2EMFA

Solution structure of the c2h2 type zinc finger (region 379-411) of human zinc finger protein 484
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGGKHFECTECGKAFTRKSTLSMHQKIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 379-411) of human Zinc finger protein 484
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 484
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emfA01
2EMGA 2EN3A 2J7JA 2CT1A 4FK5C 4R2PA 2BB8A 2EM0A 1P47A 2M9AA 3EPJA 1X6HA 2EN1A 2EN6A 2EMKA 2LT7A 1G2FC 1A1JA 2EM9A 5KL4A 2EPZA 2I13A 2ENCA 2JP9A 2DMIA 2EPXA 2EL5A 2EMBA 2EPCA 1A1HA 2EMZA 2PRTA 2EOOA 5KL6A 1AAYA 2EL4A 2ENAA 3EPKA 4GZNC 2GHFA 1YUJA 2YTNA 2EM2A 1A1KA 2EQ3A 2YTGA 2EOMA 2EN8A 2WBUA 2DLKA 2EMLA 4M9VC 2MKDA 2ENHA 4F6MA 1UN6B 4R2DA 1TF3A 1A1LA 2EQ1A 2EOXA 1B69A 1TF6A 4R2SA 2RSIA 2D9HA 2DGCA 2ADRA 2EMCA 1KJKA 4R2CA 1TN9A 2EM4A 2EOFA 2EOQA 2EOJA 2YRKA 1ZAAC 2YTEA 3UK3C 5KL7A 2YTFA 2YRMA 3M99B 1X5WA 2EMIA 2EQ0A 2DLQA 1DGCA 4WSGA 2MKNA 2EP3A 2ELZA 2MDGA 4X9JA 1RMDA 4F6NA 1JK1A 2RPCA 2YTPA 2EORA 1YUIA 3VHTB 2EMFA 2YTJA 2EM5A 4R2AA 1G2DC 2EOYA 2R1FA 2EN4A 2EL6A 5KL2A 1A1FA 2EMYA 2EN7A 2EMAA 1YSAC 2HGHA 2LVHA 2JPAA 2LCEA 1BB8A 5KL5A 1Z1BA 1A1GA 2E72A 5KL3A 4R2RA 1UBDC 2GLIA 1JK2A 2EMHA 2YTIA 2YTQA 2EOSA 2EOZA 2NABA 1BBOA 2EMWA 2LV2A 2EE8A 2EPAA 2CTDA 1LLMC 2LO3A 4IJDA 2DRPA 2EOIA 1ZR9A 2WBTA 2EPUA 2EPPA 2YSOA 4R2EA 3EPLA 2WCC3 2EPRA 2ELYA 2YU8A 2EJ4A 4IS1C 2EMXA 1WJPA 1X6EA 3MHHC 1F2IG 2WBSA 4F2JC 4R2QA 2CSHA 2EN2A 1X3CA 1X6FA 2VRDA 2YTOA 1NCSA 2A25A 2EM7A 2YRHA 3MHSC 1A1IA 2YU5A 2EM3A 2EM8A 2EOEA 2EOHA 2YTDA 3EPHA 2EM6A 2YSPA 1ZU1A 1MEYC
chains in the Genus database with same CATH superfamily
4OX9E 3KZYA 2NA2A 2UU9E 2CT1A 2YT4A 2ZM6E 2MDRA 2UUBE 3BIDA 1HNWE 1EH8A 2M1SA 2LTSA 2LUQA 4GEQB 1SFEA 2M9AA 1GTKA 4KWYA 2B3TB 5AC5A 1N33E 1SR9A 2EMKA 3VK6A 1HNZE 2JOBA 3LLHA 2EM9A 5KL4A 2EPZA 4BC9A 2JY9A 1UILA 1PJTA 3KZZA 2L8TA 2V86A 4B3RE 2ODRC 3HTXA 2V88A 2PRTA 5IV8B 5KL6A 4M0VA 3EPKA 