2EOHA

Solution structure of the c2h2 type zinc finger (region 780-812) of human zinc finger protein 28 homolog
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
GSSGSSGSGKKPYECKECRKTFIQIGHLNQHKRVHTGERSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 28 homolog
publication title Solution structure of the C2H2 type zinc finger (region 780-812) of human Zinc finger protein 28 homolog
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eohA00
2R1FA 2EL5A 2CSHA 1BB8A 2EMAA 1A1LA 2EM0A 2EM8A 2EORA 2YTQA 3UK3C 2YTFA 2EPPA 2YTOA 2DLQA 2EMWA 3VHTB 2EQ0A 1NCSA 2GLIA 2GHFA 3EPJA 2EMBA 2EOXA 2EJ4A 2EN1A 4GZNC 4X9JA 2EMHA 2MKDA 2EM6A 2YRKA 4R2CA 2LCEA 1B69A 2WCC3 2EN3A 1X5WA 2EM2A 2YTPA 2YRHA 2EMFA 4R2QA 2EMLA 2EM4A 4M9VC 1UN6B 2LV2A 2EMKA 2EOQA 1Z1BA 1RMDA 2WBUA 2CT1A 1DGCA 1P47A 2LVHA 1UBDC 2ADRA 5KL2A 5KL3A 1LLMC 1JK2A 1KJKA 2ENAA 2DGCA 2EMCA 2YTIA 2BB8A 1TF3A 2EM5A 1X6EA 2EOEA 2EOJA 2YTDA 2EM3A 2ENCA 2MKNA 2YTJA 1YUJA 1TN9A 2EPXA 2EMYA 2EOSA 2EOFA 4F2JC 1ZR9A 2EM9A 2M9AA 2RSIA 2EOHA 3MHSC 2DLKA 2CTDA 5KL5A 1MEYC 2EN6A 2EPCA 2YSPA 2EN7A 1X6FA 2A25A 1X3CA 2HGHA 2RPCA 1YSAC 2EPUA 2EOIA 2EN4A 1BBOA 2EN8A 4R2EA 4R2PA 2DRPA 2EM7A 2EMIA 2WBSA 1G2DC 3EPHA 1AAYA 1X6HA 2EP3A 1JK1A 2MDGA 4F6MA 2EPRA 4R2RA 2EQ3A 1WJPA 3EPLA 1A1KA 2EPZA 1A1GA 1ZU1A 2EPAA 2WBTA 4R2DA 3EPKA 2ENHA 2PRTA 2EOMA 2DMIA 2EOZA 2NABA 4IS1C 2D9HA 1A1IA 2EE8A 2EOYA 2EOOA 5KL4A 2EMZA 2J7JA 2ELYA 2ELZA 2LT7A 3M99B 2E72A 2EMGA 4R2SA 5KL6A 4F6NA 2I13A 2YTGA 3MHHC 1A1FA 4R2AA 2YRMA 2EN2A 1A1HA 4FK5C 2YU8A 2YTNA 5KL7A 2EMXA 1YUIA 2EL4A 2EL6A 1ZAAC 2EQ1A 2LO3A 2YU5A 1A1JA 4WSGA 2JPAA 1G2FC 2JP9A 2YTEA 1F2IG 2YSOA 2VRDA 4IJDA 1TF6A
chains in the Genus database with same CATH superfamily
