A69A 4R2RA 1PDAA 5T6JA 1T4LB 4DKKA 1T4NA 2EOYA 1J26A 4R2AA 2ODRC 2LMZA 1YYOA 2EQ3A 5KL5A 2EOXA 4IS1C 4F6NA 1FKAE 3EPKA 1HR0E 4X66E 1L4SA 2EWLA 5LL6R 2JOBA 2YSOA 2EQ1A 4DR3E 1EH7A 1IBLE 4DV3E 4JI5E 1TF6A 4LF7E 2EN4A 2N3GA 2EORA 1P47A 1AAYA 1RMDA 2YSPA 1A1LA 3LMLA 3EPLA 2LRSA 1J5EE 5BR8E 4O4KA 4BBYA 2EZ6A 2ENHA 2WCC3 3HXLA 2B7VA 1N33E 5A6BA 2LT7A 3BBGA 4LF6E 4RH8A 4WYQB 4AQYE 3F6GA 1HNZE 4BHCA 2JOXA 4DR1E 5A6JA 2N3HA 4L5NC 1MEYC 2YZTA 3OMLA 4TUIA 1WRJA 5F3WA 3RMPA 3UK3C 1DGCA 2UXBE 1X6FA 1GQEA 2BB8A 3F6HA 2EM6A 1IBKE 4DUZE 1UBDC 1DQ3A 2YWQA 2LJUA 4ZYGA 2B7TA 1G2FC 2RTXA 5A2QC 2DB2A 4DR5E 2EOFA 4R03A 2VF1A 2EPPA 5FLXC 1MGTA
chains in the Genus database with same CATH topology
2EMCA 2EQ0A 2YTOA 1UN6B 2YRMA 2YTNA 1A1IA 2VRDA 2J7JA 4IJDA 1TF3A 1A1JA 2D9HA 3EPHA 2YTIA 2EOEA 2EPPA 2DLKA 2ENAA 2EMLA 1BB8A 1X5WA 4R2QA 2GLIA 2I13A 2EM7A 2YTJA 2EL4A 1TN9A 1A1FA 2LCEA 5KL7A 2PRTA 2EMIA 2EJ4A 2EE8A 2EN7A 3EPJA 2YRHA 3MHHC 4GZNC 5KL4A 1WJPA 2EN2A 2LVHA 2RSIA 4R2RA 2YU5A 2EOIA 2EM2A 2EOYA 5KL2A 4R2AA 4R2SA 2EMBA 2EPXA 4R2DA 2EM9A 1G2DC 2EQ3A 4F2JC 5KL5A 1ZU1A 2EOXA 4IS1C 2RPCA 4F6NA 3EPKA 2EMAA 2LO3A 4R2PA 2WBSA 2YTQA 2EOHA 2ELZA 1LLMC 5KL3A 2EPUA 2YSOA 2YTFA 2CTDA 2EMKA 2EMGA 2EQ1A 1YSAC 1ZAAC 4FK5C 2YTDA 2EM8A 1JK2A 3M99B 2EPZA 2MKNA 1TF6A 2EN4A 4R2CA 2EORA 1P47A 1AAYA 1RMDA 2JP9A 2YSPA 1A1LA 2EMWA 2YRKA 3EPLA 2EL6A 2MKDA 2JPAA 2EN3A 2HGHA 2EOSA 5KL6A 2EPAA 2ENHA 2WCC3 2EM4A 2EOMA 2EM5A 2CSHA 1A1GA 2EPRA 1A1KA 1A1HA 2R1FA 2EP3A 2WBTA 2EN8A 1X6HA 2EPCA 2YTEA 2GHFA 2NABA 2LT7A 2ELYA 2EMYA 2YU8A 2EMXA 2A25A 3MHSC 1X3CA 2EOQA 2M9AA 2EMFA 2EN1A 1JK1A 4WSGA 2CT1A 2EN6A 1MEYC 2EMZA 1YUJA 1BBOA 2EM0A 1YUIA 2EOZA 2YTPA 1Z1BA 3UK3C 2ENCA 1DGCA 1X6FA 4X9JA 2DRPA 2E72A 2LV2A 1X6EA 2BB8A 2EOOA 4M9VC 2EM6A 2YTGA 2DGCA 2DMIA 1UBDC 2EM3A 1G2FC 2EL5A 1ZR9A 2WBUA 4R2EA 2ADRA 2DLQA 3VHTB 1F2IG 1B69A 2EOFA 2EOJA 1NCSA 4F6MA 2MDGA 1KJKA 2EMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMC A;  2EQ0 A;  2YTO A;  1UN6 B;  2YRM A;  2YTN A;  1A1I A;  2VRD A;  2J7J A;  4IJD A;  1TF3 A;  1A1J A;  2D9H A;  3EPH A;  2YTI A;  2EOE A;  2EPP A;  2DLK A;  2ENA A;  2EML A;  1BB8 A;  1X5W A;  4R2Q A;  2GLI A;  2I13 A;  2EM7 A;  2YTJ A;  2EL4 A;  1TN9 A;  