2EMFA

Solution structure of the c2h2 type zinc finger (region 379-411) of human zinc finger protein 484
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGGKHFECTECGKAFTRKSTLSMHQKIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 484
publication title Solution structure of the C2H2 type zinc finger (region 379-411) of human Zinc finger protein 484
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emfA01
2MKNA 1WJPA 2CT1A 2WBTA 2YSOA 1ZAAC 2JP9A 2YTNA 2DLKA 2MKDA 1G2DC 2WBUA 5KL4A 2EM3A 2EOHA 2ENAA 4R2PA 2YRKA 2EPAA 1P47A 3EPHA 1X5WA 4R2AA 1B69A 2YTEA 2LT7A 2YTQA 4IJDA 1A1GA 1G2FC 2HGHA 2YU8A 2JPAA 1YUJA 2EMCA 2YTDA 2D9HA 2ENHA 2EQ1A 4R2CA 2EPRA 1YSAC 2EM5A 2EN8A 1X6FA 4F6MA 1A1KA 2EM7A 2EJ4A 1DGCA 2EQ0A 2EN6A 2EMFA 3MHSC 2EL6A 2CSHA 2EOSA 2YTIA 2EOZA 2EMLA 5KL7A 2NABA 2LVHA 2YTFA 2YTJA 2EMBA 4R2RA 2EL4A 5KL2A 2DMIA 2EOYA 2RSIA 4GZNC 2LV2A 4R2SA 1LLMC 2EMWA 1KJKA 4F6NA 4M9VC 2EOJA 2EMHA 5KL3A 2GHFA 4R2DA 2YSPA 1JK2A 2EPZA 2EQ3A 4X9JA 2DGCA 2EL5A 3EPJA 1A1LA 4R2EA 2EMXA 2WCC3 1A1IA 2EN1A 1A1JA 2J7JA 2EMAA 2YRMA 1YUIA 2EOEA 2YTGA 2GLIA 2EM8A 2CTDA 2EOXA 1MEYC 2EPXA 2LCEA 2DLQA 2EOFA 2EM4A 2EMGA 5KL6A 4IS1C 2M9AA 2E72A 2EP3A 2RPCA 2WBSA 2EOOA 2EPUA 1F2IG 1Z1BA 2YTPA 2EOIA 3EPLA 4F2JC 1X6HA 1A1FA 2EPPA 2EORA 1JK1A 2YTOA 1BB8A 2EN2A 3UK3C 2A25A 1TF6A 2LO3A 5KL5A 2EMYA 1UBDC 2ELYA 1AAYA 3EPKA 2EN4A 1X3CA 2EOQA 1TF3A 2YRHA 2EMIA 1X6EA 3MHHC 2EN7A 1A1HA 2EM9A 2EE8A 1ZU1A 1TN9A 2EM2A 2ENCA 4WSGA 2DRPA 1ZR9A 4R2QA 2EN3A 2PRTA 3M99B 2EM0A 2I13A 2EMZA 2EM6A 1BBOA 1NCSA 2YU5A 3VHTB 2ADRA 2VRDA 1UN6B 2ELZA 2EMKA 4FK5C 2MDGA 1RMDA 2R1FA 2EPCA 2BB8A 2EOMA
chains in the Genus database with same CATH superfamily