2GHFA 1YUJA 4JI2E 1A1KA 2WBUA 1XNRE 2V8QB 4M30A 2DSYA 4DV1E 2ENHA 1YFHA 2G7HA 4R8OA 1PJSA 2RSIA 2DGCA 3ADLA 1KJKA 4LF7E 2EM4A 3THOB 2VQEE 2EOFA 3JAMC 3RMPA 4DMIA 1ZAAC 5KL7A 4YHHE 2FTXB 4DV7E 2DB2A 1QNTA 1WHNA 3F6GA 1RMDA 1JK1A 2E5LE 2LJUA 2EORA 3VHTB 2YTJA 1X47A 4R2AA 2EOYA 4JI4E 2NUGA 2M4IA 2EL6A 2EMYA 1YSAC 1HR0E 2L2NA 2LCEA 1BB8A 5KL5A 2NUFA 2YZTA 2E72A 5KL3A 4R2RA 4WPYA 4WXCA 3IWCA 3TQMA 3IWBA 1LLMC 4HTGA 2KHXA 1XMQE 1YYOA 2EPUA 2YSOA 3EPLA 2ELYA 4BHBA 2RSMA 4DUYE 1N36E 2L6MA 4LFCE 2UXBE 4RHBB 2VRDA 2A25A 2EM7A 2YRHA 3BGHA 4WFTA 2EM8A 2YTDA 1FKAE 4RH8A 4Q28A 4X64E 4KHPE 2GPIA 4FK5C 4R2PA 2V87A 4WYQB 4AQYE 4DKKA 3J7Yp 4B3ME 4GKJE 2EM0A 5AE3A 1X6HA 2EN1A 2V83A 4JI1E 2LT7A 1YYKA 4JI8E 2VQFE 2ENCA 1HNXE 2EPXA 2EL5A 2EPCA 4BS9A 2EMZA 1EH6A 3JU0A 4WSPA 5LMUE 2RQLA 1XMOE 5DNYA 1AAYA 2ENAA 3BF2A 3L00A 5T6JA 2WZOA 2LE2A 2YTGA 1IBME 3H09A 4M9VC 4BCAA 2MKDA 3HQ1A 4WX9A 5LL6R 2BBGA 1A1LA 2EQ1A 1TF6A 4DV2E 5A2QC 2ADRA 4R2CA 3OTOE 1RQ0A 2RS6A 2EOQA 2EOJA 1IQSA 2YRKA 2V85A 4BHCA 2YRMA 4ZYHA 3UK3C 2EQ0A 1IMUA 3VYXA 2F4VE 2B7VA 2B9DA 2JR1A 4LFAE 2FV4B 2YTPA 1YUIA 2JVAA 5A69A 2EMFA 2EM5A 1G2DC 1QU6A 2EN4A 3THNA 1A1FA 4MLQA 2EN7A 2LVHA 4I8OA 4KZSA 4LF5E 2KONA 4X62E 1Z1BA 4DV0E 1WXRA 3QG5C 4R03A 3AUZA 4LTYA 4K0KE 2EMHA 4TUIA 4X8WA 2YTIA 2N8XA 4DR2E 2EMWA 4HEIA 2B7TA 4J8ZA 3OMLA 2LO3A 1YZ9A 2R76A 4R2EA 2YU8A 2V89A 4L8NA 1EKZA 1ZBQA 1YPNA 1X6EA 5CFFE 4O24A 3DJWA 4R2QA 1T4NA 2CSHA 1IBLE 1X3CA 2FGGA 3ADJA 2YTOA 3EPHA 2EOEA 2HHHE 4ZYDA 2F8BA 2EM6A 5F3WA 1ZU1A 1T4LB 1O0WA 2BB8A 2EPLX 5ADZA 4JI0E 4DR5E 3EPJA 1X49A 4X65E 1YYWA 1A1JA 3JTZA 1WHQA 2I13A 4B3TE 2JP9A 2DMIA 1WRJA 5BR8E 1T39A 1A1HA 4JI6E 2LRSA 2EOOA 2L2MA 2EL4A 4OOGC 2MC5A 4MLVA 1IBKE 5TSEA 4LF9E 4BBYA 2EM2A 4JI3E 2EOMA 2EN8A 1DI2A 2DLKA 2EMLA 2Q8UA 4F6MA 4R2DA 2JXPA 2LMZA 2UXCE 2EOXA 2N3HA 1B69A 2D9HA 4F9AB 1IQOA 5AE2A 3C6KA 1FJGE 1TN9A 4N4RB 1PDAA 2MC6A 4LFBE 2UXDE 1MEYC 3LMLA 2IHR1 2YTEA 3F6HA 2EPKX 5AC4A 2MKNA 2EP3A 2ELZA 2MDGA 