1A1F A;  2LCE A;  5KL7 A;  2PRT A;  2EMI A;  2EJ4 A;  2EE8 A;  2EN7 A;  3EPJ A;  2YRH A;  3MHH C;  4GZN C;  5KL4 A;  1WJP A;  2EN2 A;  2LVH A;  2RSI A;  4R2R A;  2YU5 A;  2EOI A;  2EM2 A;  2EOY A;  5KL2 A;  4R2A A;  4R2S A;  2EMB A;  2EPX A;  4R2D A;  2EM9 A;  1G2D C;  2EQ3 A;  4F2J C;  5KL5 A;  1ZU1 A;  2EOX A;  4IS1 C;  2RPC A;  4F6N A;  3EPK A;  2EMA A;  2LO3 A;  4R2P A;  2WBS A;  2YTQ A;  2EOH A;  2ELZ A;  1LLM C;  5KL3 A;  2EPU A;  2YSO A;  2YTF A;  2CTD A;  2EMK A;  2EMG A;  2EQ1 A;  1YSA C;  1ZAA C;  4FK5 C;  2YTD A;  2EM8 A;  1JK2 A;  3M99 B;  2EPZ A;  2MKN A;  1TF6 A;  2EN4 A;  4R2C A;  2EOR A;  1P47 A;  1AAY A;  1RMD A;  2JP9 A;  2YSP A;  1A1L A;  2EMW A;  2YRK A;  3EPL A;  2EL6 A;  2MKD A;  2JPA A;  2EN3 A;  2HGH A;  2EOS A;  5KL6 A;  2EPA A;  2ENH A;  2WCC 3;  2EM4 A;  2EOM A;  2EM5 A;  2CSH A;  1A1G A;  2EPR A;  1A1K A;  1A1H A;  2R1F A;  2EP3 A;  2WBT A;  2EN8 A;  1X6H A;  2EPC A;  2YTE A;  2GHF A;  2NAB A;  2LT7 A;  2ELY A;  2EMY A;  2YU8 A;  2EMX A;  2A25 A;  3MHS C;  1X3C A;  2EOQ A;  2M9A A;  2EMF A;  2EN1 A;  1JK1 A;  4WSG A;  2CT1 A;  2EN6 A;  1MEY C;  2EMZ A;  1YUJ A;  1BBO A;  2EM0 A;  1YUI A;  2EOZ A;  2YTP A;  1Z1B A;  3UK3 C;  2ENC A;  1DGC A;  1X6F A;  4X9J A;  2DRP A;  2E72 A;  2LV2 A;  1X6E A;  2BB8 A;  2EOO A;  4M9V C;  2EM6 A;  2YTG A;  2DGC A;  2DMI A;  1UBD C;  2EM3 A;  1G2F C;  2EL5 A;  1ZR9 A;  2WBU A;  4R2E A;  2ADR A;  2DLQ A;  3VHT B;  1F2I G;  1B69 A;  2EOF A;  2EOJ A;  1NCS A;  4F6M A;  2MDG A;  1KJK A;  2EMH A; 
#chains in the Genus database with same CATH topology
 1EH8 A;  2EQ0 A;  1NEI A;  4RHB B;  1A1I A;  1A1J A;  2D9H A;  2K4V A;  2NUF A;  4GEQ B;  2EML A;  2GLI A;  2YTJ A;  2KHX A;  2EL4 A;  5LLQ A;  1A1F A;  1QU6 A;  5KL7 A;  2PRT A;  1N34 E;  2UUB E;  1YYW A;  4LF9 E;  3VYX A;  4JI2 E;  3VK6 A;  2VE7 C;  4LTY A;  4ZYD A;  3EPJ A;  2YRH A;  3MHH C;  5AAS A;  2CPN A;  1KYQ A;  4R8O A;  2LE2 A;  2LVH A;  2EM2 A;  5KL2 A;  4R2S A;  1PJS A;  2EPO A;  3L00 A;  2EPX A;  4R2D A;  1IQO A;  3OTO E;  2JR1 A;  1IMU A;  3KWR A;  2RPC A;  3FIG A;  2EMA A;  4LFB E;  4LFA E;  2WBS A;  2YTQ A;  5A6K A;  3JU0 A;  2WZO A;  2EPU A;  2G7H A;  3T1H E;  2RSM A;  2ODR D;  2LTS A;  2YTF