1UHZA 1ZAAC 1GZ6A 2LUQA 2V89A 4JI2E 4DUZE 3K6QA 2E5LE 4M0VA 1YYWA 2WBUA 4DV3E 2EM3A 2RS7A 2EPAA 3J81C 2EPNA 3DJWA 4R2AA 1KYQA 4NHRA 3T1YE 2HGHA 2YU8A 2JPAA 2UU9E 2ENHA 4ZYEA 3BGHA 2EQ1A 5A6KA 2EPRA 2EZ6A 2EN8A 4F6MA 2M1SA 4DV1E 3JU0A 2UUAE 2EQ0A 1ZBTA 3ADJA 2EL6A 2LTRA 3MHSC 3TQMA 2BBGA 5LMNE 1IMUA 1NEIA 2RS6A 2YTIA 4LF7E 2EOZA 2N3HA 3H09A 2EMBA 4R03A 2E1MA 2K4VA 4LF5E 4BBYA 1IQSA 2DMIA 2EOYA 2RSIA 2FTXB 4R2SA 3C4TA 2L2KB 2EOJA 3L00A 3BIDA 4DR5E 3OTOE 1QNTA 2JVAA 3VYXA 2V86A 2YSPA 4ZYDA 1YYKA 4DMIA 2EPZA 2DGCA 2EL5A 3C4BA 4L5NC 2ODRD 5A6BD 1A1JA 2L33A 4R8OA 2YRMA 5AC5A 1XMQE 3IWDA 1T4LB 2LCEA 2LJUA 4JI6E 2EOFA 4AQYE 4LF9E 2EPUA 5LLQA 1Z1BA 2YTPA 1F2IG 3ECRA 4F2JC 1X49A 2EPPA 4LF6E 1RC7A 4GEQB 4X64E 2EPMX 3UK3C 2NUFA 2EMYA 3EPKA 3HXLA 1TF3A 1A1HA 4Q35B 4X8WA 4LFBE 2EM2A 2DRPA 4WXCA 4DV7E 1WHNA 1BBGA 3M99B 4DV4E 4O4KA 3VHTB 5AE3A 1UN6B 3BBGA 2EMKA 4FK5C 2L3CA 2M7QA 1J26A 2BB8A 1UBDC 1WJPA 2EPKX 3HPZA 4LU9A 2DMYA 2YTNA 1SR9A 4WX9A 2DLKA 2MKDA 1G2DC 2EOHA 2ENAA 4TUGA 4B3TE 1X5WA 4DR6E 2UUBE 2YTEA 2YTQA 1A1GA 1G2FC 2DB2A 2HHHE 2JY9A 2D9HA 2NUGA 2RQLA 2MC6A 4O43A 3EQ1A 4LTYA 4R2CA 2FGGA 5A69A 5AASA 4BS9A 1XNQE 1X6FA 1A1KA 2EJ4A 2EM7A 4ZYGA 4DR1E 1O0WA 4F54A 2EN6A 5A6AA 4WYQB 2CSHA 2EOSA 2NABA 2LVHA 4M2ZA 3ZOQB 3BF2A 2B7TA 2JWOA 2F4VE 1T39A 2JXPA 4HTGA 4DR7E 2V8QB 4F6NA 2VQFE 2WZOA 4L8NA 3J7AG 5IV8B 2LJHA 2N8XA 5FLXC 4R2EA 4O24A 3HTXA 2J7JA 1EH8A 5DNYA 5AC4A 2EMAA 5IXMB 1MEYC 2JOBA 2DLQA 1N32E 2E72A 2EP3A 2B3TB 2L92A 2RPCA 2EOOA 4BMJA 2EOIA 2L6MA 4M30A 4KZSA 1EH7A 4BCAA 3T1HE 2EORA 2L3JA 4KHPE 4JYAE 1IBKE 2KHXA 1X47A 1BB8A 1GTKA 2LO3A 4JI4E 2RSMA 5BR8E 2EN4A 3KWRA 4BC9A 2B9DA 4N4RB 2YZTA 1T4NA 2EN7A 1ZU1A 4WSGA 4WXDA 2DSYA 4J8ZA 2PRTA 2EM0A 2EMZA 1BBOA 2YU5A 3AUZA 1N3GA 3J7Yp 1N33E 3HPSA 2MDGA 4DKKA 2KONA 2R1FA 1B69A 2EPLX 2EPCA 2HC5A 2EOMA 1WRJA 2CT1A 2FV4B 2JP9A 3P1XA 2G7HA 2MC5A 3VK6A 5KL4A 4JI0E 4NZVA 4TUIA 1HNXE 3ADGA 1FKAE 1P47A 3EPHA 4WFTA 5F3WA 5A6JA 1XNRE 5A2QC 4P7DA 1EH6A 1YUJA 4JV5E 2EMCA 2YTDA 1SFEA 3HQ1A 3MSWA 1PJSA 1EKZA 1YZ9A 2KOUA 3IWCA 2EM5A 1YSAC 5T6JA 3QG5C 1DGCA 2EMFA 2ZM6E 2V85A 2NA2A 5LL6R 2EMLA 5KL7A 2YTFA 4DR4E 1PJTA 2EL4A 4GZNC 2LV2A 1KJKA 1LLMC 2JYAA 2V83A 3THNA 4LFCE 4M9VC 2EMHA 4LF4E 4Q28A 4YY3E 3DF6A 2GHFA 2GPIA 