2EMFA

Solution structure of the c2h2 type zinc finger (region 379-411) of human zinc finger protein 484
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
b'GSSGSSGTGGKHFECTECGKAFTRKSTLSMHQKIHTGEKPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 484
publication title Solution structure of the C2H2 type zinc finger (region 379-411) of human Zinc finger protein 484
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emfA01
2EOMA 5KL4A 2EL5A 2EOEA 2RSIA 2ENCA 1A1GA 1TN9A 1NCSA 1X6FA 2EM9A 2YTGA 2JPAA 2WBTA 2YRKA 2HGHA 1A1IA 2EPAA 2E72A 2EMKA 3EPHA 1MEYC 4IS1C 2EOOA 2EM6A 4X9JA 2EN8A 2ELZA 3VHTB 1A1HA 2YRHA 5KL5A 4M9VC 3MHHC 1P47A 2R1FA 5KL6A 1ZR9A 2EMIA 2EOXA 2ENHA 2EMXA 2EOJA 1LLMC 4R2AA 2EOHA 2LVHA 2YU8A 1UBDC 2WBSA 2YTEA 1UN6B 3EPKA 3EPJA 2EN3A 1A1FA 1A1JA 4R2QA 2EN2A 3EPLA 1ZU1A 2EOQA 2EQ1A 2EMLA 2EM2A 2EMFA 2EN1A 4FK5C 1BBOA 2EM7A 2DGCA 2EPUA 4IJDA 2YSOA 1X3CA 4R2EA 2A25A 3M99B 2EPZA 2YTFA 3MHSC 2EPXA 2ENAA 2EM3A 1Z1BA 2VRDA 2EORA 1DGCA 2EMCA 2EJ4A 5KL2A 1JK2A 2M9AA 2MKDA 1G2DC 2PRTA 1ZAAC 5KL7A 1JK1A 2JP9A 2EM8A 2CTDA 2WCC3 2GHFA 2MKNA 2EPPA 1RMDA 2LV2A 2LCEA 1WJPA 2EPRA 1BB8A 2EMGA 2J7JA 2DLQA 1X6HA 2EOFA 4R2SA 1YUJA 2EOZA 1TF3A 2CSHA 2EMAA 1YUIA 2EOYA 2EL4A 2YRMA 2YTOA 2I13A 2EN6A 2RPCA 4R2PA 2NABA 2ELYA 2BB8A 2MDGA 4GZNC 3UK3C 2EM4A 1F2IG 1KJKA 5KL3A 2DMIA 2EN7A 2EN4A 2LO3A 2CT1A 2EPCA 1X5WA 4F6NA 2YU5A 2EM5A 2YSPA 2EL6A 2YTNA 4WSGA 1B69A 1A1LA 2EMYA 2EMWA 2YTIA 2YTJA 2EMBA 2EQ3A 2EOIA 2YTDA 1AAYA 4F6MA 2DLKA 2EP3A 1X6EA 2EQ0A 2D9HA 4R2CA 2EMHA 1G2FC 1TF6A 1A1KA 2YTPA 2WBUA 4R2RA 2DRPA 2ADRA 1YSAC 2GLIA 2EE8A 4R2DA 2EMZA 4F2JC 2LT7A 2EOSA 2YTQA 2EM0A
chains in the Genus database with same CATH superfamily
3HPSA 3MSWA 1A1GA 2RSIA 1O0WA 2ENCA 1TN9A 1X6FA 2N3GA 2JPAA 2JXPA 3BGHA 2YRKA 2LJHA 4GEQB 2RTXA 1MEYC 2V87A 4DV2E 4X9JA 3C6KA 4K0KE 1KYQA 3ADIA 1HNWE 3VHTB 3MHHC 1P47A 2ENHA 2EOJA 4R2AA 2UUAE 2EOHA 2JOXA 1N33E 3EPKA 5LMNE 4R2QA 5A2QC 3C6MA 1ZU1A 1T4LB 2EMLA 3BF2A 5A6JA 2DGCA 3J81C 2RSMA 3AUZA 2YSOA 4WFTA 4DV4E 4NXNE 1T38A 3KZZA 1DI2A 5IV8B 1I94E 2EPXA 2MC5A 2WZOA 1PDAA 1Z1BA 1J5EE 1IBME 4LF5E 2DB2A 