4ZYEA 2LJHA 4F6NA 3C4TA 4NHRA 4LU9A 4L5NC 2K7IA 1UHZA 4O43A 1RC7A 2L92A 2R1FA 5A6BD 5KL2A 5FLXC 2EMAA 2EWLA 4LF4E 3HPSA 2LBSB 5AE1A 5IXMB 4TUGA 1A1GA 1UBDC 2GLIA 1JK2A 2NABA 4DR1E 2LV2A 5IWAE 2DMYA 2EE8A 2EPAA 2RS7A 2DRPA 1ZR9A 4NZVA 1I94E 2EPPA 2WCC3 2H36X 4IS1C 2CPNA 4ZYGA 3MHHC 3C4BA 4DR7E 2EN2A 1STUA 3ZOQB 3ECRA 1X6FA 1NCSA 1NEIA 2JOXA 4DR4E 2YU5A 2EM3A 4DR3E 2YSPA 4DV6E 1GZ6A 4DV5E 2EMGA 1N34E 2EN3A 3T1HE 2J7JA 3T1YE 1X48A 3P1XA 2L2KB 4LF8E 4DV4E 4YY3E 4O4KA 1P47A 5A6KA 4F9CB 2LUPB 2RTXA 4NXME 2EN6A 2L3JA 2L33A 1G2FC 1N32E 4O5GA 1T4OA 4JYAE 2EMBA 2HJJA 3BBGA 2EPMX 2I9IA 4GZNC 4M2ZA 2YTNA 1L4SA 2EQ3A 4DUZE 3HPZA 3KWRA 1PJQA 1PKPA 3C6MA 2UUCE 1UN6B 1TF3A 1EH7A 1KYQA 3EQ1A 3IWDA 4R2SA 4NXNE 3J7AG 2EMCA 3FIGA 2EZ6A 5A6JA 2LTRA 2E1MA 2K4VA 3ADIA 4B3SE 2YTFA 3HXLA 3M99B 1X5WA 5LLQA 2EMIA 4P7DA 4JI7E 2DLQA 4BC7A 1T38A 1DGCA 3VYYA 2JYAA 2N3GA 2YPNA 3ADGA 4WSGA 4DV3E 1AH5A 4BMJA 5LMNE 4X9JA 4WXDA 4X66E 2RPCA 2EPOA 5AASA 2JWOA 2DIXA 3MSWA 4JI5E 4GKKE 4Q35B 5A6AA 2HGHA 4F54A 2JPAA 4LF6E 5A6BA 3J81C 2L3CA 2YWQA 2ODRD 2VF1A 1XNQE 2UUAE 2M7QA 3K6QA 1GQEA 2YTQA 2EOSA 2EOZA 1BBOA 2EPNA 1BBGA 2CTDA 3AV0A 4DR6E 4IJDA 2EOIA 2WBTA 2EPRA 1J26A 2EJ4A 3J80C 2HC5A 2EMXA 1WJPA 1N3GA 1ZBTA 4JV5E 1F2IG 2WBSA 4F2JC 1DQ3A 5IT9C 4F9BB 4P78A 2KOUA 3MHSC 1A1IA 2EOHA 1MGTA 1J5EE 2NUEA 2VE7C 3DF6A
chains in the Genus database with same CATH topology
2EMGA 2EN3A 2J7JA 2CT1A 4FK5C 4R2PA 2BB8A 2EM0A 1P47A 2M9AA 3EPJA 1X6HA 2EN1A 2EN6A 2EMKA 2LT7A 1G2FC 1A1JA 2EM9A 5KL4A 2EPZA 2I13A 2ENCA 2JP9A 2DMIA 2EPXA 2EL5A 2EMBA 2EPCA 1A1HA 2EMZA 2PRTA 2EOOA 5KL6A 1AAYA 2EL4A 2ENAA 3EPKA 4GZNC 2GHFA 1YUJA 2YTNA 2EM2A 1A1KA 2EQ3A 2YTGA 2EOMA 2EN8A 2WBUA 2DLKA 2EMLA 4M9VC 2MKDA 2ENHA 4F6MA 1UN6B 4R2DA 1TF3A 1A1LA 2EQ1A 2EOXA 1B69A 1TF6A 4R2SA 2RSIA 2D9HA 2DGCA 2ADRA 2EMCA 1KJKA 4R2CA 1TN9A 2EM4A 2EOFA 2EOQA 2EOJA 2YRKA 1ZAAC 2YTEA 3UK3C 5KL7A 2YTFA 2YRMA 3M99B 1X5WA 2EMIA 2EQ0A 2DLQA 1DGCA 4WSGA 2MKNA 2EP3A 2ELZA 