A;  1XMQ E;  2CTD A;  2EMK A;  4DV7 E;  2DIX A;  1ZAA C;  2RS6 A;  2EPN A;  2BBG A;  2L2N A;  4HTG A;  3M99 B;  2HJJ A;  4JI8 E;  2JP9 A;  2UU9 E;  1ZBT A;  1RC7 A;  2EL6 A;  2ZM6 E;  2MKD A;  2F4V E;  2EN3 A;  4DR2 E;  4OX9 E;  2HGH A;  4L8N A;  2E1M A;  2EOS A;  4X65 E;  2M1S A;  2EM4 A;  2V87 A;  2V8Q B;  1A1G A;  1A1H A;  2R1F A;  3ZOQ B;  2WBT A;  3C6M A;  2EN8 A;  2EPC A;  5IV8 B;  1N36 E;  2ELY A;  4KHP E;  2EMY A;  2N8X A;  2YPN A;  2A25 A;  1BBG A;  3MHS C;  4WX9 A;  3ADG A;  1N3G A;  2LUQ A;  1JK1 A;  2HHH E;  1BBO A;  2L33 A;  4GKJ E;  1Z1B A;  3AUZ A;  2ENC A;  4LU9 A;  1X6E A;  2EOO A;  2I9I A;  2DMI A;  2MC5 A;  3C6K A;  2LUP B;  2JVA A;  3J81 C;  2DLQ A;  1B69 A;  4JI6 E;  4F54 A;  3T1Y E;  4F6M A;  4X64 E;  1RQ0 A;  2MDG A;  1KJK A;  1UN6 B;  3MSW A;  1XNR E;  4KWY A;  2VRD A;  2J7J A;  3J7Y p;  4JI4 E;  3JTZ A;  2MC6 A;  2YTI A;  4WXC A;  2RS7 A;  2E5L E;  1WHQ A;  1WXR A;  1BB8 A;  1X5W A;  4BS9 A;  4R2Q A;  2I13 A;  2LJH A;  2EM7 A;  2L3C A;  1TN9 A;  1IBM E;  4MLQ A;  3C4B A;  4O5G A;  3THO B;  2EN7 A;  3LLH A;  1WJP A;  2EN2 A;  2DSY A;  2RSI A;  2NUE A;  2EOI A;  3DJW A;  2EPK X;  4MLV A;  2NA2 A;  4ZYE A;  1HNX E;  2V88 A;  2EM9 A;  3AV0 A;  1ZU1 A;  4F9B B;  4R2P A;  2EOH A;  4NHR A;  1LLM C;  1IQS A;  4BMJ A;  2L92 A;  4WSP A;  4B3T E;  2EMG A;  1PJQ A;  1YSA C;  4FK5 C;  2YTD A;  2EM8 A;  2L3J A;  1PKP A;  2EPZ A;  2MKN A;  2B9D A;  4TUG A;  4N4R B;  4NZV A;  2YRK A;  3IWD A;  5LMU E;  5AE1 A;  2R76 A;  4DV2 E;  1I94 E;  4BC7 A;  2EPA A;  4I8O A;  4JYA E;  1ZBQ A;  2F8B A;  1A1K A;  2UXD E;  2EP3 A;  3BGH A;  5DNY A;  2JXP A;  1X6H A;  3EQ1 A;  1PJT A;  1UHZ A;  4JI1 E;  4M30 A;  4LF5 E;  4X62 E;  2YU8 A;  2V83 A;  3IWC A;  2L8T A;  2UUA E;  2EOQ A;  2M9A A;  2JY9 A;  5IXM B;  1T38 A;  2K7I A;  4DR6 E;  1GTK A;  2EM0 A;  4Q28 A;  4YHH E;  1YUI A;  2YT4 A;  4OOG C;  1YFH A;  3H09 A;  3JAM C;  1STU A;  4DMI A;  2DGC A;  4DV1 E;  4LFC E;  2EPM X;  4BCA A;  1SR9 A;  2EL5 A;  2JYA A;  1X48 A;  1ZR9 A;  4KZS A;  3QG5 C;  4JV5 E;  4WXD A;  4YY3 E;  2WBU A;  4R2E A;  3VHT B;  3IWB A;  2L6M A;  1T39 A;  1F2I G;  3K6Q A;  1YZ9 A;  1NCS A;  3HPZ A;  2EMH A;  2V85 A;  2YRM A;  2DMY A;  4IJD A;  