1IMUA 2UUBE 4DV7E 2PRTA 2VF1A 2EPNA 1JK1A 2EPKX 1WJPA 2L8TA 3HQ1A 2DMYA 1BB8A 1WRJA 4R2SA 2NUGA 2HJJA 4LU9A 4MLQA 2CSHA 2EMAA 1YUIA 4LF9E 1N3GA 4KHPE 1FKAE 2RPCA 4R2PA 1IQOA 2UXDE 2UUCE 3BBGA 2BB8A 1KJKA 4DR7E 2CT1A 2EPCA 3C4TA 4TUIA 2RQLA 4BHCA 1X49A 4WSGA 1B69A 2F4VE 2YTJA 4LFCE 1AAYA 3DJWA 4O5GA 4DV6E 1HNZE 2EP3A 4DUZE 4ZYHA 4R2CA 4P78A 2LTRA 4WX9A 3ZOQB 4I8OA 1G2FC 4JI2E 1EH6A 1X48A 4R2RA 2DRPA 4DKKA 5A6BA 2EE8A 4R2DA 2UXBE 3KZYA 4B3SE 3TQMA 1XMQE 5KL4A 1YYWA 5ADZA 2EL5A 2EOEA 1WHQA 2YTGA 4ZYGA 4ZYDA 2WBTA 2E5LE 4LF7E 2EPAA 2E72A 3EPHA 1N36E 4RHBB 4GKJE 2HHHE 3JAMC 1IBLE 3ECRA 1A1HA 4M9VC 2E1MA 2R1FA 2EOXA 2LVHA 2YU8A 1UBDC 4X64E 4LFAE 1T4OA 1A1FA 2NUEA 2EPMX 3EPLA 2EM2A 2EN1A 4FK5C 3T1YE 2HC5A 4R8OA 1IQSA 4WYQB 5TSEA 4F9AB 3J80C 3IWBA 1X3CA 4R2EA 4Q28A 1FJGE 1STUA 4OOGC 2H36X 2MDRA 3K6QA 2EM3A 2LUPB 2K7IA 4DR3E 2VQEE 2VQFE 2M9AA 4Q35B 2MKDA 2UXCE 2EPLX 2YZTA 1ZAAC 1AH5A 1RMDA 2LV2A 2LCEA 2M7QA 2B3TB 2J7JA 2DLQA 1X6HA 1YYKA 2FTXB 4DMIA 4WXCA 2FV4B 2V89A 2JOBA 2N8XA 5AE3A 5LMUE 4BCAA 2LE2A 3IWDA 5AC4A 2RS7A 2YT4A 1EKZA 1J26A 2MDGA 4BHBA 2EM4A 1F2IG 1ZBTA 2DMIA 4B3RE 2EN4A 2LO3A 5T6JA 2I9IA 2YU5A 1YZ9A 2EMYA 4DUYE 5A69A 4YY3E 1N32E 2YTDA 2V85A 2DLKA 2CPNA 4J8ZA 4JYAE 5CFFE 5IXMB 1BBGA 1X6EA 4LF8E 3RMPA 4B3TE 3DF6A 3THNA 1TF6A 4F9CB 1A1KA 3F6GA 2YTPA 2WBUA 5AASA 1SFEA 4DR4E 3F6HA 1UILA 2EMZA 1IBKE 2LT7A 4M2ZA 4TUGA 1UN6B 2JP9A 4O24A 2ODRD 2BBGA 4P7DA 3J7Yp 1NCSA 2YPNA 3VK6A 1EH8A 3VYXA 2HGHA 5AE2A 4F54A 2EMKA 2M1SA 4DR2E 1XMOE 3HTXA 4IS1C 2EOOA 2F8BA 2LMZA 4DV3E 2EN8A 2ELZA 2L6MA 2V86A 2YRHA 5KL5A 3H09A 5KL6A 1ZR9A 1PJQA 2EMXA 2JYAA 2R76A 2NUFA 2WBSA 4LF6E 4BBYA 4X65E 4N4RB 1A1JA 3C4BA 2LJUA 2EOQA 1YFHA 1RC7A 4JI7E 2MC6A 2EPUA 4WSPA 4IJDA 4JI3E 2B9DA 5LL6R 4B3ME 2NA2A 2EPZA 2L2MA 1ZBQA 3MHSC 4X66E 3EQ1A 4NXME 4YHHE 4L8NA 2VRDA 2L33A 1WHNA 5BR8E 1UHZA 2EJ4A 2KHXA 3VYYA 2V88A 5KL7A 1T39A 2EM8A 2KOUA 1WXRA 1YPNA 2GHFA 2MKNA 2EPPA 4O4KA 3THOB 4LFBE 3ADGA 2EMGA 1QU6A 1YUJA 2EOZA 1TF3A 2YRMA 2M4IA 2YTOA 1N34E 4GKKE 3BIDA 2LTSA 2FGGA 2NABA 2EZ6A 4DV0E 2ELYA 3KWRA 2ODRC 5FLXC 4GZNC 4L5NC 4M30A 5KL3A 4JI0E 2EN7A 4WXDA 2V83A 