4R2DA 1MGTA 1JK2A 2LE2A 3THOB 2VQEE 1UILA 2CPNA 1GQEA 2EMXA 4K0KE 4B3SE 2Q8UA 1A1IA 2LRSA 1T4OA 1YUIA 2EOEA 2GLIA 3RMPA 2EOXA 5IT9C 2EM4A 2R76A 1N36E 1IBLE 2K7IA 4I8OA 4F9BB 4LFAE 4O5GA 4NXME 4GKJE 1A1FA 1YFHA 2EPOA 4DV2E 2EN2A 1TF6A 2A25A 5KL5A 2ELYA 4DV6E 4YHHE 1DQ3A 2EOQA 2YRHA 4RHBB 4JI8E 2EMIA 3MHHC 3KZYA 4WPYA 2EM9A 2EE8A 1L4SA 3ADIA 2I9IA 2EN3A 1YYOA 2I13A 2EM6A 2UXDE 1IQOA 3JAMC 1T38A 2IHR1 4JI7E 3VYYA 4JI5E 4F9AB 1RMDA 3EPLA 3C6KA 1PDAA 2MKNA 4X62E 2WBTA 2YSOA 4BHCA 4KWYA 2HJJA 5CFFE 2L2MA 5ADZA 4DV5E 1X48A 2N3GA 4HEIA 4R2PA 2YRKA 4P78A 4DV0E 2B7VA 4JI3E 4RH8A 2LT7A 4IJDA 4B3RE 1PJQA 2YT4A 3F6GA 3FIGA 2H36X 5IWAE 1RQ0A 2M4IA 1ZBQA 3AV0A 4JI1E 4OOGC 5LMUE 1QU6A 2JOXA 2ODRC 2YTJA 4R2RA 1WXRA 5KL2A 2LMZA 5AE1A 2L2NA 2LUPB 2LBSB 3LMLA 1AH5A 2EMWA 2V88A 4OX9E 2YWQA 5KL3A 3OMLA 1YPNA 2V87A 2YPNA 3ADLA 1N34E 2EQ3A 4X9JA 1A1LA 3EPJA 2VE7C 2VF1A 2F8BA 2NUEA 2WCC3 2EN1A 4NXNE 4B3ME 4GKKE 3JTZA 2YTGA 4LF8E 2EM8A 5A6BA 2CTDA 5TSEA 2EPXA 2EMGA 5KL6A 4DR3E 1DI2A 1WHQA 4IS1C 2UXBE 2M9AA 5AE2A 2WBSA 4MLVA 3F6HA 2EWLA 2LTSA 1X6HA 2L8TA 1JK1A 1J5EE 2JR1A 2YTOA 2UXCE 2RTXA 4BHBA 1AAYA 1STUA 2MDRA 3KZZA 1HR0E 3J80C 1X3CA 1XMOE 2DIXA 1FJGE 1X6EA 4BC7A 1PKPA 1HNZE 2ENCA 1I94E 1TN9A 1ZR9A 4F9CB 4R2QA 1HNWE 3LLHA 3C6MA 1IBME 4WSPA 4MLQA 2UUCE 1NCSA 4DUYE 3IWBA 2ADRA 2VRDA 4DR2E 4X66E 2ELZA 4X65E 4ZYHA
chains in the Genus database with same CATH topology
2MKNA 1WJPA 2CT1A 2WBTA 2YSOA 1ZAAC 2JP9A 2YTNA 2DLKA 2MKDA 1G2DC 2WBUA 5KL4A 2EM3A 2EOHA 2ENAA 4R2PA 2YRKA 2EPAA 1P47A 3EPHA 1X5WA 4R2AA 1B69A 2YTEA 2LT7A 2YTQA 4IJDA 1A1GA 1G2FC 2HGHA 2YU8A 2JPAA 1YUJA 2EMCA 2YTDA 2D9HA 2ENHA 2EQ1A 4R2CA 2EPRA 1YSAC 2EM5A 2EN8A 1X6FA 4F6MA 1A1KA 2EM7A 2EJ4A 1DGCA 2EQ0A 2EN6A 2EMFA 3MHSC 2EL6A 2CSHA 2EOSA 2YTIA 2EOZA 2EMLA 5KL7A 2NABA 2LVHA 2YTFA 2YTJA 2EMBA 4R2RA 2EL4A 5KL2A 2DMIA 2EOYA 2RSIA 4GZNC 2LV2A 4R2SA 1LLMC 2EMWA 1KJKA 4F6NA 4M9VC 2EOJA 2EMHA 5KL3A 2GHFA 4R2DA 2YSPA 1JK2A 2EPZA 2EQ3A 4X9JA 2DGCA 