2EOHA

Solution structure of the c2h2 type zinc finger (region 780-812) of human zinc finger protein 28 homolog
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
GSSGSSGSGKKPYECKECRKTFIQIGHLNQHKRVHTGERSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 780-812) of human Zinc finger protein 28 homolog
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 28 homolog
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eohA00
2EMAA 2EJ4A 2MKNA 1G2FC 1ZR9A 2EL5A 4FK5C 1ZU1A 2M9AA 4R2SA 2EM8A 2D9HA 2ENAA 2EE8A 2J7JA 2EOSA 4IS1C 1DGCA 4R2PA 2WBTA 2EMBA 1JK2A 1WJPA 2YRMA 1TF3A 2WCC3 3EPHA 1A1FA 2EP3A 2EQ3A 2MDGA 5KL2A 2EM9A 5KL4A 4R2RA 2EMLA 1LLMC 1YSAC 2NABA 2EN4A 2YTJA 4F6MA 1X5WA 2YTIA 2LCEA 1G2DC 1F2IG 5KL3A 2EMHA 2EOFA 2EM5A 2JPAA 2EOHA 1X3CA 2EM6A 2YU5A 3VHTB 1ZAAC 4X9JA 2ENCA 2YTOA 1P47A 2CT1A 2ELYA 2EOQA 2CSHA 2EN8A 2EPCA 2DGCA 2EMZA 1A1JA 2EN7A 2LT7A 2WBSA 4R2AA 2YTEA 2EOXA 2YTDA 2JP9A 4R2DA 2E72A 4WSGA 2LVHA 2MKDA 1A1IA 1YUJA 1RMDA 2EM0A 2YTFA 3MHHC 2EL4A 2EMGA 2EMKA 2EPRA 1BBOA 3M99B 1A1HA 2DMIA 2EM7A 4GZNC 2YTNA 2LO3A 1X6EA 1X6FA 1TN9A 4R2QA 2EOZA 2HGHA 2EORA 2EOJA 2EL6A 2EOMA 1X6HA 2YSOA 2EMFA 2EN6A 4F6NA 1KJKA 2EN3A 1A1LA 2YTQA 2LV2A 2R1FA 2EOOA 5KL7A 1UN6B 1B69A 2YSPA 2RPCA 1BB8A 2EOIA 2EPXA 2EPPA 1UBDC 2BB8A 2DLKA 1MEYC 1NCSA 2YRHA 2DRPA 4IJDA 2EM4A 3MHSC 1A1KA 2YU8A 4R2EA 1TF6A 5KL6A 3UK3C 1AAYA 2EMWA 2RSIA 2EPUA 2EQ0A 2EN2A 2EM3A 2A25A 2GLIA 2YRKA 2ENHA 2PRTA 4F2JC 2YTGA 1YUIA 2EMYA 4M9VC 1A1GA 3EPJA 2EPAA 2I13A 2VRDA 2CTDA 2EPZA 2GHFA 2YTPA 1Z1BA 3EPKA 2EMCA 1JK1A 2EMIA 2EN1A 2EOEA 2EQ1A 4R2CA 2WBUA 2EM2A 2ELZA 2EMXA 5KL5A 2ADRA 3EPLA 2DLQA 2EOYA
chains in the Genus database with same CATH superfamily