3IWCA 5IT9C 2Q8UA 4BC9A 4KZSA 2EMWA 1GQEA 2EMBA 2EQ3A 2EOIA 3ADJA 4DV5E 4F6MA 2EPOA 2D9HA 2K4VA 2DSYA 4DR1E 2EMHA 5A6KA 2ADRA 2KONA 2GLIA 2L92A 4F9BB 2EOSA 4NHRA 2EOMA 1NEIA 2JR1A 1XNQE 2EM9A 4HEIA 2L2KB 1A1IA 3LLHA 1PJTA 2L3CA 5A6AA 4BS9A 1XNRE 2EM6A 4HTGA 1QNTA 4DR6E 2VE7C 4RH8A 4JI4E 2YWQA 4X8WA 1RQ0A 5F3WA 1PJSA 1SR9A 1DQ3A 2EMIA 1LLMC 2G7HA 5AC5A 2LUQA 2YTEA 3EPJA 2EN3A 2EN2A 1EH7A 2EWLA 2EQ1A 3HPZA 2EMFA 3P1XA 2V8QB 1YYOA 1BBOA 2EM7A 1HR0E 4OX9E 4AQYE 2A25A 1X47A 3M99B 2YTFA 2LRSA 1T4NA 1L4SA 2ENAA 2EORA 3JU0A 4DV1E 3OMLA 1DGCA 2EMCA 2ZM6E 3JTZA 3LMLA 1HNXE 5KL2A 1JK2A 2JWOA 1G2DC 4KWYA 2RS6A 3L00A 5AE1A 2CTDA 3FIGA 2WCC3 2LBSB 4JI5E 2EPRA 3OTOE 3T1HE 4BMJA 4DR5E 2EOFA 4BC7A 2JY9A 2B7VA 2JVAA 5A6BD 4LF4E 2EOYA 2EL4A 5DNYA 3HXLA 2I13A 2EN6A 2UU9E 4O43A 2DIXA 2N3HA 2GPIA 2B7TA 3ADLA 2L2NA 4JI8E 3UK3C 4MLVA 4JI6E 3QG5C 1GTKA 4JI1E 1X5WA 4F6NA 5IWAE 2EM5A 2YSPA 2EL6A 1GZ6A 2YTNA 1A1LA 2YTIA 3J7AG 4R03A 2EQ0A 2IHR1 3AV0A 4LTYA 4X62E 5LLQA 1PKPA 4NZVA 1MGTA 1YSAC 4ZYEA 4WPYA 4M0VA 4F2JC 2L3JA 2YTQA 4JV5E 2EM0A
chains in the Genus database with same CATH topology
2EOMA 5KL4A 2EL5A 2EOEA 2RSIA 2ENCA 1A1GA 1TN9A 1NCSA 1X6FA 2EM9A 2YTGA 2JPAA 2WBTA 2YRKA 2HGHA 1A1IA 2EPAA 2E72A 2EMKA 3EPHA 1MEYC 4IS1C 2EOOA 2EM6A 4X9JA 2EN8A 2ELZA 3VHTB 1A1HA 2YRHA 5KL5A 4M9VC 3MHHC 1P47A 2R1FA 5KL6A 1ZR9A 2EMIA 2EOXA 2ENHA 2EMXA 2EOJA 1LLMC 4R2AA 2EOHA 2LVHA 2YU8A 1UBDC 2WBSA 2YTEA 1UN6B 3EPKA 3EPJA 2EN3A 1A1FA 1A1JA 4R2QA 2EN2A 3EPLA 1ZU1A 2EOQA 2EQ1A 2EMLA 2EM2A 2EMFA 2EN1A 4FK5C 1BBOA 2EM7A 2DGCA 2EPUA 4IJDA 2YSOA 1X3CA 4R2EA 2A25A 3M99B 2EPZA 2YTFA 3MHSC 2EPXA 2ENAA 2EM3A 1Z1BA 2VRDA 2EORA 1DGCA 2EMCA 2EJ4A 5KL2A 1JK2A 2M9AA 2MKDA 1G2DC 2PRTA 1ZAAC 5KL7A 1JK1A 2JP9A 2EM8A 2CTDA 2WCC3 2GHFA 2MKNA 2EPPA 1RMDA 2LV2A 2LCEA 1WJPA 2EPRA 1BB8A 2EMGA 2J7JA 2DLQA 1X6HA 2EOFA 4R2SA 1YUJA 2EOZA 1TF3A 2CSHA 2EMAA 1YUIA 2EOYA 2EL4A 2YRMA 2YTOA 2I13A 2EN6A 2RPCA 4R2PA 2NABA 2ELYA 2BB8A 2MDGA 4GZNC 3UK3C 2EM4A 1F2IG 1KJKA 5KL3A 2DMIA 2EN7A 2EN4A 2LO3A 2CT1A 2EPCA 1X5WA 4F6NA 2YU5A 2EM5A 2YSPA 2EL6A 2YTNA 4WSGA 1B69A 1A1LA 2EMYA 2EMWA 2YTIA 2YTJA 