1TF3 A;  3ADJ A;  3TQM A;  1XMO E;  2M7Q A;  2EOE A;  4DV4 E;  2DLK A;  2ENA A;  5TSE A;  3BID A;  1XNQ E;  4ZYH A;  5ADZ A;  4GKK E;  5AC4 A;  2M4I A;  2LCE A;  4LF8 E;  2EMI A;  4P78 A;  4LF4 E;  3J7A G;  2EPL X;  4WPY A;  1GZ6 A;  2MDR A;  4GZN C;  5KL4 A;  4JI0 E;  4DR7 E;  2YU5 A;  3THN A;  3ADI A;  2L2M A;  2EMB A;  4Q35 B;  2LBS B;  1G2D C;  4F2J C;  2UUC E;  1N32 E;  5LMN E;  3DF6 A;  4DV0 E;  4P7D A;  2LO3 A;  5CFF E;  5IWA E;  2ELZ A;  3P1X A;  5KL3 A;  3VYY A;  3C4T A;  1JK2 A;  4B3M E;  4F9C B;  2V86 A;  4R2C A;  5A6B D;  2EMW A;  2RQL A;  1UIL A;  1O0W A;  2L2K B;  2LTR A;  4BHB A;  4DV6 E;  2HC5 A;  2JPA A;  4K0K E;  1FJG E;  1T4O A;  5KL6 A;  5AE2 A;  3KZY A;  2EOM A;  2EM5 A;  3HQ1 A;  2CSH A;  2VQE E;  4F9A B;  2Q8U A;  2EPR A;  1AH5 A;  5AC5 A;  2YTE A;  2GHF A;  2NAB A;  2EMX A;  1YYK A;  1X3C A;  1DI2 A;  2VQF E;  1X47 A;  4M0V A;  2EMF A;  4B3R E;  2EN1 A;  2H36 X;  1QNT A;  4WSG A;  2CT1 A;  2EN6 A;  2NUG A;  2EMZ A;  2V89 A;  1YUJ A;  4JI3 E;  2KOU A;  5IT9 C;  4NXM E;  2EOZ A;  2YTP A;  2IHR 1;  1X49 A;  4O24 A;  4WFT A;  2FGG A;  3ECR A;  4X8W A;  4X9J A;  2DRP A;  2E72 A;  2LV2 A;  5AE3 A;  3KZZ A;  4M9V C;  2B3T B;  2YTG A;  4O43 A;  1WHN A;  2EM3 A;  4DV5 E;  4NXN E;  2ADR A;  4JI7 E;  2UXC E;  3HTX A;  2EOJ A;  4DR4 E;  3HPS A;  1SFE A;  1YPN A;  4J8Z A;  2EMC A;  1EH6 A;  2YTO A;  4B3S E;  3ADL A;  2YTN A;  4HEI A;  3J80 C;  2JWO A;  3EPH A;  4M2Z A;  5A6A A;  2FV4 B;  3BF2 A;  2KON A;  4DUY E;  2EJ4 A;  1HNW E;  2GPI A;  1EKZ A;  2EE8 A;  2FTX B;  4BC9 A;  5A69 A;  4R2R A;  1PDA A;  5T6J A;  1T4L B;  4DKK A;  1T4N A;  2EOY A;  1J26 A;  4R2A A;  2ODR C;  2LMZ A;  1YYO A;  2EQ3 A;  5KL5 A;  2EOX A;  4IS1 C;  4F6N A;  1FKA E;  3EPK A;  1HR0 E;  4X66 E;  1L4S A;  2EWL A;  5LL6 R;  2JOB A;  2YSO A;  2EQ1 A;  4DR3 E;  1EH7 A;  1IBL E;  4DV3 E;  4JI5 E;  1TF6 A;  4LF7 E;  2EN4 A;  2N3G A;  2EOR A;  1P47 A;  1AAY A;  1RMD A;  2YSP A;  1A1L A;  3LML A;  3EPL A;  2LRS A;  1J5E E;  5BR8 E;  4O4K A;  4BBY A;  2EZ6 A;  2ENH A;  2WCC 3;  3HXL A;  2B7V A;  1N33 E;  5A6B A;  2LT7 A;  3BBG A;  4LF6 E;  4RH8 A;  4WYQ B;  4AQY E;  3F6G A;  1HNZ E;  4BHC A;  2JOX A;  4DR1 E;  5A6J A;  2N3H A;  4L5N C;  1MEY C;  2YZT A;  3OML A;  4TUI A;  1WRJ A;  5F3W A;  3RMP A;  3UK3 C;  1DGC A;  2UXB E;  1X6F A;  1GQE A;  2BB8 A;  3F6H A;  2EM6 A;  1IBK E;  4DUZ E;  1UBD C;  1DQ3 A;  2YWQ A;  2LJU A;  4ZYG A;  2B7T A;  1G2F C;  2RTX A;  5A2Q C;  2DB2 A;  4DR5 E;  2EOF A;  4R03 A;  2VF1 A;  2EPP A;  5FLX C;  1MGT A; 
