2EMFA

Solution structure of the c2h2 type zinc finger (region 379-411) of human zinc finger protein 484
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGGKHFECTECGKAFTRKSTLSMHQKIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 379-411) of human Zinc finger protein 484
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 484
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emfA01
2EM2A 2EMCA 3EPJA 4X9JA 1NCSA 2YTEA 2YRHA 2EMXA 2PRTA 2EN3A 1TN9A 2NABA 2RSIA 2YTQA 2E72A 1A1FA 2EJ4A 2WBUA 2EM3A 2A25A 2EOMA 1X6EA 2LO3A 1A1KA 1MEYC 1DGCA 1AAYA 2LT7A 2EMGA 1B69A 2EMLA 2EMFA 2EPRA 1P47A 2MKNA 2EM6A 2DMIA 1X6HA 2EL6A 2ELZA 4M9VC 2BB8A 2EMHA 2EOOA 2EPXA 4WSGA 1F2IG 1UN6B 1ZR9A 1RMDA 1YUJA 2ENCA 2YTNA 2DLKA 2LCEA 2EM9A 1X5WA 2EORA 2CT1A 5KL7A 2EL5A 2EMYA 1UBDC 4R2RA 1LLMC 2EMBA 2YTIA 1WJPA 1A1HA 2EM8A 2J7JA 2DLQA 4IS1C 1JK2A 3MHHC 4F2JC 2YRKA 5KL3A 2VRDA 2EPUA 1A1JA 2JP9A 2EQ0A 2YTOA 3EPHA 2GHFA 5KL5A 2R1FA 2EOXA 2EP3A 2YTJA 2M9AA 4FK5C 4GZNC 2HGHA 4R2AA 2YSOA 4IJDA 2D9HA 3M99B 3MHSC 2LVHA 1YSAC 2YTPA 2EOQA 2DGCA 1KJKA 2EOEA 1TF3A 2YSPA 1BB8A 2MKDA 2JPAA 1A1GA 2CTDA 2EL4A 2EN6A 2EQ1A 4R2EA 1YUIA 1A1IA 2EM4A 2YTGA 2EOFA 2EOSA 5KL2A 2ENHA 2EPCA 2YU8A 2MDGA 2EN4A 2EMWA 4R2PA 2EOYA 2LV2A 2DRPA 3EPKA 1A1LA 1TF6A 4R2CA 2YTDA 3EPLA 2ENAA 2YU5A 1JK1A 2EQ3A 2EN1A 2EMKA 2ELYA 2EPAA 1G2DC 2EN7A 2EN2A 2EM7A 1X3CA 2YRMA 2EM0A 2I13A 1G2FC 5KL6A 4F6MA 4R2QA 1X6FA 2EM5A 3UK3C 2YTFA 2EOHA 1BBOA 2EMAA 2EN8A 2EPPA 2WCC3 1ZAAC 2GLIA 2EMZA 2EOIA 3VHTB 2EE8A 5KL4A 2EPZA 4R2DA 2WBTA 4R2SA 2WBSA 2RPCA 2ADRA 1Z1BA 1ZU1A 2EMIA 4F6NA 2EOJA 2CSHA 2EOZA
chains in the Genus database with same CATH superfamily
2EM2A 2YT4A 1EH7A 4WPYA 3EPJA 1X47A 4O4KA 2PRTA 4JI6E 2V85A 4KZSA 2B7TA 2UUAE 4JI5E 2VQEE 2EM3A 5A2QC 4M30A 2EOMA 2EZ6A 2LUPB 2JOBA 5A6JA 2LT7A 2EMGA 4DV5E 1IQOA 4WYQB 4ZYGA 4RH8A 1ZR9A 2L2MA 5LL6R 4L5NC 4N4RB 5LMNE 4KHPE 4RHBB 1X5WA 2HC5A 2RS6A 1GZ6A 4DV4E 4R2RA 2V8QB 3DF6A 4GEQB 4JI7E 