2EL5A 3EPJA 1A1LA 4R2EA 2EMXA 2WCC3 1A1IA 2EN1A 1A1JA 2J7JA 2EMAA 2YRMA 1YUIA 2EOEA 2YTGA 2GLIA 2EM8A 2CTDA 2EOXA 1MEYC 2EPXA 2LCEA 2DLQA 2EOFA 2EM4A 2EMGA 5KL6A 4IS1C 2M9AA 2E72A 2EP3A 2RPCA 2WBSA 2EOOA 2EPUA 1F2IG 1Z1BA 2YTPA 2EOIA 3EPLA 4F2JC 1X6HA 1A1FA 2EPPA 2EORA 1JK1A 2YTOA 1BB8A 2EN2A 3UK3C 2A25A 1TF6A 2LO3A 5KL5A 2EMYA 1UBDC 2ELYA 1AAYA 3EPKA 2EN4A 1X3CA 2EOQA 1TF3A 2YRHA 2EMIA 1X6EA 3MHHC 2EN7A 1A1HA 2EM9A 2EE8A 1ZU1A 1TN9A 2EM2A 2ENCA 4WSGA 2DRPA 1ZR9A 4R2QA 2EN3A 2PRTA 3M99B 2EM0A 2I13A 2EMZA 2EM6A 1BBOA 1NCSA 2YU5A 3VHTB 2ADRA 2VRDA 1UN6B 2ELZA 2EMKA 4FK5C 2MDGA 1RMDA 2R1FA 2EPCA 2BB8A 2EOMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MKN A;  1WJP A;  2CT1 A;  2WBT A;  2YSO A;  1ZAA C;  2JP9 A;  2YTN A;  2DLK A;  2MKD A;  1G2D C;  2WBU A;  5KL4 A;  2EM3 A;  2EOH A;  2ENA A;  4R2P A;  2YRK A;  2EPA A;  1P47 A;  3EPH A;  1X5W A;  4R2A A;  1B69 A;  2YTE A;  2LT7 A;  2YTQ A;  4IJD A;  1A1G A;  1G2F C;  2HGH A;  2YU8 A;  2JPA A;  1YUJ A;  2EMC A;  2YTD A;  2D9H A;  2ENH A;  2EQ1 A;  4R2C A;  2EPR A;  1YSA C;  2EM5 A;  2EN8 A;  1X6F A;  4F6M A;  1A1K A;  2EM7 A;  2EJ4 A;  1DGC A;  2EQ0 A;  2EN6 A;  2EMF A;  3MHS C;  2EL6 A;  2CSH A;  2EOS A;  2YTI A;  2EOZ A;  2EML A;  5KL7 A;  2NAB A;  2LVH A;  2YTF A;  2YTJ A;  2EMB A;  4R2R A;  2EL4 A;  5KL2 A;  2DMI A;  2EOY A;  2RSI A;  4GZN C;  2LV2 A;  4R2S A;  1LLM C;  2EMW A;  1KJK A;  4F6N A;  4M9V C;  2EOJ A;  2EMH A;  5KL3 A;  2GHF A;  4R2D A;  2YSP A;  1JK2 A;  2EPZ A;  2EQ3 A;  4X9J A;  2DGC A;  2EL5 A;  3EPJ A;  1A1L A;  4R2E A;  2EMX A;  2WCC 3;  1A1I A;  2EN1 A;  1A1J A;  2J7J A;  2EMA A;  2YRM A;  1YUI A;  2EOE A;  2YTG A;  2GLI A;  2EM8 A;  2CTD A;  2EOX A;  1MEY C;  2EPX A;  2LCE A;  2DLQ A;  2EOF A;  2EM4 A;  2EMG A;  5KL6 A;  4IS1 C;  2M9A A;  2E72 A;  2EP3 A;  2RPC A;  2WBS A;  2EOO A;  2EPU A;  1F2I G;  1Z1B A;  2YTP A;  2EOI A;  3EPL A;  4F2J C;  1X6H A;  1A1F A;  2EPP A;  2EOR A;  1JK1 A;  2YTO A;  