2MDGA 4X9JA 1RMDA 4F6NA 1JK1A 2RPCA 2YTPA 2EORA 1YUIA 3VHTB 2EMFA 2YTJA 2EM5A 4R2AA 1G2DC 2EOYA 2R1FA 2EN4A 2EL6A 5KL2A 1A1FA 2EMYA 2EN7A 2EMAA 1YSAC 2HGHA 2LVHA 2JPAA 2LCEA 1BB8A 5KL5A 1Z1BA 1A1GA 2E72A 5KL3A 4R2RA 1UBDC 2GLIA 1JK2A 2EMHA 2YTIA 2YTQA 2EOSA 2EOZA 2NABA 1BBOA 2EMWA 2LV2A 2EE8A 2EPAA 2CTDA 1LLMC 2LO3A 4IJDA 2DRPA 2EOIA 1ZR9A 2WBTA 2EPUA 2EPPA 2YSOA 4R2EA 3EPLA 2WCC3 2EPRA 2ELYA 2YU8A 2EJ4A 4IS1C 2EMXA 1WJPA 1X6EA 3MHHC 1F2IG 2WBSA 4F2JC 4R2QA 2CSHA 2EN2A 1X3CA 1X6FA 2VRDA 2YTOA 1NCSA 2A25A 2EM7A 2YRHA 3MHSC 1A1IA 2YU5A 2EM3A 2EM8A 2EOEA 2EOHA 2YTDA 3EPHA 2EM6A 2YSPA 1ZU1A 1MEYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMG A;  2EN3 A;  2J7J A;  2CT1 A;  4FK5 C;  4R2P A;  2BB8 A;  2EM0 A;  1P47 A;  2M9A A;  3EPJ A;  1X6H A;  2EN1 A;  2EN6 A;  2EMK A;  2LT7 A;  1G2F C;  1A1J A;  2EM9 A;  5KL4 A;  2EPZ A;  2I13 A;  2ENC A;  2JP9 A;  2DMI A;  2EPX A;  2EL5 A;  2EMB A;  2EPC A;  1A1H A;  2EMZ A;  2PRT A;  2EOO A;  5KL6 A;  1AAY A;  2EL4 A;  2ENA A;  3EPK A;  4GZN C;  2GHF A;  1YUJ A;  2YTN A;  2EM2 A;  1A1K A;  2EQ3 A;  2YTG A;  2EOM A;  2EN8 A;  2WBU A;  2DLK A;  2EML A;  4M9V C;  2MKD A;  2ENH A;  4F6M A;  1UN6 B;  4R2D A;  1TF3 A;  1A1L A;  2EQ1 A;  2EOX A;  1B69 A;  1TF6 A;  4R2S A;  2RSI A;  2D9H A;  2DGC A;  2ADR A;  2EMC A;  1KJK A;  4R2C A;  1TN9 A;  2EM4 A;  2EOF A;  2EOQ A;  2EOJ A;  2YRK A;  1ZAA C;  2YTE A;  3UK3 C;  5KL7 A;  2YTF A;  2YRM A;  3M99 B;  1X5W A;  2EMI A;  2EQ0 A;  2DLQ A;  1DGC A;  4WSG A;  2MKN A;  2EP3 A;  2ELZ A;  2MDG A;  4X9J A;  1RMD A;  4F6N A;  1JK1 A;  2RPC A;  2YTP A;  2EOR A;  1YUI A;  3VHT B;  2EMF A;  2YTJ A;  2EM5 A;  4R2A A;  1G2D C;  2EOY A;  2R1F A;  2EN4 A;  2EL6 A;  5KL2 A;  1A1F A;  2EMY A;  2EN7 A;  2EMA A;  1YSA C;  2HGH A;  2LVH A;  2JPA A;  2LCE A;  1BB8 A;  5KL5 A;  1Z1B A;  1A1G A;  2E72 A;  5KL3 A;  4R2R A;  1UBD C;  2GLI A;  1JK2 A;  2EMH A;  2YTI A;  2YTQ A;  2EOS A;  2EOZ A;  2NAB A;  1BBO A;  