4WFTA 2EMBA 3HQ1A 4LF5E 1WHQA 5T6JA 2YRKA 5KL3A 4LFBE 1UILA 2JP9A 2YTOA 4LF7E 1WRJA 1T4LB 3K6QA 3ADIA 4JI3E 1PJQA 2M9AA 4LF8E 4FK5C 4B3SE 4WSPA 4ZYHA 1BBGA 4NZVA 3P1XA 2YTPA 1KJKA 2EOEA 2MKDA 4LF4E 2EN6A 2CPNA 1PKPA 2B9DA 1PJSA 2EM4A 1WXRA 1XMOE 2EPCA 1WHNA 1N36E 2EMWA 2FV4B 1QU6A 3EPKA 4DR7E 1YYKA 5A6AA 4JI8E 3EPLA 2YU5A 1JK1A 4X64E 1HNWE 2EN2A 5AE2A 3KZYA 5KL6A 2RQLA 2V83A 4R2QA 5AC4A 2HJJA 5LMUE 4LF6E 3KZZA 3JU0A 5AC5A 5A6BD 2FGGA 4ZYDA 3BF2A 2EOHA 1BBOA 2N8XA 4KWYA 2EN8A 2EPPA 2WCC3 1DI2A 2DSYA 5KL4A 4R2SA 2RPCA 4TUIA 1EKZA 1Z1BA 1ZU1A 2V88A 1N33E 4BMJA 2ODRC 4B3RE 4DV6E 3J80C 2EMXA 4R03A 5TSEA 1TN9A 2NABA 2L3CA 2E72A 3HPZA 4DR1E 5A6BA 5A69A 1A1FA 1EH8A 2EJ4A 2N3GA 2ODRD 2WBUA 5DNYA 4P7DA 5AE3A 2JOXA 1HR0E 1ZBTA 2EMLA 2EMFA 4LFCE 4OX9E 4O43A 2DMIA 2EL6A 2ELZA 4DMIA 4JI0E 2EPXA 2N3HA 1RMDA 2ENCA 3THOB 2LE2A 1XMQE 1STUA 2LUQA 1XNQE 5KL7A 2LBSB 2EL5A 1IQSA 1LLMC 5ADZA 1HNZE 4F9CB 1YFHA 1SFEA 1A1HA 2J7JA 3IWDA 4DUZE 1IBLE 1MGTA 1YYWA 2UXDE 4F2JC 1GQEA 1A1JA 4ZYEA 4DR2E 1X49A 3BGHA 2EOXA 3VK6A 3TQMA 1IMUA 4GZNC 2V86A 2HGHA 2YSOA 4IJDA 1KYQA 4M2ZA 2LVHA 2NUEA 2EOQA 2Q8UA 4OOGC 1YYOA 4NXME 1TF3A 3OMLA 1T38A 1A1GA 3AUZA 2EL4A 1GTKA 1YUIA 2YTGA 4DV2E 2KOUA 3J7AG 2LJHA 3EQ1A 3ADGA 4JI1E 3HPSA 4GKKE 2EOYA 5IWAE 4LFAE 4F54A 2EWLA 2VE7C 3JAMC 2DB2A 4F9BB 4YHHE 4BBYA 4X62E 2YTDA 2ZM6E 2NUFA 2EMKA 4Q28A 4TUGA 4BC7A 1G2DC 5BR8E 4LU9A 1X3CA 2L92A 3LMLA 2WZOA 4DV3E 4Q35B 2I9IA 4DR6E 3C4BA 4R8OA 3UK3C 1N34E 2M7QA 4DV0E 3BBGA 1ZAAC 2EMZA 2RSMA 3VHTB 2WBTA 2MC5A 2EMIA 1J5EE 4AQYE 1T39A 2EOZA 4YY3E 2EMCA 1NCSA 3VYYA 2M1SA 1EH6A 3AV0A 2L3JA 4O24A 3T1YE 2RSIA 2E1MA 1YZ9A 4JI2E 3ECRA 2A25A 1X6EA 2LO3A 1A1KA 2V87A 1XNRE 1AAYA 2MKNA 2EM6A 1X6HA 4M9VC 2BB8A 2EMHA 4WSGA 4X66E 4BS9A 5AE1A 2LRSA 1T4OA 3ADLA 2EPKX 1PJTA 2EM9A 4BHBA 3BIDA 3HXLA 2EORA 2F4VE 4P78A 2YTIA 4DV7E 4NXNE 1WJPA 5A6KA 2EM8A 2HHHE 2DLQA 4IS1C 2UXBE 2E5LE 4B3ME 4B3TE 1O0WA 2VRDA 2EPUA 4MLVA 2YPNA 3DJWA 3LLHA 2K4VA 2R1FA 1FJGE 