4WSPA 1BB8A 2EMAA 4P7DA 2UXBE 3UK3C 2HJJA 1YZ9A 2Q8UA 1T38A 2EPPA 1PDAA 2YWQA 3TQMA 2UU9E 2EQ0A 1NCSA 4HEIA 1T4NA 2EMBA 1FKAE 2EN1A 1XMQE 2ODRC 2EM6A 5ADZA 2WCC3 2EM2A 4B3RE 4LTYA 3BBGA 4WFTA 1QU6A 4R2QA 4LF4E 2EMLA 1WHQA 2G7HA 2EOQA 4I8OA 2NUFA 2EPNA 4DV1E 2WBUA 3C6KA 1HNZE 3JU0A 5KL3A 2YTIA 2EM5A 2MC6A 1X6EA 2EM3A 2E5LE 2YTJA 2ZM6E 2EMYA 2EOFA 4F2JC 4DR1E 2EM9A 1SR9A 2HC5A 3K6QA 4F9AB 2HHHE 2LRSA 1QNTA 2V8QB 4WPYA 2FTXB 4WX9A 5A6KA 1X6FA 4MLVA 2EWLA 2EN4A 3ZOQB 4R2PA 2DB2A 5LMUE 2M7QA 2B9DA 2EMIA 2WBSA 3EPHA 4GKKE 4O43A 5F3WA 4F6MA 4M0VA 2JOXA 2EPRA 5CFFE 2LTSA 4DKKA 3EPLA 3ADJA 1A1KA 2EPZA 4JI4E 4DR4E 4YHHE 2EPAA 3JAMC 4LF5E 4IS1C 1A1IA 1DQ3A 1UHZA 3ADLA 3P1XA 2YTGA 2EN2A 4TUIA 2UUCE 4FK5C 4O4KA 2YU8A 3AUZA 1YUIA 2L33A 2FV4B 1IBKE 4HTGA 2JPAA 2RS7A 2JP9A 3HPSA 3MSWA 4JI1E 1A1JA 3C4TA 3DF6A 2EL5A 2CSHA 1A1LA 2EM0A 1YYWA 2YTQA 4DV3E 2YTFA 3VYYA 1HR0E 2H36X 2GPIA 2YTOA 1WHNA 3H09A 2YPNA 2L8TA 1YFHA 4DV4E 2GLIA 3EPJA 2EOXA 4DV5E 1GTKA 4WXCA 4X64E 4GZNC 4X9JA 4R03A 2YRKA 4R2CA 2VQEE 2EN3A 1N32E 1MGTA 1N33E 2WZOA 4WYQB 2NA2A 2B7VA 2EMFA 5A6BD 3ADIA 1PKPA 4M30A 1YYKA 1UN6B 5BR8E 4ZYEA 3C6MA 1RMDA 1DI2A 2DSYA 2CT1A 1DGCA 2RSMA 2LVHA 3IWDA 2ADRA 5KL2A 2KHXA 2V87A 1XMOE 1ZBTA 2F4VE 2ENAA 2EMCA 1TF3A 2JY9A 2UXDE 2YTDA 4KZSA 2ENCA 2E1MA 1YUJA 4ZYGA 1AH5A 4TUGA 1O0WA 2LE2A 2M1SA 2EZ6A 5DNYA 3THNA 5TSEA 5KL5A 2CTDA 4LF6E 2R76A 2YSPA 1L4SA 3BGHA 4O5GA 3JTZA 1X3CA 2EPOA 1WRJA 1YSAC 4N4RB 2EPUA 1PJSA 3FIGA 2EM7A 4JV5E 2KOUA 1AAYA 2V85A 4KHPE 1WJPA 2L92A 2JXPA 1A1GA 4NZVA 1IQOA 2DMIA 4J8ZA 5IT9C 3DJWA 2D9HA 4KWYA 2L2MA 1RC7A 2B3TB 2J7JA 3ECRA 4ZYDA 4BC9A 4DV6E 4NXNE 4RH8A 2L6MA 3HTXA 4BMJA 5IXMB 3LMLA 5KL6A 2RQLA 4F6NA 3MHHC 1A1FA 2YRMA 4B3SE 3HPZA 4LFBE 2EPLX 2IHR1 2VF1A 2YTNA 2B7TA 3VYXA 1ZBQA 2EQ1A 2LO3A 2YU5A 4BHCA 4LF8E 5LL6R 4O24A 4OX9E 2YTEA 2YSOA 2VRDA 3T1YE 1TF6A 2UXCE 1N36E 1X48A 2EM8A 4JI8E 5AE3A 4DUYE 5AASA 4X66E 1EKZA 3VHTB 4GEQB 4JI0E 4LU9A 1UILA 3QG5C 2UUAE 3AV0A 2LCEA 1B69A 2JR1A 4BS9A 1X47A 4DMIA 2V89A 2NUEA 1IMUA 2YTPA 3ADGA 3LLHA 2ODRD 2YRHA 3KZYA 4M9VC 5A69A 2UUBE 2EMKA 1Z1BA 2MC5A 2VQFE 1P47A 1KYQA 1IBME 1LLMC 4DR2E 4NXME 4X62E 2DGCA 2BB8A 2N3HA 2LTRA 2EOEA 4MLQA 1N34E 4BCAA 3HQ1A 1EH8A 1TN9A 2CPNA 2EOSA 