2EMW A;  2LV2 A;  2EE8 A;  2EPA A;  2CTD A;  1LLM C;  2LO3 A;  4IJD A;  2DRP A;  2EOI A;  1ZR9 A;  2WBT A;  2EPU A;  2EPP A;  2YSO A;  4R2E A;  3EPL A;  2WCC 3;  2EPR A;  2ELY A;  2YU8 A;  2EJ4 A;  4IS1 C;  2EMX A;  1WJP A;  1X6E A;  3MHH C;  1F2I G;  2WBS A;  4F2J C;  4R2Q A;  2CSH A;  2EN2 A;  1X3C A;  1X6F A;  2VRD A;  2YTO A;  1NCS A;  2A25 A;  2EM7 A;  2YRH A;  3MHS C;  1A1I A;  2YU5 A;  2EM3 A;  2EM8 A;  2EOE A;  2EOH A;  2YTD A;  3EPH A;  2EM6 A;  2YSP A;  1ZU1 A;  1MEY C; 
#chains in the Genus database with same CATH topology
 4OX9 E;  3KZY A;  2NA2 A;  2UU9 E;  2CT1 A;  2YT4 A;  2ZM6 E;  2MDR A;  2UUB E;  3BID A;  1HNW E;  1EH8 A;  2M1S A;  2LTS A;  2LUQ A;  4GEQ B;  1SFE A;  2M9A A;  1GTK A;  4KWY A;  2B3T B;  5AC5 A;  1N33 E;  1SR9 A;  2EMK A;  3VK6 A;  1HNZ E;  2JOB A;  3LLH A;  2EM9 A;  5KL4 A;  2EPZ A;  4BC9 A;  2JY9 A;  1UIL A;  1PJT A;  3KZZ A;  2L8T A;  2V86 A;  4B3R E;  2ODR C;  3HTX A;  2V88 A;  2PRT A;  5IV8 B;  5KL6 A;  4M0V A;  3EPK A;  2GHF A;  1YUJ A;  4JI2 E;  1A1K A;  2WBU A;  1XNR E;  2V8Q B;  4M30 A;  2DSY A;  4DV1 E;  2ENH A;  1YFH A;  2G7H A;  4R8O A;  1PJS A;  2RSI A;  2DGC A;  3ADL A;  1KJK A;  4LF7 E;  2EM4 A;  3THO B;  2VQE E;  2EOF A;  3JAM C;  3RMP A;  4DMI A;  1ZAA C;  5KL7 A;  4YHH E;  2FTX B;  4DV7 E;  2DB2 A;  1QNT A;  1WHN A;  3F6G A;  1RMD A;  1JK1 A;  2E5L E;  2LJU A;  2EOR A;  3VHT B;  2YTJ A;  1X47 A;  4R2A A;  2EOY A;  4JI4 E;  2NUG A;  2M4I A;  2EL6 A;  2EMY A;  1YSA C;  1HR0 E;  2L2N A;  2LCE A;  1BB8 A;  5KL5 A;  2NUF A;  2YZT A;  2E72 A;  5KL3 A;  4R2R A;  4WPY A;  4WXC A;  3IWC A;  3TQM A;  3IWB A;  1LLM C;  4HTG A;  2KHX A;  1XMQ E;  1YYO A;  2EPU A;  2YSO A;  3EPL A;  2ELY A;  4BHB A;  2RSM A;  4DUY E;  1N36 E;  2L6M A;  4LFC E;  2UXB E;  4RHB B;  2VRD A;  2A25 A;  2EM7 A;  2YRH A;  3BGH A;  4WFT A;  2EM8 A;  2YTD A;  1FKA E;  4RH8 A;  4Q28 A;  4X64 E;  4KHP E;  2GPI A;  4FK5 C;  4R2P A;  2V87 A;  4WYQ B;  4AQY E;  