3THNA 3MSWA 4MLQA 4R2AA 4BC9A 3M99B 2L8TA 3MHSC 4DV1E 1UHZA 2DGCA 2DIXA 2UUCE 4GKJE 2YSPA 1BB8A 2JPAA 2RTXA 2EQ1A 4J8ZA 2EOFA 2EOSA 3FIGA 5AASA 5KL2A 2ENHA 2FTXB 4X8WA 4LF9E 4R2PA 2LV2A 2DRPA 3HTXA 3J81C 1FKAE 1TF6A 2GPIA 4LTYA 1IBKE 2EPAA 3F6HA 2EN7A 2EM7A 2YRMA 2EM0A 2I13A 1N3GA 4F6MA 3C6MA 2JYAA 1X6FA 2EM5A 1DQ3A 2VF1A 2L33A 2YTFA 3ZOQB 3C6KA 2GLIA 2UUBE 3ADJA 5IXMB 2KHXA 2EE8A 2NUGA 4DUYE 4R2DA 2EPZA 5IT9C 2ADRA 4F6NA 2EOJA 2CSHA 1IBME 4X9JA 2YTEA 4WXCA 2YRHA 2EN3A 2IHR1 2UU9E 2YTQA 2BBGA 2LTSA 3KWRA 1MEYC 1DGCA 2LTRA 1B69A 1J26A 2EPRA 1P47A 3QG5C 2L6MA 2EOOA 3RMPA 1F2IG 1UN6B 2UXCE 4JYAE 1YUJA 2YTNA 2DLKA 2KONA 2LCEA 1I94E 4DR5E 4WX9A 4WXDA 2CT1A 2B3TB 1UBDC 2EMYA 4DR3E 2NA2A 1QNTA 1HNXE 5FLXC 4DR4E 1JK2A 2JXPA 2MC6A 2VQFE 2LMZA 3MHHC 2EPLX 4L8NA 2G7HA 2RS7A 2YWQA 2R76A 4K0KE 2EQ0A 3OTOE 1YPNA 3EPHA 2GHFA 5KL5A 2B7VA 4NHRA 2EP3A 2YTJA 3F6GA 1NEIA 2M4IA 2L2KB 2D9HA 2EPNA 2EPOA 3T1HE 1YSAC 5IV8B 2JWOA 3H09A 4JV5E 2V89A 4JI4E 2CTDA 4R2EA 5CFFE 3C4TA 1A1IA 2H36X 2YU8A 4BCAA 1X48A 1PDAA 2YZTA 2JR1A 2MDGA 3VYXA 2EN4A 4DKKA 1ZBQA 1RQ0A 2L2NA 2LJUA 3IWBA 3L00A 4M0VA 1T4NA 1AH5A 1A1LA 4R2CA 5LLQA 2JY9A 2ENAA 2F8BA 4X65E 2EQ3A 2EN1A 4BHCA 4I8OA 2K7IA 4O5GA 4HEIA 2ELYA 2EPMX 1RC7A 1G2FC 1L4SA 3JTZA 3J7Yp 4HTGA 1N32E 3IWCA 2DMYA 2EMAA 2EOIA 4F9AB 5F3WA 2WBSA 1SR9A 2MDRA 2JVAA
chains in the Genus database with same CATH topology
2EM2A 2EMCA 3EPJA 4X9JA 1NCSA 2YTEA 2YRHA 2EMXA 2PRTA 2EN3A 1TN9A 2NABA 2RSIA 2YTQA 2E72A 1A1FA 2EJ4A 2WBUA 2EM3A 2A25A 2EOMA 1X6EA 2LO3A 1A1KA 1MEYC 1DGCA 1AAYA 2LT7A 2EMGA 1B69A 2EMLA 2EMFA 2EPRA 1P47A 2MKNA 2EM6A 2DMIA 1X6HA 2EL6A 2ELZA 4M9VC 2BB8A 2EMHA 2EOOA 2EPXA 4WSGA 1F2IG 1UN6B 1ZR9A 1RMDA 1YUJA 2ENCA 2YTNA 2DLKA 2LCEA 2EM9A 1X5WA 2EORA 2CT1A 5KL7A 2EL5A 2EMYA 1UBDC 4R2RA 1LLMC 2EMBA 2YTIA 1WJPA 1A1HA 2EM8A 2J7JA 2DLQA 4IS1C 1JK2A 3MHHC 4F2JC 2YRKA 5KL3A 2VRDA 2EPUA 1A1JA 2JP9A 2EQ0A 2YTOA 3EPHA 2GHFA 5KL5A 2R1FA 2EOXA 2EP3A 2YTJA 2M9AA 4FK5C 