4JI2E 4YY3E 1ZR9A 2RSIA 2EOHA 3MHSC 5LLQA 4JI5E 4GKJE 2EN6A 2EPCA 2RTXA 4Q35B 1T39A 4DV2E 2MDRA 2A25A 2HGHA 2LUPB 2RPCA 5IWAE 3F6GA 3BF2A 4R8OA 4F9CB 4R2EA 2DIXA 2BBGA 1G2DC 2N3GA 2EP3A 2MDGA 1STUA 3VK6A 1GQEA 4BC7A 1T4OA 2YZTA 4R2DA 2PRTA 4DR3E 2EOMA 2DMYA 4DV7E 1N3GA 1IQSA 2EE8A 5KL4A 2EMZA 2ELYA 3M99B 4P78A 2JYAA 2E72A 1J5EE 4R2AA 2NUGA 4K0KE 2N8XA 4JI7E 4LFAE 5KL7A 5LMNE 2EMXA 2FGGA 4X8WA 2EL4A 3C4BA 1ZAAC 2YT4A 3BIDA 4RHBB 4WSGA 1G2FC 1XNRE 5T6JA 3KZZA 4F9BB 2R1FA 4JI6E 4JI3E 2EORA 4WXDA 5A2QC 2L3CA 1XNQE 4F54A 4DR6E 2EPMX 2K4VA 2RS6A 2DLQA 2EMWA 2JVAA 3T1HE 2GHFA 2L2NA 5A6JA 2EJ4A 3OTOE 2EMHA 2MKDA 1NEIA 5AC4A 1HNWE 4LF9E 1X5WA 3OMLA 4M2ZA 1PJTA 3J7AG 4ZYHA 2KONA 3THOB 2EM4A 5FLXC 3J81C 2LV2A 2V83A 3RMPA 2M4IA 1BBGA 2V88A 3IWBA 4B3ME 1PJQA 1UBDC 1EH7A 4LF7E 1JK2A 5A6BA 1KJKA 3L00A 1RQ0A 1FJGE 2EOJA 2L3JA 2MKNA 3EQ1A 2EPXA 2LJHA 2V86A 4L5NC 2EPKX 2M9AA 4B3TE 2DLKA 1MEYC 4OOGC 2JWOA 1SFEA 2JOBA 2EN7A 2I9IA 5AE1A 2LMZA 1GZ6A 5IV8B 4DUZE 2EOIA 1T4LB 2L2KB 1BBOA 2EN8A 2DRPA 4JYAE 3KWRA 2K7IA 1X6HA 1JK1A 1IBLE 4DR7E 1YYOA 4R2RA 2EQ3A 1WXRA 1I94E 4NHRA 1ZU1A 2WBTA 3EPKA 2ENHA 1X49A 2EOZA 2NABA 5AE2A 1YPNA 4DR5E 2EOYA 2VE7C 2EOOA 2LBSB 5AC5A 4DV0E 2ELZA 2F8BA 2LT7A 2LUQA 4AQYE 2EMGA 4R2SA 4LFCE 4BBYA 2I13A 4Q28A 4L8NA 2LJUA 1A1HA 1J26A 3HXLA 4X65E 5A6AA 3IWCA 2EL6A 3F6HA 3J80C 4BHBA 1EH6A 1F2IG 1HNXE 4IJDA 3J7Yp
chains in the Genus database with same CATH topology
2R1FA 2EL5A 2CSHA 1BB8A 2EMAA 1A1LA 2EM0A 2EM8A 2EORA 2YTQA 3UK3C 2YTFA 2EPPA 2YTOA 2DLQA 2EMWA 3VHTB 2EQ0A 1NCSA 2GLIA 2GHFA 3EPJA 2EMBA 2EOXA 2EJ4A 2EN1A 4GZNC 4X9JA 2EMHA 2MKDA 2EM6A 2YRKA 4R2CA 2LCEA 1B69A 2WCC3 2EN3A 1X5WA 2EM2A 2YTPA 2YRHA 2EMFA 4R2QA 2EMLA 2EM4A 4M9VC 1UN6B 2LV2A 2EMKA 2EOQA 1Z1BA 1RMDA 2WBUA 2CT1A 1DGCA 1P47A 2LVHA 1UBDC 2ADRA 5KL2A 5KL3A 1LLMC 1JK2A 1KJKA 2ENAA 2DGCA 2EMCA 2YTIA 2BB8A 1TF3A 2EM5A 1X6EA 2EOEA 2EOJA 2YTDA 2EM3A 2ENCA 2MKNA 2YTJA 1YUJA 1TN9A 2EPXA 2EMYA 2EOSA 2EOFA 4F2JC 1ZR9A 