3VYXA 4M0VA 3ZOQB 2EPKX 2M9AA 4DR6E 1IBKE 1L4SA 2EMBA 1WJPA 2YRMA 2JOBA 2KONA 1TF3A 4DV2E 2EPOA 5KL2A 2MDGA 4R2RA 2G7HA 4JI1E 2EWLA 4KWYA 2B3TB 5A2QC 1J26A 1X5WA 2DB2A 1AH5A 5KL3A 1F2IG 1HR0E 3THOB 2EOHA 1GZ6A 1T4OA 1ZAAC 4X9JA 4J8ZA 4WX9A 2ELYA 2M4IA 3BGHA 4TUIA 2EOQA 4X64E 1EH7A 2CSHA 2EN8A 2DGCA 1NEIA 4M30A 4JI7E 1DQ3A 2YTDA 4R2DA 1N3GA 4WSGA 2LVHA 4KHPE 2VQFE 4Q35B 4K0KE 2UXDE 2LBSB 2LTRA 3IWBA 3OTOE 3JU0A 1YZ9A 1BBOA 2DMIA 2JYAA 2LO3A 1X6EA 4F54A 3C6KA 2K4VA 1I94E 2UUAE 3ADIA 3RMPA 2EORA 1UILA 2NA2A 2EN6A 4F9AB 4BS9A 2N8XA 3JTZA 2R1FA 1B69A 2YSPA 2RPCA 5AE1A 1UBDC 2EPPA 4X8WA 1BB8A 1BBGA 1T38A 2LTSA 2M1SA 2RSIA 4LU9A 2GPIA 3T1YE 1RQ0A 1XNRE 5FLXC 2YRKA 2PRTA 2YTGA 4YHHE 2EZ6A 2LUPB 4I8OA 2V88A 4LF8E 1XMOE 2UU9E 4WXCA 2K7IA 2NUGA 2EMIA 2EOEA 2EQ1A 4R2CA 3EPLA 2ADRA 3K6QA 5IWAE 2L33A 1QNTA 4JI4E 4BBYA 3C4BA 3KWRA 2EL5A 1ZU1A 2E5LE 4R2SA 2ENAA 2MC6A 4R2PA 1IQSA 2L3CA 4LF5E 2B7VA 4DR2E 1T4LB 4LF7E 4OX9E 4R03A 2WCC3 1A1FA 4YY3E 1YYWA 2EMLA 4BHBA 1SFEA 4R8OA 1LLMC 3H09A 2YTJA 5TSEA 3L00A 4O4KA 2LE2A 3AUZA 1N34E 2JPAA 2UXBE 2EPNA 5DNYA 4JI0E 2YU5A 5IT9C 1J5EE 2ENCA 2N3GA 2CPNA 1N36E 4BCAA 1PDAA 2EN7A 3IWDA 1YPNA 3P1XA 4R2AA 2YTEA 4JI2E 5IV8B 4NZVA 2MKDA 4X66E 1A1IA 1YUJA 4LTYA 1O0WA 4WXDA 5AC4A 4DMIA 4ZYEA 2EMKA 2V85A 4B3TE 3M99B 2EM7A 3QG5C 1T4NA 3JAMC 1SR9A 2EL6A 4AQYE 4DR4E 4MLVA 1PKPA 2HJJA 1XNQE 2BBGA 2EOOA 2FGGA 1UN6B 2M7QA 1RC7A 4GEQB 3AV0A 2BB8A 1NCSA 2RQLA 3EQ1A 4Q28A 4MLQA 3J81C 2UXCE 2EMWA 2JVAA 4GKKE 2EPUA 1DI2A 2EQ0A 5AE3A 4F9BB 2EN2A 4WYQB 2VQEE 2GLIA 2L8TA 2ENHA 3C4TA 4F2JC 2KOUA 2MC5A 1YUIA 4DR1E 3EPJA 2EPAA 1A1GA 3ADGA 3LLHA 2YT4A 3ECRA 4RH8A 2EPZA 4O24A 4X62E 3EPKA 2EMCA 2EM2A 2ELZA 1GTKA 5A6KA 2EOYA 3THNA 1PJQA 4WSPA 3ADJA 4BC7A 2MKNA 2VF1A 1G2FC 3LMLA 4FK5C 4BC9A 4RHBB 2D9HA 1UHZA 4JI3E 2J7JA 1HNWE 4IS1C 2L6MA 2B9DA 2YWQA 4OOGC 2EP3A 4ZYHA 2EM9A 4O43A 5F3WA 4NXNE 2NABA 1FJGE 4L8NA 2F8BA 2EMHA 1ZBQA 3F6GA 4KZSA 1QU6A 3HPSA 2EM6A 3VHTB 2YTOA 2LJUA 1HNZE 1ZBTA 1P47A 2EPLX 2V86A 5T6JA 4BMJA 3BF2A 4JV5E 2YPNA 4JI6E 3TQMA 3VK6A 2EPCA 2EMZA 1IBLE 4NHRA 4DV1E 2RSMA 3J80C 2EOXA 2ODRD 4F9CB 2JOXA 4LFBE 5A6BD 2RS7A 2DSYA 4B3RE 1RMDA 2EM0A 5LL6R 3MHHC 2EL4A 3BIDA 2FV4B 5AASA 2RTXA 3KZYA 2YTNA 4TUGA 4L5NC 4BHCA 1TN9A 