4DKK A;  3J7Y p;  4B3M E;  4GKJ E;  2EM0 A;  5AE3 A;  1X6H A;  2EN1 A;  2V83 A;  4JI1 E;  2LT7 A;  1YYK A;  4JI8 E;  2VQF E;  2ENC A;  1HNX E;  2EPX A;  2EL5 A;  2EPC A;  4BS9 A;  2EMZ A;  1EH6 A;  3JU0 A;  4WSP A;  5LMU E;  2RQL A;  1XMO E;  5DNY A;  1AAY A;  2ENA A;  3BF2 A;  3L00 A;  5T6J A;  2WZO A;  2LE2 A;  2YTG A;  1IBM E;  3H09 A;  4M9V C;  4BCA A;  2MKD A;  3HQ1 A;  4WX9 A;  5LL6 R;  2BBG A;  1A1L A;  2EQ1 A;  1TF6 A;  4DV2 E;  5A2Q C;  2ADR A;  4R2C A;  3OTO E;  1RQ0 A;  2RS6 A;  2EOQ A;  2EOJ A;  1IQS A;  2YRK A;  2V85 A;  4BHC A;  2YRM A;  4ZYH A;  3UK3 C;  2EQ0 A;  1IMU A;  3VYX A;  2F4V E;  2B7V A;  2B9D A;  2JR1 A;  4LFA E;  2FV4 B;  2YTP A;  1YUI A;  2JVA A;  5A69 A;  2EMF A;  2EM5 A;  1G2D C;  1QU6 A;  2EN4 A;  3THN A;  1A1F A;  4MLQ A;  2EN7 A;  2LVH A;  4I8O A;  4KZS A;  4LF5 E;  2KON A;  4X62 E;  1Z1B A;  4DV0 E;  1WXR A;  3QG5 C;  4R03 A;  3AUZ A;  4LTY A;  4K0K E;  2EMH A;  4TUI A;  4X8W A;  2YTI A;  2N8X A;  4DR2 E;  2EMW A;  4HEI A;  2B7T A;  4J8Z A;  3OML A;  2LO3 A;  1YZ9 A;  2R76 A;  4R2E A;  2YU8 A;  2V89 A;  4L8N A;  1EKZ A;  1ZBQ A;  1YPN A;  1X6E A;  5CFF E;  4O24 A;  3DJW A;  4R2Q A;  1T4N A;  2CSH A;  1IBL E;  1X3C A;  2FGG A;  3ADJ A;  2YTO A;  3EPH A;  2EOE A;  2HHH E;  4ZYD A;  2F8B A;  2EM6 A;  5F3W A;  1ZU1 A;  1T4L B;  1O0W A;  2BB8 A;  2EPL X;  5ADZ A;  4JI0 E;  4DR5 E;  3EPJ A;  1X49 A;  4X65 E;  1YYW A;  1A1J A;  3JTZ A;  1WHQ A;  2I13 A;  4B3T E;  2JP9 A;  2DMI A;  1WRJ A;  5BR8 E;  1T39 A;  1A1H A;  4JI6 E;  2LRS A;  2EOO A;  2L2M A;  2EL4 A;  4OOG C;  2MC5 A;  4MLV A;  1IBK E;  5TSE A;  4LF9 E;  4BBY A;  2EM2 A;  4JI3 E;  2EOM A;  2EN8 A;  1DI2 A;  2DLK A;  2EML A;  2Q8U A;  4F6M A;  4R2D A;  2JXP A;  2LMZ A;  2UXC E;  2EOX A;  2N3H A;  1B69 A;  2D9H A;  4F9A B;  1IQO A;  5AE2 A;  3C6K A;  1FJG E;  1TN9 A;  4N4R B;  1PDA A;  2MC6 A;  4LFB E;  2UXD E;  1MEY C;  3LML A;  2IHR 1;  2YTE A;  3F6H A;  2EPK X;  5AC4 A;  2MKN A;  2EP3 