2EM9A 2M9AA 2RSIA 2EOHA 3MHSC 2DLKA 2CTDA 5KL5A 1MEYC 2EN6A 2EPCA 2YSPA 2EN7A 1X6FA 2A25A 1X3CA 2HGHA 2RPCA 1YSAC 2EPUA 2EOIA 2EN4A 1BBOA 2EN8A 4R2EA 4R2PA 2DRPA 2EM7A 2EMIA 2WBSA 1G2DC 3EPHA 1AAYA 1X6HA 2EP3A 1JK1A 2MDGA 4F6MA 2EPRA 4R2RA 2EQ3A 1WJPA 3EPLA 1A1KA 2EPZA 1A1GA 1ZU1A 2EPAA 2WBTA 4R2DA 3EPKA 2ENHA 2PRTA 2EOMA 2DMIA 2EOZA 2NABA 4IS1C 2D9HA 1A1IA 2EE8A 2EOYA 2EOOA 5KL4A 2EMZA 2J7JA 2ELYA 2ELZA 2LT7A 3M99B 2E72A 2EMGA 4R2SA 5KL6A 4F6NA 2I13A 2YTGA 3MHHC 1A1FA 4R2AA 2YRMA 2EN2A 1A1HA 4FK5C 2YU8A 2YTNA 5KL7A 2EMXA 1YUIA 2EL4A 2EL6A 1ZAAC 2EQ1A 2LO3A 2YU5A 1A1JA 4WSGA 2JPAA 1G2FC 2JP9A 2YTEA 1F2IG 2YSOA 2VRDA 4IJDA 1TF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R1F A;  2EL5 A;  2CSH A;  1BB8 A;  2EMA A;  1A1L A;  2EM0 A;  2EM8 A;  2EOR A;  2YTQ A;  3UK3 C;  2YTF A;  2EPP A;  2YTO A;  2DLQ A;  2EMW A;  3VHT B;  2EQ0 A;  1NCS A;  2GLI A;  2GHF A;  3EPJ A;  2EMB A;  2EOX A;  2EJ4 A;  2EN1 A;  4GZN C;  4X9J A;  2EMH A;  2MKD A;  2EM6 A;  2YRK A;  4R2C A;  2LCE A;  1B69 A;  2WCC 3;  2EN3 A;  1X5W A;  2EM2 A;  2YTP A;  2YRH A;  2EMF A;  4R2Q A;  2EML A;  2EM4 A;  4M9V C;  1UN6 B;  2LV2 A;  2EMK A;  2EOQ A;  1Z1B A;  1RMD A;  2WBU A;  2CT1 A;  1DGC A;  1P47 A;  2LVH A;  1UBD C;  2ADR A;  5KL2 A;  5KL3 A;  1LLM C;  1JK2 A;  1KJK A;  2ENA A;  2DGC A;  2EMC A;  2YTI A;  2BB8 A;  1TF3 A;  2EM5 A;  1X6E A;  2EOE A;  2EOJ A;  2YTD A;  2EM3 A;  2ENC A;  2MKN A;  2YTJ A;  1YUJ A;  1TN9 A;  2EPX A;  2EMY A;  2EOS A;  2EOF A;  4F2J C;  1ZR9 A;  2EM9 A;  2M9A A;  2RSI A;  2EOH A;  3MHS C;  2DLK A;  2CTD A;  5KL5 A;  1MEY C;  2EN6 A;  2EPC A;  2YSP A;  2EN7 A;  1X6F A;  2A25 A;  1X3C A;  2HGH A;  2RPC A;  1YSA C;  2EPU A;  2EOI A;  2EN4 A;  1BBO A;  2EN8 A;  4R2E A;  4R2P A;  2DRP A;  2EM7 A;  2EMI A;  2WBS A;  1G2D C;  3EPH A;  1AAY A;  1X6H A;  2EP3 A;  1JK1 A;  2MDG A;  4F6M A;  2EPR A;  4R2R A;  2EQ3 A;  1WJP A;  3EPL A;  1A1K A;  2EPZ A;  1A1G A;  1ZU1 A;  2EPA A;  2WBT A;  