1X48A 2V83A 4JI5E 2EOZA 2EOJA 3HPZA 5LLQA 2EOMA 2EMFA 4F6NA 1KJKA 2EN3A 1EH6A 1A1LA 4LFCE 4P7DA 4DKKA 5AE2A 1IQOA 2EPXA 2V8QB 2N3HA 2MDRA 2YRHA 4DUZE 2EM4A 2LRSA 3MHSC 1A1KA 1WHNA 3MSWA 1TF6A 4LFAE 1AAYA 2HHHE 1N33E 1IBME 3HQ1A 2L92A 5AC5A 2A25A 4JI8E 1FKAE 2NUEA 1GQEA 2L2MA 2EMYA 4DR3E 4M9VC 4DV7E 2FTXB 1KYQA 2JXPA 2UUBE 2IHR1 2LUQA 3VYYA 4M2ZA 4ZYDA 5LMNE 1JK1A 2EN1A 2WBUA 5KL5A 2B7TA 1STUA 4LF4E 4DV3E 3HTXA 4WPYA 2EMAA 2HC5A 2EJ4A 1YFHA 4O5GA 5BR8E 1ZR9A 2F4VE 2EM8A 2EE8A 2EOSA 1DGCA 2JWOA 2WBTA 1JK2A 2WZOA 3EPHA 2EQ3A 3T1HE 5KL4A 3BBGA 1MGTA 1YSAC 2EN4A 1X49A 4F6MA 4LF9E 1G2DC 2YTIA 2LCEA 2EOFA 2EM5A 2Q8UA 1X3CA 2V89A 4HTGA 4WFTA 5A6JA 3HXLA 2NUFA 1X47A 4DV0E 2CT1A 2UUCE 4P78A 1A1JA 5A69A 4B3ME 2ZM6E 2LT7A 1EKZA 2WBSA 2LMZA 2JP9A 2E72A 4X65E 2EPMX 2L3JA 1T39A 4JYAE 2E1MA 3KZZA 2V87A 1YYOA 2KHXA 2L2KB 2YTFA 2DIXA 5A6BA 3ADLA 5IXMB 2EMGA 3OMLA 2EPRA 1PJTA 1A1HA 4DV5E 2LJHA 4DR5E 4GZNC 1X6FA 2L2NA 4R2QA 5A6AA 2HGHA 4LF6E 3DF6A 4DV4E 1X6HA 2YSOA 1YYKA 1PJSA 4DV6E 2YTQA 2ODRC 2LV2A 5KL7A 4N4RB 1N32E 1HNXE 2EOIA 2H36X 5CFFE 2YZTA 1MEYC 2DLKA 2VE7C 2DRPA 4NXME 4IJDA 4R2EA 2YU8A 4GKJE 5KL6A 1WHQA 1WRJA 4HEIA 2I9IA 3UK3C 1WXRA 3F6HA 3J7AG 5LMUE 3FIGA 2RS6A 2EM3A 3C6MA 3J7Yp 3DJWA 1EH8A 4ZYGA 2I13A 2R76A 2VRDA 2CTDA 4DR7E 2JY9A 1IMUA 5ADZA 2GHFA 2JR1A 2YTPA 4DUYE 1Z1BA 1XMQE 4B3SE 2EMXA 3IWCA 2DLQA 2DMYA
chains in the Genus database with same CATH topology
2EMAA 2EJ4A 2MKNA 1G2FC 1ZR9A 2EL5A 4FK5C 1ZU1A 2M9AA 4R2SA 2EM8A 2D9HA 2ENAA 2EE8A 2J7JA 2EOSA 4IS1C 1DGCA 4R2PA 2WBTA 2EMBA 1JK2A 1WJPA 2YRMA 1TF3A 2WCC3 3EPHA 1A1FA 2EP3A 2EQ3A 2MDGA 5KL2A 2EM9A 5KL4A 4R2RA 2EMLA 1LLMC 1YSAC 2NABA 2EN4A 2YTJA 4F6MA 1X5WA 2YTIA 2LCEA 1G2DC 1F2IG 5KL3A 2EMHA 2EOFA 2EM5A 2JPAA 2EOHA 1X3CA 2EM6A 2YU5A 3VHTB 1ZAAC 4X9JA 2ENCA 2YTOA 1P47A 2CT1A 2ELYA 2EOQA 2CSHA 2EN8A 2EPCA 2DGCA 2EMZA 1A1JA 2EN7A 2LT7A 2WBSA 4R2AA 2YTEA 2EOXA 2YTDA 2JP9A 4R2DA 2E72A 4WSGA 2LVHA 2MKDA 1A1IA 1YUJA 1RMDA 2EM0A 2YTFA 