4GZNC 2HGHA 4R2AA 2YSOA 4IJDA 2D9HA 3M99B 3MHSC 2LVHA 1YSAC 2YTPA 2EOQA 2DGCA 1KJKA 2EOEA 1TF3A 2YSPA 1BB8A 2MKDA 2JPAA 1A1GA 2CTDA 2EL4A 2EN6A 2EQ1A 4R2EA 1YUIA 1A1IA 2EM4A 2YTGA 2EOFA 2EOSA 5KL2A 2ENHA 2EPCA 2YU8A 2MDGA 2EN4A 2EMWA 4R2PA 2EOYA 2LV2A 2DRPA 3EPKA 1A1LA 1TF6A 4R2CA 2YTDA 3EPLA 2ENAA 2YU5A 1JK1A 2EQ3A 2EN1A 2EMKA 2ELYA 2EPAA 1G2DC 2EN7A 2EN2A 2EM7A 1X3CA 2YRMA 2EM0A 2I13A 1G2FC 5KL6A 4F6MA 4R2QA 1X6FA 2EM5A 3UK3C 2YTFA 2EOHA 1BBOA 2EMAA 2EN8A 2EPPA 2WCC3 1ZAAC 2GLIA 2EMZA 2EOIA 3VHTB 2EE8A 5KL4A 2EPZA 4R2DA 2WBTA 4R2SA 2WBSA 2RPCA 2ADRA 1Z1BA 1ZU1A 2EMIA 4F6NA 2EOJA 2CSHA 2EOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EM2 A;  2EMC A;  3EPJ A;  4X9J A;  1NCS A;  2YTE A;  2YRH A;  2EMX A;  2PRT A;  2EN3 A;  1TN9 A;  2NAB A;  2RSI A;  2YTQ A;  2E72 A;  1A1F A;  2EJ4 A;  2WBU A;  2EM3 A;  2A25 A;  2EOM A;  1X6E A;  2LO3 A;  1A1K A;  1MEY C;  1DGC A;  1AAY A;  2LT7 A;  2EMG A;  1B69 A;  2EML A;  2EMF A;  2EPR A;  1P47 A;  2MKN A;  2EM6 A;  2DMI A;  1X6H A;  2EL6 A;  2ELZ A;  4M9V C;  2BB8 A;  2EMH A;  2EOO A;  2EPX A;  4WSG A;  1F2I G;  1UN6 B;  1ZR9 A;  1RMD A;  1YUJ A;  2ENC A;  2YTN A;  2DLK A;  2LCE A;  2EM9 A;  1X5W A;  2EOR A;  2CT1 A;  5KL7 A;  2EL5 A;  2EMY A;  1UBD C;  4R2R A;  1LLM C;  2EMB A;  2YTI A;  1WJP A;  1A1H A;  2EM8 A;  2J7J A;  2DLQ A;  4IS1 C;  1JK2 A;  3MHH C;  4F2J C;  2YRK A;  5KL3 A;  2VRD A;  2EPU A;  1A1J A;  2JP9 A;  2EQ0 A;  2YTO A;  3EPH A;  2GHF A;  5KL5 A;  2R1F A;  2EOX A;  2EP3 A;  2YTJ A;  2M9A A;  4FK5 C;  4GZN C;  2HGH A;  4R2A A;  2YSO A;  4IJD A;  2D9H A;  3M99 B;  3MHS C;  2LVH A;  1YSA C;  2YTP A;  2EOQ A;  2DGC A;  1KJK A;  2EOE A;  1TF3 A;  2YSP A;  1BB8 A;  2MKD A;  2JPA A;  1A1G A;  2CTD A;  2EL4 A;  2EN6 A;  2EQ1 A;  4R2E A;  1YUI A;  1A1I A;  2EM4 A;  2YTG A;  2EOF A;  2EOS A;  5KL2 A;  2ENH A;  2EPC A;  2YU8 A;  2MDG A;  2EN4 A;  2EMW A;  4R2P A;  2EOY A;  2LV2 A;  2DRP A;  3EPK A;  1A1L A;  1TF6 A;  