4R2D A;  3EPK A;  2ENH A;  2PRT A;  2EOM A;  2DMI A;  2EOZ A;  2NAB A;  4IS1 C;  2D9H A;  1A1I A;  2EE8 A;  2EOY A;  2EOO A;  5KL4 A;  2EMZ A;  2J7J A;  2ELY A;  2ELZ A;  2LT7 A;  3M99 B;  2E72 A;  2EMG A;  4R2S A;  5KL6 A;  4F6N A;  2I13 A;  2YTG A;  3MHH C;  1A1F A;  4R2A A;  2YRM A;  2EN2 A;  1A1H A;  4FK5 C;  2YU8 A;  2YTN A;  5KL7 A;  2EMX A;  1YUI A;  2EL4 A;  2EL6 A;  1ZAA C;  2EQ1 A;  2LO3 A;  2YU5 A;  1A1J A;  4WSG A;  2JPA A;  1G2F C;  2JP9 A;  2YTE A;  1F2I G;  2YSO A;  2VRD A;  4IJD A;  1TF6 A; 
#chains in the Genus database with same CATH topology
 4WSP A;  1BB8 A;  2EMA A;  4P7D A;  2UXB E;  3UK3 C;  2HJJ A;  1YZ9 A;  2Q8U A;  1T38 A;  2EPP A;  1PDA A;  2YWQ A;  3TQM A;  2UU9 E;  2EQ0 A;  1NCS A;  4HEI A;  1T4N A;  2EMB A;  1FKA E;  2EN1 A;  1XMQ E;  2ODR C;  2EM6 A;  5ADZ A;  2WCC 3;  2EM2 A;  4B3R E;  4LTY A;  3BBG A;  4WFT A;  1QU6 A;  4R2Q A;  4LF4 E;  2EML A;  1WHQ A;  2G7H A;  2EOQ A;  4I8O A;  2NUF A;  2EPN A;  4DV1 E;  2WBU A;  3C6K A;  1HNZ E;  3JU0 A;  5KL3 A;  2YTI A;  2EM5 A;  2MC6 A;  1X6E A;  2EM3 A;  2E5L E;  2YTJ A;  2ZM6 E;  2EMY A;  2EOF A;  4F2J C;  4DR1 E;  2EM9 A;  1SR9 A;  2HC5 A;  3K6Q A;  4F9A B;  2HHH E;  2LRS A;  1QNT A;  2V8Q B;  4WPY A;  2FTX B;  4WX9 A;  5A6K A;  1X6F A;  4MLV A;  2EWL A;  2EN4 A;  3ZOQ B;  4R2P A;  2DB2 A;  5LMU E;  2M7Q A;  2B9D A;  2EMI A;  2WBS A;  3EPH A;  4GKK E;  4O43 A;  5F3W A;  4F6M A;  4M0V A;  2JOX A;  2EPR A;  5CFF E;  2LTS A;  4DKK A;  3EPL A;  3ADJ A;  1A1K A;  2EPZ A;  4JI4 E;  4DR4 E;  4YHH E;  2EPA A;  3JAM C;  4LF5 E;  4IS1 C;  1A1I A;  1DQ3 A;  1UHZ A;  3ADL A;  3P1X A;  2YTG A;  2EN2 A;  4TUI A;  2UUC E;  4FK5 C;  4O4K A;  2YU8 A;  3AUZ A;  1YUI A;  2L33 A;  2FV4 B;  1IBK E;  4HTG A;  2JPA A;  2RS7 A;  2JP9 A;  3HPS A;  3MSW A;  4JI1 E;  1A1J A;  3C4T A;  3DF6 A;  2EL5 A;  2CSH A;  1A1L A;  2EM0 A;  1YYW A;  2YTQ A;  4DV3 E;  2YTF A;  3VYY A;  1HR0 E;  2H36 X;  2GPI A;  2YTO A;  1WHN A;  3H09 