A;  2ELZ A;  2MDG A;  4ZYE A;  2LJH A;  4F6N A;  3C4T A;  4NHR A;  4LU9 A;  4L5N C;  2K7I A;  1UHZ A;  4O43 A;  1RC7 A;  2L92 A;  2R1F A;  5A6B D;  5KL2 A;  5FLX C;  2EMA A;  2EWL A;  4LF4 E;  3HPS A;  2LBS B;  5AE1 A;  5IXM B;  4TUG A;  1A1G A;  1UBD C;  2GLI A;  1JK2 A;  2NAB A;  4DR1 E;  2LV2 A;  5IWA E;  2DMY A;  2EE8 A;  2EPA A;  2RS7 A;  2DRP A;  1ZR9 A;  4NZV A;  1I94 E;  2EPP A;  2WCC 3;  2H36 X;  4IS1 C;  2CPN A;  4ZYG A;  3MHH C;  3C4B A;  4DR7 E;  2EN2 A;  1STU A;  3ZOQ B;  3ECR A;  1X6F A;  1NCS A;  1NEI A;  2JOX A;  4DR4 E;  2YU5 A;  2EM3 A;  4DR3 E;  2YSP A;  4DV6 E;  1GZ6 A;  4DV5 E;  2EMG A;  1N34 E;  2EN3 A;  3T1H E;  2J7J A;  3T1Y E;  1X48 A;  3P1X A;  2L2K B;  4LF8 E;  4DV4 E;  4YY3 E;  4O4K A;  1P47 A;  5A6K A;  4F9C B;  2LUP B;  2RTX A;  4NXM E;  2EN6 A;  2L3J A;  2L33 A;  1G2F C;  1N32 E;  4O5G A;  1T4O A;  4JYA E;  2EMB A;  2HJJ A;  3BBG A;  2EPM X;  2I9I A;  4GZN C;  4M2Z A;  2YTN A;  1L4S A;  2EQ3 A;  4DUZ E;  3HPZ A;  3KWR A;  1PJQ A;  1PKP A;  3C6M A;  2UUC E;  1UN6 B;  1TF3 A;  1EH7 A;  1KYQ A;  3EQ1 A;  3IWD A;  4R2S A;  4NXN E;  3J7A G;  2EMC A;  3FIG A;  2EZ6 A;  5A6J A;  2LTR A;  2E1M A;  2K4V A;  3ADI A;  4B3S E;  2YTF A;  3HXL A;  3M99 B;  1X5W A;  5LLQ A;  2EMI A;  4P7D A;  4JI7 E;  2DLQ A;  4BC7 A;  1T38 A;  1DGC A;  3VYY A;  2JYA A;  2N3G A;  2YPN A;  3ADG A;  4WSG A;  4DV3 E;  1AH5 A;  4BMJ A;  5LMN E;  4X9J A;  4WXD A;  4X66 E;  2RPC A;  2EPO A;  5AAS A;  2JWO A;  2DIX A;  3MSW A;  4JI5 E;  4GKK E;  4Q35 B;  5A6A A;  2HGH A;  4F54 A;  2JPA A;  4LF6 E;  5A6B A;  3J81 C;  2L3C A;  2YWQ A;  2ODR D;  2VF1 A;  1XNQ E;  2UUA E;  2M7Q A;  3K6Q A;  1GQE A;  2YTQ A;  2EOS A;  2EOZ A;  1BBO A;  2EPN A;  1BBG A;  2CTD A;  3AV0 A;  4DR6 E;  4IJD A;  2EOI A;  2WBT A;  2EPR A;  1J26 A;  2EJ4 A;  3J80 C;  2HC5 A;  2EMX A;  1WJP A;  1N3G A;  1ZBT A;  4JV5 E;  1F2I G;  2WBS A;  4F2J C;  1DQ3 A;  5IT9 C;  4F9B B;  4P78 A;  2KOU A;  3MHS C;  1A1I A;  2EOH A;  1MGT A;  1J5E E;  2NUE A;  2VE7 C;  3DF6 A; 