3MHHC 2EL4A 2EMGA 2EMKA 2EPRA 1BBOA 3M99B 1A1HA 2DMIA 2EM7A 4GZNC 2YTNA 2LO3A 1X6EA 1X6FA 1TN9A 4R2QA 2EOZA 2HGHA 2EORA 2EOJA 2EL6A 2EOMA 1X6HA 2YSOA 2EMFA 2EN6A 4F6NA 1KJKA 2EN3A 1A1LA 2YTQA 2LV2A 2R1FA 2EOOA 5KL7A 1UN6B 1B69A 2YSPA 2RPCA 1BB8A 2EOIA 2EPXA 2EPPA 1UBDC 2BB8A 2DLKA 1MEYC 1NCSA 2YRHA 2DRPA 4IJDA 2EM4A 3MHSC 1A1KA 2YU8A 4R2EA 1TF6A 5KL6A 3UK3C 1AAYA 2EMWA 2RSIA 2EPUA 2EQ0A 2EN2A 2EM3A 2A25A 2GLIA 2YRKA 2ENHA 2PRTA 4F2JC 2YTGA 1YUIA 2EMYA 4M9VC 1A1GA 3EPJA 2EPAA 2I13A 2VRDA 2CTDA 2EPZA 2GHFA 2YTPA 1Z1BA 3EPKA 2EMCA 1JK1A 2EMIA 2EN1A 2EOEA 2EQ1A 4R2CA 2WBUA 2EM2A 2ELZA 2EMXA 5KL5A 2ADRA 3EPLA 2DLQA 2EOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMA A;  2EJ4 A;  2MKN A;  1G2F C;  1ZR9 A;  2EL5 A;  4FK5 C;  1ZU1 A;  2M9A A;  4R2S A;  2EM8 A;  2D9H A;  2ENA A;  2EE8 A;  2J7J A;  2EOS A;  4IS1 C;  1DGC A;  4R2P A;  2WBT A;  2EMB A;  1JK2 A;  1WJP A;  2YRM A;  1TF3 A;  2WCC 3;  3EPH A;  1A1F A;  2EP3 A;  2EQ3 A;  2MDG A;  5KL2 A;  2EM9 A;  5KL4 A;  4R2R A;  2EML A;  1LLM C;  1YSA C;  2NAB A;  2EN4 A;  2YTJ A;  4F6M A;  1X5W A;  2YTI A;  2LCE A;  1G2D C;  1F2I G;  5KL3 A;  2EMH A;  2EOF A;  2EM5 A;  2JPA A;  2EOH A;  1X3C A;  2EM6 A;  2YU5 A;  3VHT B;  1ZAA C;  4X9J A;  2ENC A;  2YTO A;  1P47 A;  2CT1 A;  2ELY A;  2EOQ A;  2CSH A;  2EN8 A;  2EPC A;  2DGC A;  2EMZ A;  1A1J A;  2EN7 A;  2LT7 A;  2WBS A;  4R2A A;  2YTE A;  2EOX A;  2YTD A;  2JP9 A;  4R2D A;  2E72 A;  4WSG A;  2LVH A;  2MKD A;  1A1I A;  1YUJ A;  1RMD A;  2EM0 A;  2YTF A;  3MHH C;  2EL4 A;  2EMG A;  2EMK A;  2EPR A;  1BBO A;  3M99 B;  1A1H A;  2DMI A;  2EM7 A;  4GZN C;  2YTN A;  2LO3 A;  1X6E A;  1X6F A;  1TN9 A;  4R2Q A;  2EOZ A;  2HGH A;  2EOR A;  2EOJ A;  2EL6 A;  2EOM A;  1X6H A;  2YSO A;  2EMF A;  2EN6 A;  4F6N A;  1KJK A;  2EN3 A;  1A1L A;  2YTQ A;  2LV2 A;  2R1F A;  2EOO A;  5KL7 A;  1UN6 B;  1B69 A;  2YSP A;  2RPC A;  1BB8 A;  2EOI A;  2EPX A;  2EPP A;  1UBD C;  2BB8 A;  2DLK A;  1MEY C;  