A;  2YPN A;  2L8T A;  1YFH A;  4DV4 E;  2GLI A;  3EPJ A;  2EOX A;  4DV5 E;  1GTK A;  4WXC A;  4X64 E;  4GZN C;  4X9J A;  4R03 A;  2YRK A;  4R2C A;  2VQE E;  2EN3 A;  1N32 E;  1MGT A;  1N33 E;  2WZO A;  4WYQ B;  2NA2 A;  2B7V A;  2EMF A;  5A6B D;  3ADI A;  1PKP A;  4M30 A;  1YYK A;  1UN6 B;  5BR8 E;  4ZYE A;  3C6M A;  1RMD A;  1DI2 A;  2DSY A;  2CT1 A;  1DGC A;  2RSM A;  2LVH A;  3IWD A;  2ADR A;  5KL2 A;  2KHX A;  2V87 A;  1XMO E;  1ZBT A;  2F4V E;  2ENA A;  2EMC A;  1TF3 A;  2JY9 A;  2UXD E;  2YTD A;  4KZS A;  2ENC A;  2E1M A;  1YUJ A;  4ZYG A;  1AH5 A;  4TUG A;  1O0W A;  2LE2 A;  2M1S A;  2EZ6 A;  5DNY A;  3THN A;  5TSE A;  5KL5 A;  2CTD A;  4LF6 E;  2R76 A;  2YSP A;  1L4S A;  3BGH A;  4O5G A;  3JTZ A;  1X3C A;  2EPO A;  1WRJ A;  1YSA C;  4N4R B;  2EPU A;  1PJS A;  3FIG A;  2EM7 A;  4JV5 E;  2KOU A;  1AAY A;  2V85 A;  4KHP E;  1WJP A;  2L92 A;  2JXP A;  1A1G A;  4NZV A;  1IQO A;  2DMI A;  4J8Z A;  5IT9 C;  3DJW A;  2D9H A;  4KWY A;  2L2M A;  1RC7 A;  2B3T B;  2J7J A;  3ECR A;  4ZYD A;  4BC9 A;  4DV6 E;  4NXN E;  4RH8 A;  2L6M A;  3HTX A;  4BMJ A;  5IXM B;  3LML A;  5KL6 A;  2RQL A;  4F6N A;  3MHH C;  1A1F A;  2YRM A;  4B3S E;  3HPZ A;  4LFB E;  2EPL X;  2IHR 1;  2VF1 A;  2YTN A;  2B7T A;  3VYX A;  1ZBQ A;  2EQ1 A;  2LO3 A;  2YU5 A;  4BHC A;  4LF8 E;  5LL6 R;  4O24 A;  4OX9 E;  2YTE A;  2YSO A;  2VRD A;  3T1Y E;  1TF6 A;  2UXC E;  1N36 E;  1X48 A;  2EM8 A;  4JI8 E;  5AE3 A;  4DUY E;  5AAS A;  4X66 E;  1EKZ A;  3VHT B;  4GEQ B;  4JI0 E;  4LU9 A;  1UIL A;  3QG5 C;  2UUA E;  3AV0 A;  2LCE A;  1B69 A;  2JR1 A;  4BS9 A;  1X47 A;  4DMI A;  2V89 A;  2NUE A;  1IMU A;  2YTP A;  3ADG A;  3LLH A;  2ODR D;  2YRH A;  3KZY A;  4M9V C;  5A69 A;  2UUB E;  2EMK A;  1Z1B A;  2MC5 A;  2VQF E;  1P47 A;  1KYQ A;  1IBM E;  1LLM C;  4DR2 E;  4NXM E;  4X62 E;  2DGC A;  2BB8 A;  2N3H A;  2LTR A;  2EOE A;  4MLQ A;  1N34 E;  4BCA A;  3HQ1 A;  1EH8 A;  1TN9 A;  2CPN A;  2EOS A;  4JI2 E;  4YY3 E;  1ZR9 