1BB8 A;  2EN2 A;  3UK3 C;  2A25 A;  1TF6 A;  2LO3 A;  5KL5 A;  2EMY A;  1UBD C;  2ELY A;  1AAY A;  3EPK A;  2EN4 A;  1X3C A;  2EOQ A;  1TF3 A;  2YRH A;  2EMI A;  1X6E A;  3MHH C;  2EN7 A;  1A1H A;  2EM9 A;  2EE8 A;  1ZU1 A;  1TN9 A;  2EM2 A;  2ENC A;  4WSG A;  2DRP A;  1ZR9 A;  4R2Q A;  2EN3 A;  2PRT A;  3M99 B;  2EM0 A;  2I13 A;  2EMZ A;  2EM6 A;  1BBO A;  1NCS A;  2YU5 A;  3VHT B;  2ADR A;  2VRD A;  1UN6 B;  2ELZ A;  2EMK A;  4FK5 C;  2MDG A;  1RMD A;  2R1F A;  2EPC A;  2BB8 A;  2EOM A; 
#chains in the Genus database with same CATH topology
 1UHZ A;  1ZAA C;  1GZ6 A;  2LUQ A;  2V89 A;  4JI2 E;  4DUZ E;  3K6Q A;  2E5L E;  4M0V A;  1YYW A;  2WBU A;  4DV3 E;  2EM3 A;  2RS7 A;  2EPA A;  3J81 C;  2EPN A;  3DJW A;  4R2A A;  1KYQ A;  4NHR A;  3T1Y E;  2HGH A;  2YU8 A;  2JPA A;  2UU9 E;  2ENH A;  4ZYE A;  3BGH A;  2EQ1 A;  5A6K A;  2EPR A;  2EZ6 A;  2EN8 A;  4F6M A;  2M1S A;  4DV1 E;  3JU0 A;  2UUA E;  2EQ0 A;  1ZBT A;  3ADJ A;  2EL6 A;  2LTR A;  3MHS C;  3TQM A;  2BBG A;  5LMN E;  1IMU A;  1NEI A;  2RS6 A;  2YTI A;  4LF7 E;  2EOZ A;  2N3H A;  3H09 A;  2EMB A;  4R03 A;  2E1M A;  2K4V A;  4LF5 E;  4BBY A;  1IQS A;  2DMI A;  2EOY A;  2RSI A;  2FTX B;  4R2S A;  3C4T A;  2L2K B;  2EOJ A;  3L00 A;  3BID A;  4DR5 E;  3OTO E;  1QNT A;  2JVA A;  3VYX A;  2V86 A;  2YSP A;  4ZYD A;  1YYK A;  4DMI A;  2EPZ A;  2DGC A;  2EL5 A;  3C4B A;  4L5N C;  2ODR D;  5A6B D;  1A1J A;  2L33 A;  4R8O A;  2YRM A;  5AC5 A;  1XMQ E;  3IWD A;  1T4L B;  2LCE A;  2LJU A;  4JI6 E;  2EOF A;  4AQY E;  4LF9 E;  2EPU A;  5LLQ A;  1Z1B A;  2YTP A;  1F2I G;  3ECR A;  4F2J C;  1X49 A;  2EPP A;  4LF6 E;  1RC7 A;  4GEQ B;  4X64 E;  2EPM X;  3UK3 C;  2NUF A;  2EMY A;  3EPK A;  3HXL A;  1TF3 A;  1A1H A;  4Q35 B;  4X8W A;  4LFB E;  2EM2 A;  2DRP A;  4WXC A;  4DV7 E;  1WHN A;  1BBG A;  3M99 B;  4DV4 E;  4O4K A;  3VHT B;  5AE3 A;  1UN6 B;  3BBG A;  2EMK A;  4FK5 C;  2L3C A;  2M7Q A;  1J26 A;  2BB8 A;  1UBD C;  1WJP A;  