1NCS A;  2YRH A;  2DRP A;  4IJD A;  2EM4 A;  3MHS C;  1A1K A;  2YU8 A;  4R2E A;  1TF6 A;  5KL6 A;  3UK3 C;  1AAY A;  2EMW A;  2RSI A;  2EPU A;  2EQ0 A;  2EN2 A;  2EM3 A;  2A25 A;  2GLI A;  2YRK A;  2ENH A;  2PRT A;  4F2J C;  2YTG A;  1YUI A;  2EMY A;  4M9V C;  1A1G A;  3EPJ A;  2EPA A;  2I13 A;  2VRD A;  2CTD A;  2EPZ A;  2GHF A;  2YTP A;  1Z1B A;  3EPK A;  2EMC A;  1JK1 A;  2EMI A;  2EN1 A;  2EOE A;  2EQ1 A;  4R2C A;  2WBU A;  2EM2 A;  2ELZ A;  2EMX A;  5KL5 A;  2ADR A;  3EPL A;  2DLQ A;  2EOY A; 
#chains in the Genus database with same CATH topology
 3VYX A;  4M0V A;  3ZOQ B;  2EPK X;  2M9A A;  4DR6 E;  1IBK E;  1L4S A;  2EMB A;  1WJP A;  2YRM A;  2JOB A;  2KON A;  1TF3 A;  4DV2 E;  2EPO A;  5KL2 A;  2MDG A;  4R2R A;  2G7H A;  4JI1 E;  2EWL A;  4KWY A;  2B3T B;  5A2Q C;  1J26 A;  1X5W A;  2DB2 A;  1AH5 A;  5KL3 A;  1F2I G;  1HR0 E;  3THO B;  2EOH A;  1GZ6 A;  1T4O A;  1ZAA C;  4X9J A;  4J8Z A;  4WX9 A;  2ELY A;  2M4I A;  3BGH A;  4TUI A;  2EOQ A;  4X64 E;  1EH7 A;  2CSH A;  2EN8 A;  2DGC A;  1NEI A;  4M30 A;  4JI7 E;  1DQ3 A;  2YTD A;  4R2D A;  1N3G A;  4WSG A;  2LVH A;  4KHP E;  2VQF E;  4Q35 B;  4K0K E;  2UXD E;  2LBS B;  2LTR A;  3IWB A;  3OTO E;  3JU0 A;  1YZ9 A;  1BBO A;  2DMI A;  2JYA A;  2LO3 A;  1X6E A;  4F54 A;  3C6K A;  2K4V A;  1I94 E;  2UUA E;  3ADI A;  3RMP A;  2EOR A;  1UIL A;  2NA2 A;  2EN6 A;  4F9A B;  4BS9 A;  2N8X A;  3JTZ A;  2R1F A;  1B69 A;  2YSP A;  2RPC A;  5AE1 A;  1UBD C;  2EPP A;  4X8W A;  1BB8 A;  1BBG A;  1T38 A;  2LTS A;  2M1S A;  2RSI A;  4LU9 A;  2GPI A;  3T1Y E;  1RQ0 A;  1XNR E;  5FLX C;  2YRK A;  2PRT A;  2YTG A;  4YHH E;  2EZ6 A;  2LUP B;  4I8O A;  2V88 A;  4LF8 E;  1XMO E;  2UU9 E;  4WXC A;  2K7I A;  2NUG A;  2EMI A;  2EOE A;  2EQ1 A;  4R2C A;  3EPL A;  2ADR A;  3K6Q A;  5IWA E;  2L33 A;  1QNT A;  4JI4 E;  4BBY A;  3C4B A;  3KWR A;  2EL5 A;  1ZU1 A;  2E5L E;  4R2S A;  2ENA A;  2MC6 A;  4R2P A;  1IQS A;  2L3C A;  4LF5 E;  2B7V A;  4DR2 