4R2C A;  2YTD A;  3EPL A;  2ENA A;  2YU5 A;  1JK1 A;  2EQ3 A;  2EN1 A;  2EMK A;  2ELY A;  2EPA A;  1G2D C;  2EN7 A;  2EN2 A;  2EM7 A;  1X3C A;  2YRM A;  2EM0 A;  2I13 A;  1G2F C;  5KL6 A;  4F6M A;  4R2Q A;  1X6F A;  2EM5 A;  3UK3 C;  2YTF A;  2EOH A;  1BBO A;  2EMA A;  2EN8 A;  2EPP A;  2WCC 3;  1ZAA C;  2GLI A;  2EMZ A;  2EOI A;  3VHT B;  2EE8 A;  5KL4 A;  2EPZ A;  4R2D A;  2WBT A;  4R2S A;  2WBS A;  2RPC A;  2ADR A;  1Z1B A;  1ZU1 A;  2EMI A;  4F6N A;  2EOJ A;  2CSH A;  2EOZ A; 
#chains in the Genus database with same CATH topology
 2EM2 A;  2YT4 A;  1EH7 A;  4WPY A;  3EPJ A;  1X47 A;  4O4K A;  2PRT A;  4JI6 E;  2V85 A;  4KZS A;  2B7T A;  2UUA E;  4JI5 E;  2VQE E;  2EM3 A;  5A2Q C;  4M30 A;  2EOM A;  2EZ6 A;  2LUP B;  2JOB A;  5A6J A;  2LT7 A;  2EMG A;  4DV5 E;  1IQO A;  4WYQ B;  4ZYG A;  4RH8 A;  1ZR9 A;  2L2M A;  5LL6 R;  4L5N C;  4N4R B;  5LMN E;  4KHP E;  4RHB B;  1X5W A;  2HC5 A;  2RS6 A;  1GZ6 A;  4DV4 E;  4R2R A;  2V8Q B;  3DF6 A;  4GEQ B;  4JI7 E;  4WFT A;  2EMB A;  3HQ1 A;  4LF5 E;  1WHQ A;  5T6J A;  2YRK A;  5KL3 A;  4LFB E;  1UIL A;  2JP9 A;  2YTO A;  4LF7 E;  1WRJ A;  1T4L B;  3K6Q A;  3ADI A;  4JI3 E;  1PJQ A;  2M9A A;  4LF8 E;  4FK5 C;  4B3S E;  4WSP A;  4ZYH A;  1BBG A;  4NZV A;  3P1X A;  2YTP A;  1KJK A;  2EOE A;  2MKD A;  4LF4 E;  2EN6 A;  2CPN A;  1PKP A;  2B9D A;  1PJS A;  2EM4 A;  1WXR A;  1XMO E;  2EPC A;  1WHN A;  1N36 E;  2EMW A;  2FV4 B;  1QU6 A;  3EPK A;  4DR7 E;  1YYK A;  5A6A A;  4JI8 E;  3EPL A;  2YU5 A;  1JK1 A;  4X64 E;  1HNW E;  2EN2 A;  5AE2 A;  3KZY A;  5KL6 A;  2RQL A;  2V83 A;  4R2Q A;  5AC4 A;  2HJJ A;  5LMU E;  4LF6 E;  3KZZ A;  3JU0 A;  5AC5 A;  5A6B D;  2FGG A;  4ZYD A;  3BF2 A;  2EOH A;  1BBO A;  2N8X A;  4KWY A;  2EN8 A;  2EPP A;  2WCC 3;  1DI2 A;  2DSY A;  5KL4 A;  4R2S A;  2RPC A;  4TUI A;  1EKZ A;  1Z1B A;  1ZU1 A;  2V88 A;  1N33 E;  4BMJ A;  2ODR C;  4B3R E;  4DV6 E;  3J80 C;  2EMX A;  4R03 A;  5TSE A;  1TN9 A;  2NAB A;  