A;  2RSI A;  2EOH A;  3MHS C;  5LLQ A;  4JI5 E;  4GKJ E;  2EN6 A;  2EPC A;  2RTX A;  4Q35 B;  1T39 A;  4DV2 E;  2MDR A;  2A25 A;  2HGH A;  2LUP B;  2RPC A;  5IWA E;  3F6G A;  3BF2 A;  4R8O A;  4F9C B;  4R2E A;  2DIX A;  2BBG A;  1G2D C;  2N3G A;  2EP3 A;  2MDG A;  1STU A;  3VK6 A;  1GQE A;  4BC7 A;  1T4O A;  2YZT A;  4R2D A;  2PRT A;  4DR3 E;  2EOM A;  2DMY A;  4DV7 E;  1N3G A;  1IQS A;  2EE8 A;  5KL4 A;  2EMZ A;  2ELY A;  3M99 B;  4P78 A;  2JYA A;  2E72 A;  1J5E E;  4R2A A;  2NUG A;  4K0K E;  2N8X A;  4JI7 E;  4LFA E;  5KL7 A;  5LMN E;  2EMX A;  2FGG A;  4X8W A;  2EL4 A;  3C4B A;  1ZAA C;  2YT4 A;  3BID A;  4RHB B;  4WSG A;  1G2F C;  1XNR E;  5T6J A;  3KZZ A;  4F9B B;  2R1F A;  4JI6 E;  4JI3 E;  2EOR A;  4WXD A;  5A2Q C;  2L3C A;  1XNQ E;  4F54 A;  4DR6 E;  2EPM X;  2K4V A;  2RS6 A;  2DLQ A;  2EMW A;  2JVA A;  3T1H E;  2GHF A;  2L2N A;  5A6J A;  2EJ4 A;  3OTO E;  2EMH A;  2MKD A;  1NEI A;  5AC4 A;  1HNW E;  4LF9 E;  1X5W A;  3OML A;  4M2Z A;  1PJT A;  3J7A G;  4ZYH A;  2KON A;  3THO B;  2EM4 A;  5FLX C;  3J81 C;  2LV2 A;  2V83 A;  3RMP A;  2M4I A;  1BBG A;  2V88 A;  3IWB A;  4B3M E;  1PJQ A;  1UBD C;  1EH7 A;  4LF7 E;  1JK2 A;  5A6B A;  1KJK A;  3L00 A;  1RQ0 A;  1FJG E;  2EOJ A;  2L3J A;  2MKN A;  3EQ1 A;  2EPX A;  2LJH A;  2V86 A;  4L5N C;  2EPK X;  2M9A A;  4B3T E;  2DLK A;  1MEY C;  4OOG C;  2JWO A;  1SFE A;  2JOB A;  2EN7 A;  2I9I A;  5AE1 A;  2LMZ A;  1GZ6 A;  5IV8 B;  4DUZ E;  2EOI A;  1T4L B;  2L2K B;  1BBO A;  2EN8 A;  2DRP A;  4JYA E;  3KWR A;  2K7I A;  1X6H A;  1JK1 A;  1IBL E;  4DR7 E;  1YYO A;  4R2R A;  2EQ3 A;  1WXR A;  1I94 E;  4NHR A;  1ZU1 A;  2WBT A;  3EPK A;  2ENH A;  1X49 A;  2EOZ A;  2NAB A;  5AE2 A;  1YPN A;  4DR5 E;  2EOY A;  2VE7 C;  2EOO A;  2LBS B;  5AC5 A;  4DV0 E;  2ELZ A;  2F8B A;  2LT7 A;  2LUQ A;  4AQY E;  2EMG A;  4R2S A;  4LFC E;  4BBY A;  2I13 A;  4Q28 A;  4L8N A;  2LJU A;  1A1H A;  1J26 A;  3HXL A;  4X65 E;  5A6A A;  3IWC A;  2EL6 A;  3F6H A;  3J80 C;  4BHB A;  1EH6 A;  1F2I G;  1HNX E;  4IJD A;  3J7Y p; 