E;  1T4L B;  4LF7 E;  4OX9 E;  4R03 A;  2WCC 3;  1A1F A;  4YY3 E;  1YYW A;  2EML A;  4BHB A;  1SFE A;  4R8O A;  1LLM C;  3H09 A;  2YTJ A;  5TSE A;  3L00 A;  4O4K A;  2LE2 A;  3AUZ A;  1N34 E;  2JPA A;  2UXB E;  2EPN A;  5DNY A;  4JI0 E;  2YU5 A;  5IT9 C;  1J5E E;  2ENC A;  2N3G A;  2CPN A;  1N36 E;  4BCA A;  1PDA A;  2EN7 A;  3IWD A;  1YPN A;  3P1X A;  4R2A A;  2YTE A;  4JI2 E;  5IV8 B;  4NZV A;  2MKD A;  4X66 E;  1A1I A;  1YUJ A;  4LTY A;  1O0W A;  4WXD A;  5AC4 A;  4DMI A;  4ZYE A;  2EMK A;  2V85 A;  4B3T E;  3M99 B;  2EM7 A;  3QG5 C;  1T4N A;  3JAM C;  1SR9 A;  2EL6 A;  4AQY E;  4DR4 E;  4MLV A;  1PKP A;  2HJJ A;  1XNQ E;  2BBG A;  2EOO A;  2FGG A;  1UN6 B;  2M7Q A;  1RC7 A;  4GEQ B;  3AV0 A;  2BB8 A;  1NCS A;  2RQL A;  3EQ1 A;  4Q28 A;  4MLQ A;  3J81 C;  2UXC E;  2EMW A;  2JVA A;  4GKK E;  2EPU A;  1DI2 A;  2EQ0 A;  5AE3 A;  4F9B B;  2EN2 A;  4WYQ B;  2VQE E;  2GLI A;  2L8T A;  2ENH A;  3C4T A;  4F2J C;  2KOU A;  2MC5 A;  1YUI A;  4DR1 E;  3EPJ A;  2EPA A;  1A1G A;  3ADG A;  3LLH A;  2YT4 A;  3ECR A;  4RH8 A;  2EPZ A;  4O24 A;  4X62 E;  3EPK A;  2EMC A;  2EM2 A;  2ELZ A;  1GTK A;  5A6K A;  2EOY A;  3THN A;  1PJQ A;  4WSP A;  3ADJ A;  4BC7 A;  2MKN A;  2VF1 A;  1G2F C;  3LML A;  4FK5 C;  4BC9 A;  4RHB B;  2D9H A;  1UHZ A;  4JI3 E;  2J7J A;  1HNW E;  4IS1 C;  2L6M A;  2B9D A;  2YWQ A;  4OOG C;  2EP3 A;  4ZYH A;  2EM9 A;  4O43 A;  5F3W A;  4NXN E;  2NAB A;  1FJG E;  4L8N A;  2F8B A;  2EMH A;  1ZBQ A;  3F6G A;  4KZS A;  1QU6 A;  3HPS A;  2EM6 A;  3VHT B;  2YTO A;  2LJU A;  1HNZ E;  1ZBT A;  1P47 A;  2EPL X;  2V86 A;  5T6J A;  4BMJ A;  3BF2 A;  4JV5 E;  2YPN A;  4JI6 E;  3TQM A;  3VK6 A;  2EPC A;  2EMZ A;  1IBL E;  4NHR A;  4DV1 E;  2RSM A;  3J80 C;  2EOX A;  2ODR D;  4F9C B;  2JOX A;  4LFB E;  5A6B D;  2RS7 A;  2DSY A;  4B3R E;  1RMD A;  2EM0 A;  5LL6 R;  3MHH C;  2EL4 A;  3BID A;  2FV4 B;  5AAS A;  2RTX A;  3KZY A;  2YTN A;  4TUG A;  4L5N C;  4BHC A;  1TN9 A;  1X48 A;  2V83 