2L3C A;  2E72 A;  3HPZ A;  4DR1 E;  5A6B A;  5A69 A;  1A1F A;  1EH8 A;  2EJ4 A;  2N3G A;  2ODR D;  2WBU A;  5DNY A;  4P7D A;  5AE3 A;  2JOX A;  1HR0 E;  1ZBT A;  2EML A;  2EMF A;  4LFC E;  4OX9 E;  4O43 A;  2DMI A;  2EL6 A;  2ELZ A;  4DMI A;  4JI0 E;  2EPX A;  2N3H A;  1RMD A;  2ENC A;  3THO B;  2LE2 A;  1XMQ E;  1STU A;  2LUQ A;  1XNQ E;  5KL7 A;  2LBS B;  2EL5 A;  1IQS A;  1LLM C;  5ADZ A;  1HNZ E;  4F9C B;  1YFH A;  1SFE A;  1A1H A;  2J7J A;  3IWD A;  4DUZ E;  1IBL E;  1MGT A;  1YYW A;  2UXD E;  4F2J C;  1GQE A;  1A1J A;  4ZYE A;  4DR2 E;  1X49 A;  3BGH A;  2EOX A;  3VK6 A;  3TQM A;  1IMU A;  4GZN C;  2V86 A;  2HGH A;  2YSO A;  4IJD A;  1KYQ A;  4M2Z A;  2LVH A;  2NUE A;  2EOQ A;  2Q8U A;  4OOG C;  1YYO A;  4NXM E;  1TF3 A;  3OML A;  1T38 A;  1A1G A;  3AUZ A;  2EL4 A;  1GTK A;  1YUI A;  2YTG A;  4DV2 E;  2KOU A;  3J7A G;  2LJH A;  3EQ1 A;  3ADG A;  4JI1 E;  3HPS A;  4GKK E;  2EOY A;  5IWA E;  4LFA E;  4F54 A;  2EWL A;  2VE7 C;  3JAM C;  2DB2 A;  4F9B B;  4YHH E;  4BBY A;  4X62 E;  2YTD A;  2ZM6 E;  2NUF A;  2EMK A;  4Q28 A;  4TUG A;  4BC7 A;  1G2D C;  5BR8 E;  4LU9 A;  1X3C A;  2L92 A;  3LML A;  2WZO A;  4DV3 E;  4Q35 B;  2I9I A;  4DR6 E;  3C4B A;  4R8O A;  3UK3 C;  1N34 E;  2M7Q A;  4DV0 E;  3BBG A;  1ZAA C;  2EMZ A;  2RSM A;  3VHT B;  2WBT A;  2MC5 A;  2EMI A;  1J5E E;  4AQY E;  1T39 A;  2EOZ A;  4YY3 E;  2EMC A;  1NCS A;  3VYY A;  2M1S A;  1EH6 A;  3AV0 A;  2L3J A;  4O24 A;  3T1Y E;  2RSI A;  2E1M A;  1YZ9 A;  4JI2 E;  3ECR A;  2A25 A;  1X6E A;  2LO3 A;  1A1K A;  2V87 A;  1XNR E;  1AAY A;  2MKN A;  2EM6 A;  1X6H A;  4M9V C;  2BB8 A;  2EMH A;  4WSG A;  4X66 E;  4BS9 A;  5AE1 A;  2LRS A;  1T4O A;  3ADL A;  2EPK X;  1PJT A;  2EM9 A;  4BHB A;  3BID A;  3HXL A;  2EOR A;  2F4V E;  4P78 A;  2YTI A;  4DV7 E;  4NXN E;  1WJP A;  5A6K A;  2EM8 A;  2HHH E;  2DLQ A;  4IS1 C;  2UXB E;  2E5L E;  4B3M E;  4B3T E;  1O0W A;  2VRD A;  2EPU A;  4MLV A;  2YPN A;  3DJW A;  3LLH A;  