#chains in the Genus database with same CATH homology
 2EMG A;  2EN3 A;  2J7J A;  2CT1 A;  4FK5 C;  4R2P A;  2BB8 A;  2EM0 A;  1P47 A;  2M9A A;  3EPJ A;  1X6H A;  2EN1 A;  2EN6 A;  2EMK A;  2LT7 A;  1G2F C;  1A1J A;  2EM9 A;  5KL4 A;  2EPZ A;  2I13 A;  2ENC A;  2JP9 A;  2DMI A;  2EPX A;  2EL5 A;  2EMB A;  2EPC A;  1A1H A;  2EMZ A;  2PRT A;  2EOO A;  5KL6 A;  1AAY A;  2EL4 A;  2ENA A;  3EPK A;  4GZN C;  2GHF A;  1YUJ A;  2YTN A;  2EM2 A;  1A1K A;  2EQ3 A;  2YTG A;  2EOM A;  2EN8 A;  2WBU A;  2DLK A;  2EML A;  4M9V C;  2MKD A;  2ENH A;  4F6M A;  1UN6 B;  4R2D A;  1TF3 A;  1A1L A;  2EQ1 A;  2EOX A;  1B69 A;  1TF6 A;  4R2S A;  2RSI A;  2D9H A;  2DGC A;  2ADR A;  2EMC A;  1KJK A;  4R2C A;  1TN9 A;  2EM4 A;  2EOF A;  2EOQ A;  2EOJ A;  2YRK A;  1ZAA C;  2YTE A;  3UK3 C;  5KL7 A;  2YTF A;  2YRM A;  3M99 B;  1X5W A;  2EMI A;  2EQ0 A;  2DLQ A;  1DGC A;  4WSG A;  2MKN A;  2EP3 A;  2ELZ A;  2MDG A;  4X9J A;  1RMD A;  4F6N A;  1JK1 A;  2RPC A;  2YTP A;  2EOR A;  1YUI A;  3VHT B;  2EMF A;  2YTJ A;  2EM5 A;  4R2A A;  1G2D C;  2EOY A;  2R1F A;  2EN4 A;  2EL6 A;  5KL2 A;  1A1F A;  2EMY A;  2EN7 A;  2EMA A;  1YSA C;  2HGH A;  2LVH A;  2JPA A;  2LCE A;  1BB8 A;  5KL5 A;  1Z1B A;  1A1G A;  2E72 A;  5KL3 A;  4R2R A;  1UBD C;  2GLI A;  1JK2 A;  2EMH A;  2YTI A;  2YTQ A;  2EOS A;  2EOZ A;  2NAB A;  1BBO A;  2EMW A;  2LV2 A;  2EE8 A;  2EPA A;  2CTD A;  1LLM C;  2LO3 A;  4IJD A;  2DRP A;  2EOI A;  1ZR9 A;  2WBT A;  2EPU A;  2EPP A;  2YSO A;  4R2E A;  3EPL A;  2WCC 3;  2EPR A;  2ELY A;  2YU8 A;  2EJ4 A;  4IS1 C;  2EMX A;  1WJP A;  1X6E A;  3MHH C;  1F2I G;  2WBS A;  4F2J C;  4R2Q A;  2CSH A;  2EN2 A;  1X3C A;  1X6F A;  2VRD A;  2YTO A;  1NCS A;  2A25 A;  2EM7 A;  2YRH A;  3MHS C;  1A1I A;  2YU5 A;  2EM3 A;  2EM8 A;  2EOE A;  2EOH A;  2YTD A;  3EPH A;  2EM6 A;  2YSP A;  1ZU1 A;  1MEY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...