2EPK X;  3HPZ A;  4LU9 A;  2DMY A;  2YTN A;  1SR9 A;  4WX9 A;  2DLK A;  2MKD A;  1G2D C;  2EOH A;  2ENA A;  4TUG A;  4B3T E;  1X5W A;  4DR6 E;  2UUB E;  2YTE A;  2YTQ A;  1A1G A;  1G2F C;  2DB2 A;  2HHH E;  2JY9 A;  2D9H A;  2NUG A;  2RQL A;  2MC6 A;  4O43 A;  3EQ1 A;  4LTY A;  4R2C A;  2FGG A;  5A69 A;  5AAS A;  4BS9 A;  1XNQ E;  1X6F A;  1A1K A;  2EJ4 A;  2EM7 A;  4ZYG A;  4DR1 E;  1O0W A;  4F54 A;  2EN6 A;  5A6A A;  4WYQ B;  2CSH A;  2EOS A;  2NAB A;  2LVH A;  4M2Z A;  3ZOQ B;  3BF2 A;  2B7T A;  2JWO A;  2F4V E;  1T39 A;  2JXP A;  4HTG A;  4DR7 E;  2V8Q B;  4F6N A;  2VQF E;  2WZO A;  4L8N A;  3J7A G;  5IV8 B;  2LJH A;  2N8X A;  5FLX C;  4R2E A;  4O24 A;  3HTX A;  2J7J A;  1EH8 A;  5DNY A;  5AC4 A;  2EMA A;  5IXM B;  1MEY C;  2JOB A;  2DLQ A;  1N32 E;  2E72 A;  2EP3 A;  2B3T B;  2L92 A;  2RPC A;  2EOO A;  4BMJ A;  2EOI A;  2L6M A;  4M30 A;  4KZS A;  1EH7 A;  4BCA A;  3T1H E;  2EOR A;  2L3J A;  4KHP E;  4JYA E;  1IBK E;  2KHX A;  1X47 A;  1BB8 A;  1GTK A;  2LO3 A;  4JI4 E;  2RSM A;  5BR8 E;  2EN4 A;  3KWR A;  4BC9 A;  2B9D A;  4N4R B;  2YZT A;  1T4N A;  2EN7 A;  1ZU1 A;  4WSG A;  4WXD A;  2DSY A;  4J8Z A;  2PRT A;  2EM0 A;  2EMZ A;  1BBO A;  2YU5 A;  3AUZ A;  1N3G A;  3J7Y p;  1N33 E;  3HPS A;  2MDG A;  4DKK A;  2KON A;  2R1F A;  1B69 A;  2EPL X;  2EPC A;  2HC5 A;  2EOM A;  1WRJ A;  2CT1 A;  2FV4 B;  2JP9 A;  3P1X A;  2G7H A;  2MC5 A;  3VK6 A;  5KL4 A;  4JI0 E;  4NZV A;  4TUI A;  1HNX E;  3ADG A;  1FKA E;  1P47 A;  3EPH A;  4WFT A;  5F3W A;  5A6J A;  1XNR E;  5A2Q C;  4P7D A;  1EH6 A;  1YUJ A;  4JV5 E;  2EMC A;  2YTD A;  1SFE A;  3HQ1 A;  3MSW A;  1PJS A;  1EKZ A;  1YZ9 A;  2KOU A;  3IWC A;  2EM5 A;  1YSA C;  5T6J A;  3QG5 C;  1DGC A;  2EMF A;  2ZM6 E;  2V85 A;  2NA2 A;  5LL6 R;  2EML A;  5KL7 A;  2YTF A;  4DR4 E;  1PJT A;  2EL4 A;  4GZN C;  2LV2 A;  1KJK A;  1LLM C;  2JYA A;  2V83 A;  3THN A;  4LFC E;  4M9V C;  2EMH A;  4LF4 E;  4Q28 A;  4YY3 E;  3DF6 A;  2GHF A;  2GPI