#chains in the Genus database with same CATH homology
 2R1F A;  2EL5 A;  2CSH A;  1BB8 A;  2EMA A;  1A1L A;  2EM0 A;  2EM8 A;  2EOR A;  2YTQ A;  3UK3 C;  2YTF A;  2EPP A;  2YTO A;  2DLQ A;  2EMW A;  3VHT B;  2EQ0 A;  1NCS A;  2GLI A;  2GHF A;  3EPJ A;  2EMB A;  2EOX A;  2EJ4 A;  2EN1 A;  4GZN C;  4X9J A;  2EMH A;  2MKD A;  2EM6 A;  2YRK A;  4R2C A;  2LCE A;  1B69 A;  2WCC 3;  2EN3 A;  1X5W A;  2EM2 A;  2YTP A;  2YRH A;  2EMF A;  4R2Q A;  2EML A;  2EM4 A;  4M9V C;  1UN6 B;  2LV2 A;  2EMK A;  2EOQ A;  1Z1B A;  1RMD A;  2WBU A;  2CT1 A;  1DGC A;  1P47 A;  2LVH A;  1UBD C;  2ADR A;  5KL2 A;  5KL3 A;  1LLM C;  1JK2 A;  1KJK A;  2ENA A;  2DGC A;  2EMC A;  2YTI A;  2BB8 A;  1TF3 A;  2EM5 A;  1X6E A;  2EOE A;  2EOJ A;  2YTD A;  2EM3 A;  2ENC A;  2MKN A;  2YTJ A;  1YUJ A;  1TN9 A;  2EPX A;  2EMY A;  2EOS A;  2EOF A;  4F2J C;  1ZR9 A;  2EM9 A;  2M9A A;  2RSI A;  2EOH A;  3MHS C;  2DLK A;  2CTD A;  5KL5 A;  1MEY C;  2EN6 A;  2EPC A;  2YSP A;  2EN7 A;  1X6F A;  2A25 A;  1X3C A;  2HGH A;  2RPC A;  1YSA C;  2EPU A;  2EOI A;  2EN4 A;  1BBO A;  2EN8 A;  4R2E A;  4R2P A;  2DRP A;  2EM7 A;  2EMI A;  2WBS A;  1G2D C;  3EPH A;  1AAY A;  1X6H A;  2EP3 A;  1JK1 A;  2MDG A;  4F6M A;  2EPR A;  4R2R A;  2EQ3 A;  1WJP A;  3EPL A;  1A1K A;  2EPZ A;  1A1G A;  1ZU1 A;  2EPA A;  2WBT A;  4R2D A;  3EPK A;  2ENH A;  2PRT A;  2EOM A;  2DMI A;  2EOZ A;  2NAB A;  4IS1 C;  2D9H A;  1A1I A;  2EE8 A;  2EOY A;  2EOO A;  5KL4 A;  2EMZ A;  2J7J A;  2ELY A;  2ELZ A;  2LT7 A;  3M99 B;  2E72 A;  2EMG A;  4R2S A;  5KL6 A;  4F6N A;  2I13 A;  2YTG A;  3MHH C;  1A1F A;  4R2A A;  2YRM A;  2EN2 A;  1A1H A;  4FK5 C;  2YU8 A;  2YTN A;  5KL7 A;  2EMX A;  1YUI A;  2EL4 A;  2EL6 A;  1ZAA C;  2EQ1 A;  2LO3 A;  2YU5 A;  1A1J A;  4WSG A;  2JPA A;  1G2F C;  2JP9 A;  2YTE A;  1F2I G;  2YSO A;  2VRD A;  4IJD A;  1TF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...