A;  4JI5 E;  2EOZ A;  2EOJ A;  3HPZ A;  5LLQ A;  2EOM A;  2EMF A;  4F6N A;  1KJK A;  2EN3 A;  1EH6 A;  1A1L A;  4LFC E;  4P7D A;  4DKK A;  5AE2 A;  1IQO A;  2EPX A;  2V8Q B;  2N3H A;  2MDR A;  2YRH A;  4DUZ E;  2EM4 A;  2LRS A;  3MHS C;  1A1K A;  1WHN A;  3MSW A;  1TF6 A;  4LFA E;  1AAY A;  2HHH E;  1N33 E;  1IBM E;  3HQ1 A;  2L92 A;  5AC5 A;  2A25 A;  4JI8 E;  1FKA E;  2NUE A;  1GQE A;  2L2M A;  2EMY A;  4DR3 E;  4M9V C;  4DV7 E;  2FTX B;  1KYQ A;  2JXP A;  2UUB E;  2IHR 1;  2LUQ A;  3VYY A;  4M2Z A;  4ZYD A;  5LMN E;  1JK1 A;  2EN1 A;  2WBU A;  5KL5 A;  2B7T A;  1STU A;  4LF4 E;  4DV3 E;  3HTX A;  4WPY A;  2EMA A;  2HC5 A;  2EJ4 A;  1YFH A;  4O5G A;  5BR8 E;  1ZR9 A;  2F4V E;  2EM8 A;  2EE8 A;  2EOS A;  1DGC A;  2JWO A;  2WBT A;  1JK2 A;  2WZO A;  3EPH A;  2EQ3 A;  3T1H E;  5KL4 A;  3BBG A;  1MGT A;  1YSA C;  2EN4 A;  1X49 A;  4F6M A;  4LF9 E;  1G2D C;  2YTI A;  2LCE A;  2EOF A;  2EM5 A;  2Q8U A;  1X3C A;  2V89 A;  4HTG A;  4WFT A;  5A6J A;  3HXL A;  2NUF A;  1X47 A;  4DV0 E;  2CT1 A;  2UUC E;  4P78 A;  1A1J A;  5A69 A;  4B3M E;  2ZM6 E;  2LT7 A;  1EKZ A;  2WBS A;  2LMZ A;  2JP9 A;  2E72 A;  4X65 E;  2EPM X;  2L3J A;  1T39 A;  4JYA E;  2E1M A;  3KZZ A;  2V87 A;  1YYO A;  2KHX A;  2L2K B;  2YTF A;  2DIX A;  5A6B A;  3ADL A;  5IXM B;  2EMG A;  3OML A;  2EPR A;  1PJT A;  1A1H A;  4DV5 E;  2LJH A;  4DR5 E;  4GZN C;  1X6F A;  2L2N A;  4R2Q A;  5A6A A;  2HGH A;  4LF6 E;  3DF6 A;  4DV4 E;  1X6H A;  2YSO A;  1YYK A;  1PJS A;  4DV6 E;  2YTQ A;  2ODR C;  2LV2 A;  5KL7 A;  4N4R B;  1N32 E;  1HNX E;  2EOI A;  2H36 X;  5CFF E;  2YZT A;  1MEY C;  2DLK A;  2VE7 C;  2DRP A;  4NXM E;  4IJD A;  4R2E A;  2YU8 A;  4GKJ E;  5KL6 A;  1WHQ A;  1WRJ A;  4HEI A;  2I9I A;  3UK3 C;  1WXR A;  3F6H A;  3J7A G;  5LMU E;  3FIG A;  2RS6 A;  2EM3 A;  3C6M A;  3J7Y p;  3DJW A;  1EH8 A;  4ZYG A;  2I13 A;  2R76 A;  2VRD A;  2CTD A;  4DR7 E;  2JY9 A;  1IMU A;  5ADZ A;  2GHF A;  2JR1 A;  2YTP A;  4DUY E;  1Z1B A;  1XMQ E;  4B3S E;  2EMX A;  3IWC A;  2DLQ A;  2DMY A; 