A;  4R2D A;  1MGT A;  1JK2 A;  2LE2 A;  3THO B;  2VQE E;  1UIL A;  2CPN A;  1GQE A;  2EMX A;  4K0K E;  4B3S E;  2Q8U A;  1A1I A;  2LRS A;  1T4O A;  1YUI A;  2EOE A;  2GLI A;  3RMP A;  2EOX A;  5IT9 C;  2EM4 A;  2R76 A;  1N36 E;  1IBL E;  2K7I A;  4I8O A;  4F9B B;  4LFA E;  4O5G A;  4NXM E;  4GKJ E;  1A1F A;  1YFH A;  2EPO A;  4DV2 E;  2EN2 A;  1TF6 A;  2A25 A;  5KL5 A;  2ELY A;  4DV6 E;  4YHH E;  1DQ3 A;  2EOQ A;  2YRH A;  4RHB B;  4JI8 E;  2EMI A;  3MHH C;  3KZY A;  4WPY A;  2EM9 A;  2EE8 A;  1L4S A;  3ADI A;  2I9I A;  2EN3 A;  1YYO A;  2I13 A;  2EM6 A;  2UXD E;  1IQO A;  3JAM C;  1T38 A;  2IHR 1;  4JI7 E;  3VYY A;  4JI5 E;  4F9A B;  1RMD A;  3EPL A;  3C6K A;  1PDA A;  2MKN A;  4X62 E;  2WBT A;  2YSO A;  4BHC A;  4KWY A;  2HJJ A;  5CFF E;  2L2M A;  5ADZ A;  4DV5 E;  1X48 A;  2N3G A;  4HEI A;  4R2P A;  2YRK A;  4P78 A;  4DV0 E;  2B7V A;  4JI3 E;  4RH8 A;  2LT7 A;  4IJD A;  4B3R E;  1PJQ A;  2YT4 A;  3F6G A;  3FIG A;  2H36 X;  5IWA E;  1RQ0 A;  2M4I A;  1ZBQ A;  3AV0 A;  4JI1 E;  4OOG C;  5LMU E;  1QU6 A;  2JOX A;  2ODR C;  2YTJ A;  4R2R A;  1WXR A;  5KL2 A;  2LMZ A;  5AE1 A;  2L2N A;  2LUP B;  2LBS B;  3LML A;  1AH5 A;  2EMW A;  2V88 A;  4OX9 E;  2YWQ A;  5KL3 A;  3OML A;  1YPN A;  2V87 A;  2YPN A;  3ADL A;  1N34 E;  2EQ3 A;  4X9J A;  1A1L A;  3EPJ A;  2VE7 C;  2VF1 A;  2F8B A;  2NUE A;  2WCC 3;  2EN1 A;  4NXN E;  4B3M E;  4GKK E;  3JTZ A;  2YTG A;  4LF8 E;  2EM8 A;  5A6B A;  2CTD A;  5TSE A;  2EPX A;  2EMG A;  5KL6 A;  4DR3 E;  1DI2 A;  1WHQ A;  4IS1 C;  2UXB E;  2M9A A;  5AE2 A;  2WBS A;  4MLV A;  3F6H A;  2EWL A;  2LTS A;  1X6H A;  2L8T A;  1JK1 A;  1J5E E;  2JR1 A;  2YTO A;  2UXC E;  2RTX A;  4BHB A;  1AAY A;  1STU A;  2MDR A;  3KZZ A;  1HR0 E;  3J80 C;  1X3C A;  1XMO E;  2DIX A;  1FJG E;  1X6E A;  4BC7 A;  1PKP A;  1HNZ E;  2ENC A;  1I94 E;  1TN9 A;  1ZR9 A;  4F9C B;  4R2Q A;  1HNW E;  3LLH A;  3C6M A;  1IBM E;  4WSP A;  4MLQ A;  2UUC E;  1NCS A;  4DUY E;  3IWB A;  2ADR A;  2VRD A;  4DR2 E;  4X66 E;  2ELZ A;  4X65 E;  4ZYH A; 