2K4V A;  2R1F A;  1FJG E;  3THN A;  3MSW A;  4MLQ A;  4R2A A;  4BC9 A;  3M99 B;  2L8T A;  3MHS C;  4DV1 E;  1UHZ A;  2DGC A;  2DIX A;  2UUC E;  4GKJ E;  2YSP A;  1BB8 A;  2JPA A;  2RTX A;  2EQ1 A;  4J8Z A;  2EOF A;  2EOS A;  3FIG A;  5AAS A;  5KL2 A;  2ENH A;  2FTX B;  4X8W A;  4LF9 E;  4R2P A;  2LV2 A;  2DRP A;  3HTX A;  3J81 C;  1FKA E;  1TF6 A;  2GPI A;  4LTY A;  1IBK E;  2EPA A;  3F6H A;  2EN7 A;  2EM7 A;  2YRM A;  2EM0 A;  2I13 A;  1N3G A;  4F6M A;  3C6M A;  2JYA A;  1X6F A;  2EM5 A;  1DQ3 A;  2VF1 A;  2L33 A;  2YTF A;  3ZOQ B;  3C6K A;  2GLI A;  2UUB E;  3ADJ A;  5IXM B;  2KHX A;  2EE8 A;  2NUG A;  4DUY E;  4R2D A;  2EPZ A;  5IT9 C;  2ADR A;  4F6N A;  2EOJ A;  2CSH A;  1IBM E;  4X9J A;  2YTE A;  4WXC A;  2YRH A;  2EN3 A;  2IHR 1;  2UU9 E;  2YTQ A;  2BBG A;  2LTS A;  3KWR A;  1MEY C;  1DGC A;  2LTR A;  1B69 A;  1J26 A;  2EPR A;  1P47 A;  3QG5 C;  2L6M A;  2EOO A;  3RMP A;  1F2I G;  1UN6 B;  2UXC E;  4JYA E;  1YUJ A;  2YTN A;  2DLK A;  2KON A;  2LCE A;  1I94 E;  4DR5 E;  4WX9 A;  4WXD A;  2CT1 A;  2B3T B;  1UBD C;  2EMY A;  4DR3 E;  2NA2 A;  1QNT A;  1HNX E;  5FLX C;  4DR4 E;  1JK2 A;  2JXP A;  2MC6 A;  2VQF E;  2LMZ A;  3MHH C;  2EPL X;  4L8N A;  2G7H A;  2RS7 A;  2YWQ A;  2R76 A;  4K0K E;  2EQ0 A;  3OTO E;  1YPN A;  3EPH A;  2GHF A;  5KL5 A;  2B7V A;  4NHR A;  2EP3 A;  2YTJ A;  3F6G A;  1NEI A;  2M4I A;  2L2K B;  2D9H A;  2EPN A;  2EPO A;  3T1H E;  1YSA C;  5IV8 B;  2JWO A;  3H09 A;  4JV5 E;  2V89 A;  4JI4 E;  2CTD A;  4R2E A;  5CFF E;  3C4T A;  1A1I A;  2H36 X;  2YU8 A;  4BCA A;  1X48 A;  1PDA A;  2YZT A;  2JR1 A;  2MDG A;  3VYX A;  2EN4 A;  4DKK A;  1ZBQ A;  1RQ0 A;  2L2N A;  2LJU A;  3IWB A;  3L00 A;  4M0V A;  1T4N A;  1AH5 A;  1A1L A;  4R2C A;  5LLQ A;  2JY9 A;  2ENA A;  2F8B A;  4X65 E;  2EQ3 A;  2EN1 A;  4BHC A;  4I8O A;  2K7I A;  4O5G A;  4HEI A;  2ELY A;  2EPM X;  1RC7 A;  1G2F C;  1L4S A;  3JTZ A;  3J7Y p;  4HTG A;  1N32 E;  3IWC A;  2DMY A;  2EMA A;  2EOI A;  4F9A B;  5F3W A;  2WBS A;  1SR9 A;  2MDR A;  2JVA A; 