#chains in the Genus database with same CATH homology
 2EMC A;  2EQ0 A;  2YTO A;  1UN6 B;  2YRM A;  2YTN A;  1A1I A;  2VRD A;  2J7J A;  4IJD A;  1TF3 A;  1A1J A;  2D9H A;  3EPH A;  2YTI A;  2EOE A;  2EPP A;  2DLK A;  2ENA A;  2EML A;  1BB8 A;  1X5W A;  4R2Q A;  2GLI A;  2I13 A;  2EM7 A;  2YTJ A;  2EL4 A;  1TN9 A;  1A1F A;  2LCE A;  5KL7 A;  2PRT A;  2EMI A;  2EJ4 A;  2EE8 A;  2EN7 A;  3EPJ A;  2YRH A;  3MHH C;  4GZN C;  5KL4 A;  1WJP A;  2EN2 A;  2LVH A;  2RSI A;  4R2R A;  2YU5 A;  2EOI A;  2EM2 A;  2EOY A;  5KL2 A;  4R2A A;  4R2S A;  2EMB A;  2EPX A;  4R2D A;  2EM9 A;  1G2D C;  2EQ3 A;  4F2J C;  5KL5 A;  1ZU1 A;  2EOX A;  4IS1 C;  2RPC A;  4F6N A;  3EPK A;  2EMA A;  2LO3 A;  4R2P A;  2WBS A;  2YTQ A;  2EOH A;  2ELZ A;  1LLM C;  5KL3 A;  2EPU A;  2YSO A;  2YTF A;  2CTD A;  2EMK A;  2EMG A;  2EQ1 A;  1YSA C;  1ZAA C;  4FK5 C;  2YTD A;  2EM8 A;  1JK2 A;  3M99 B;  2EPZ A;  2MKN A;  1TF6 A;  2EN4 A;  4R2C A;  2EOR A;  1P47 A;  1AAY A;  1RMD A;  2JP9 A;  2YSP A;  1A1L A;  2EMW A;  2YRK A;  3EPL A;  2EL6 A;  2MKD A;  2JPA A;  2EN3 A;  2HGH A;  2EOS A;  5KL6 A;  2EPA A;  2ENH A;  2WCC 3;  2EM4 A;  2EOM A;  2EM5 A;  2CSH A;  1A1G A;  2EPR A;  1A1K A;  1A1H A;  2R1F A;  2EP3 A;  2WBT A;  2EN8 A;  1X6H A;  2EPC A;  2YTE A;  2GHF A;  2NAB A;  2LT7 A;  2ELY A;  2EMY A;  2YU8 A;  2EMX A;  2A25 A;  3MHS C;  1X3C A;  2EOQ A;  2M9A A;  2EMF A;  2EN1 A;  1JK1 A;  4WSG A;  2CT1 A;  2EN6 A;  1MEY C;  2EMZ A;  1YUJ A;  1BBO A;  2EM0 A;  1YUI A;  2EOZ A;  2YTP A;  1Z1B A;  3UK3 C;  2ENC A;  1DGC A;  1X6F A;  4X9J A;  2DRP A;  2E72 A;  2LV2 A;  1X6E A;  2BB8 A;  2EOO A;  4M9V C;  2EM6 A;  2YTG A;  2DGC A;  2DMI A;  1UBD C;  2EM3 A;  1G2F C;  2EL5 A;  1ZR9 A;  2WBU A;  4R2E A;  2ADR A;  2DLQ A;  3VHT B;  1F2I G;  1B69 A;  2EOF A;  2EOJ A;  1NCS A;  4F6M A;  2MDG A;  1KJK A;  2EMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...