#chains in the Genus database with same CATH homology
 2MKN A;  1WJP A;  2CT1 A;  2WBT A;  2YSO A;  1ZAA C;  2JP9 A;  2YTN A;  2DLK A;  2MKD A;  1G2D C;  2WBU A;  5KL4 A;  2EM3 A;  2EOH A;  2ENA A;  4R2P A;  2YRK A;  2EPA A;  1P47 A;  3EPH A;  1X5W A;  4R2A A;  1B69 A;  2YTE A;  2LT7 A;  2YTQ A;  4IJD A;  1A1G A;  1G2F C;  2HGH A;  2YU8 A;  2JPA A;  1YUJ A;  2EMC A;  2YTD A;  2D9H A;  2ENH A;  2EQ1 A;  4R2C A;  2EPR A;  1YSA C;  2EM5 A;  2EN8 A;  1X6F A;  4F6M A;  1A1K A;  2EM7 A;  2EJ4 A;  1DGC A;  2EQ0 A;  2EN6 A;  2EMF A;  3MHS C;  2EL6 A;  2CSH A;  2EOS A;  2YTI A;  2EOZ A;  2EML A;  5KL7 A;  2NAB A;  2LVH A;  2YTF A;  2YTJ A;  2EMB A;  4R2R A;  2EL4 A;  5KL2 A;  2DMI A;  2EOY A;  2RSI A;  4GZN C;  2LV2 A;  4R2S A;  1LLM C;  2EMW A;  1KJK A;  4F6N A;  4M9V C;  2EOJ A;  2EMH A;  5KL3 A;  2GHF A;  4R2D A;  2YSP A;  1JK2 A;  2EPZ A;  2EQ3 A;  4X9J A;  2DGC A;  2EL5 A;  3EPJ A;  1A1L A;  4R2E A;  2EMX A;  2WCC 3;  1A1I A;  2EN1 A;  1A1J A;  2J7J A;  2EMA A;  2YRM A;  1YUI A;  2EOE A;  2YTG A;  2GLI A;  2EM8 A;  2CTD A;  2EOX A;  1MEY C;  2EPX A;  2LCE A;  2DLQ A;  2EOF A;  2EM4 A;  2EMG A;  5KL6 A;  4IS1 C;  2M9A A;  2E72 A;  2EP3 A;  2RPC A;  2WBS A;  2EOO A;  2EPU A;  1F2I G;  1Z1B A;  2YTP A;  2EOI A;  3EPL A;  4F2J C;  1X6H A;  1A1F A;  2EPP A;  2EOR A;  1JK1 A;  2YTO A;  1BB8 A;  2EN2 A;  3UK3 C;  2A25 A;  1TF6 A;  2LO3 A;  5KL5 A;  2EMY A;  1UBD C;  2ELY A;  1AAY A;  3EPK A;  2EN4 A;  1X3C A;  2EOQ A;  1TF3 A;  2YRH A;  2EMI A;  1X6E A;  3MHH C;  2EN7 A;  1A1H A;  2EM9 A;  2EE8 A;  1ZU1 A;  1TN9 A;  2EM2 A;  2ENC A;  4WSG A;  2DRP A;  1ZR9 A;  4R2Q A;  2EN3 A;  2PRT A;  3M99 B;  2EM0 A;  2I13 A;  2EMZ A;  2EM6 A;  1BBO A;  1NCS A;  2YU5 A;  3VHT B;  2ADR A;  2VRD A;  1UN6 B;  2ELZ A;  2EMK A;  4FK5 C;  2MDG A;  1RMD A;  2R1F A;  2EPC A;  2BB8 A;  2EOM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...