#chains in the Genus database with same CATH homology
 2EMA A;  2EJ4 A;  2MKN A;  1G2F C;  1ZR9 A;  2EL5 A;  4FK5 C;  1ZU1 A;  2M9A A;  4R2S A;  2EM8 A;  2D9H A;  2ENA A;  2EE8 A;  2J7J A;  2EOS A;  4IS1 C;  1DGC A;  4R2P A;  2WBT A;  2EMB A;  1JK2 A;  1WJP A;  2YRM A;  1TF3 A;  2WCC 3;  3EPH A;  1A1F A;  2EP3 A;  2EQ3 A;  2MDG A;  5KL2 A;  2EM9 A;  5KL4 A;  4R2R A;  2EML A;  1LLM C;  1YSA C;  2NAB A;  2EN4 A;  2YTJ A;  4F6M A;  1X5W A;  2YTI A;  2LCE A;  1G2D C;  1F2I G;  5KL3 A;  2EMH A;  2EOF A;  2EM5 A;  2JPA A;  2EOH A;  1X3C A;  2EM6 A;  2YU5 A;  3VHT B;  1ZAA C;  4X9J A;  2ENC A;  2YTO A;  1P47 A;  2CT1 A;  2ELY A;  2EOQ A;  2CSH A;  2EN8 A;  2EPC A;  2DGC A;  2EMZ A;  1A1J A;  2EN7 A;  2LT7 A;  2WBS A;  4R2A A;  2YTE A;  2EOX A;  2YTD A;  2JP9 A;  4R2D A;  2E72 A;  4WSG A;  2LVH A;  2MKD A;  1A1I A;  1YUJ A;  1RMD A;  2EM0 A;  2YTF A;  3MHH C;  2EL4 A;  2EMG A;  2EMK A;  2EPR A;  1BBO A;  3M99 B;  1A1H A;  2DMI A;  2EM7 A;  4GZN C;  2YTN A;  2LO3 A;  1X6E A;  1X6F A;  1TN9 A;  4R2Q A;  2EOZ A;  2HGH A;  2EOR A;  2EOJ A;  2EL6 A;  2EOM A;  1X6H A;  2YSO A;  2EMF A;  2EN6 A;  4F6N A;  1KJK A;  2EN3 A;  1A1L A;  2YTQ A;  2LV2 A;  2R1F A;  2EOO A;  5KL7 A;  1UN6 B;  1B69 A;  2YSP A;  2RPC A;  1BB8 A;  2EOI A;  2EPX A;  2EPP A;  1UBD C;  2BB8 A;  2DLK A;  1MEY C;  1NCS A;  2YRH A;  2DRP A;  4IJD A;  2EM4 A;  3MHS C;  1A1K A;  2YU8 A;  4R2E A;  1TF6 A;  5KL6 A;  3UK3 C;  1AAY A;  2EMW A;  2RSI A;  2EPU A;  2EQ0 A;  2EN2 A;  2EM3 A;  2A25 A;  2GLI A;  2YRK A;  2ENH A;  2PRT A;  4F2J C;  2YTG A;  1YUI A;  2EMY A;  4M9V C;  1A1G A;  3EPJ A;  2EPA A;  2I13 A;  2VRD A;  2CTD A;  2EPZ A;  2GHF A;  2YTP A;  1Z1B A;  3EPK A;  2EMC A;  1JK1 A;  2EMI A;  2EN1 A;  2EOE A;  2EQ1 A;  4R2C A;  2WBU A;  2EM2 A;  2ELZ A;  2EMX A;  5KL5 A;  2ADR A;  3EPL A;  2DLQ A;  2EOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...