#chains in the Genus database with same CATH homology
 2EM2 A;  2EMC A;  3EPJ A;  4X9J A;  1NCS A;  2YTE A;  2YRH A;  2EMX A;  2PRT A;  2EN3 A;  1TN9 A;  2NAB A;  2RSI A;  2YTQ A;  2E72 A;  1A1F A;  2EJ4 A;  2WBU A;  2EM3 A;  2A25 A;  2EOM A;  1X6E A;  2LO3 A;  1A1K A;  1MEY C;  1DGC A;  1AAY A;  2LT7 A;  2EMG A;  1B69 A;  2EML A;  2EMF A;  2EPR A;  1P47 A;  2MKN A;  2EM6 A;  2DMI A;  1X6H A;  2EL6 A;  2ELZ A;  4M9V C;  2BB8 A;  2EMH A;  2EOO A;  2EPX A;  4WSG A;  1F2I G;  1UN6 B;  1ZR9 A;  1RMD A;  1YUJ A;  2ENC A;  2YTN A;  2DLK A;  2LCE A;  2EM9 A;  1X5W A;  2EOR A;  2CT1 A;  5KL7 A;  2EL5 A;  2EMY A;  1UBD C;  4R2R A;  1LLM C;  2EMB A;  2YTI A;  1WJP A;  1A1H A;  2EM8 A;  2J7J A;  2DLQ A;  4IS1 C;  1JK2 A;  3MHH C;  4F2J C;  2YRK A;  5KL3 A;  2VRD A;  2EPU A;  1A1J A;  2JP9 A;  2EQ0 A;  2YTO A;  3EPH A;  2GHF A;  5KL5 A;  2R1F A;  2EOX A;  2EP3 A;  2YTJ A;  2M9A A;  4FK5 C;  4GZN C;  2HGH A;  4R2A A;  2YSO A;  4IJD A;  2D9H A;  3M99 B;  3MHS C;  2LVH A;  1YSA C;  2YTP A;  2EOQ A;  2DGC A;  1KJK A;  2EOE A;  1TF3 A;  2YSP A;  1BB8 A;  2MKD A;  2JPA A;  1A1G A;  2CTD A;  2EL4 A;  2EN6 A;  2EQ1 A;  4R2E A;  1YUI A;  1A1I A;  2EM4 A;  2YTG A;  2EOF A;  2EOS A;  5KL2 A;  2ENH A;  2EPC A;  2YU8 A;  2MDG A;  2EN4 A;  2EMW A;  4R2P A;  2EOY A;  2LV2 A;  2DRP A;  3EPK A;  1A1L A;  1TF6 A;  4R2C A;  2YTD A;  3EPL A;  2ENA A;  2YU5 A;  1JK1 A;  2EQ3 A;  2EN1 A;  2EMK A;  2ELY A;  2EPA A;  1G2D C;  2EN7 A;  2EN2 A;  2EM7 A;  1X3C A;  2YRM A;  2EM0 A;  2I13 A;  1G2F C;  5KL6 A;  4F6M A;  4R2Q A;  1X6F A;  2EM5 A;  3UK3 C;  2YTF A;  2EOH A;  1BBO A;  2EMA A;  2EN8 A;  2EPP A;  2WCC 3;  1ZAA C;  2GLI A;  2EMZ A;  2EOI A;  3VHT B;  2EE8 A;  5KL4 A;  2EPZ A;  4R2D A;  2WBT A;  4R2S A;  2WBS A;  2RPC A;  2ADR A;  1Z1B A;  1ZU1 A;  2EMI A;  4F6N A;  2EOJ A;  2CSH A;  2EOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...