2EMBA 2EQ3A 2EOIA 2YTDA 1AAYA 4F6MA 2DLKA 2EP3A 1X6EA 2EQ0A 2D9HA 4R2CA 2EMHA 1G2FC 1TF6A 1A1KA 2YTPA 2WBUA 4R2RA 2DRPA 2ADRA 1YSAC 2GLIA 2EE8A 4R2DA 2EMZA 4F2JC 2LT7A 2EOSA 2YTQA 2EM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOM A;  5KL4 A;  2EL5 A;  2EOE A;  2RSI A;  2ENC A;  1A1G A;  1TN9 A;  1NCS A;  1X6F A;  2EM9 A;  2YTG A;  2JPA A;  2WBT A;  2YRK A;  2HGH A;  1A1I A;  2EPA A;  2E72 A;  2EMK A;  3EPH A;  1MEY C;  4IS1 C;  2EOO A;  2EM6 A;  4X9J A;  2EN8 A;  2ELZ A;  3VHT B;  1A1H A;  2YRH A;  5KL5 A;  4M9V C;  3MHH C;  1P47 A;  2R1F A;  5KL6 A;  1ZR9 A;  2EMI A;  2EOX A;  2ENH A;  2EMX A;  2EOJ A;  1LLM C;  4R2A A;  2EOH A;  2LVH A;  2YU8 A;  1UBD C;  2WBS A;  2YTE A;  1UN6 B;  3EPK A;  3EPJ A;  2EN3 A;  1A1F A;  1A1J A;  4R2Q A;  2EN2 A;  3EPL A;  1ZU1 A;  2EOQ A;  2EQ1 A;  2EML A;  2EM2 A;  2EMF A;  2EN1 A;  4FK5 C;  1BBO A;  2EM7 A;  2DGC A;  2EPU A;  4IJD A;  2YSO A;  1X3C A;  4R2E A;  2A25 A;  3M99 B;  2EPZ A;  2YTF A;  3MHS C;  2EPX A;  2ENA A;  2EM3 A;  1Z1B A;  2VRD A;  2EOR A;  1DGC A;  2EMC A;  2EJ4 A;  5KL2 A;  1JK2 A;  2M9A A;  2MKD A;  1G2D C;  2PRT A;  1ZAA C;  5KL7 A;  1JK1 A;  2JP9 A;  2EM8 A;  2CTD A;  2WCC 3;  2GHF A;  2MKN A;  2EPP A;  1RMD A;  2LV2 A;  2LCE A;  1WJP A;  2EPR A;  1BB8 A;  2EMG A;  2J7J A;  2DLQ A;  1X6H A;  2EOF A;  4R2S A;  1YUJ A;  2EOZ A;  1TF3 A;  2CSH A;  2EMA A;  1YUI A;  2EOY A;  2EL4 A;  2YRM A;  2YTO A;  2I13 A;  2EN6 A;  2RPC A;  4R2P A;  2NAB A;  2ELY A;  2BB8 A;  2MDG A;  4GZN C;  3UK3 C;  2EM4 A;  1F2I G;  1KJK A;  5KL3 A;  2DMI A;  2EN7 A;  2EN4 A;  2LO3 A;  2CT1 A;  2EPC A;  1X5W A;  4F6N A;  2YU5 A;  2EM5 A;  2YSP A;  2EL6 A;  2YTN A;  4WSG A;  1B69 A;  1A1L A;  2EMY A;  2EMW A;  2YTI A;  2YTJ A;  2EMB A;  2EQ3 A;  2EOI A;  2YTD A;  1AAY A;  4F6M A;  2DLK A;  2EP3 A;  1X6E A;  2EQ0 A;  2D9H A;  4R2C A;  2EMH A;  1G2F C;  1TF6 A;  1A1K A;  2YTP A;  2WBU A;  4R2R A;  2DRP A;  2ADR A;  1YSA C;  2GLI A;  2EE8 A;  4R2D A;  2EMZ A;  4F2J C;  2LT7 A;  2EOS A;  2YTQ A;  2EM0 A; 
#chains in the Genus database with same CATH topology
 3HPS A;  3MSW A;  1A1G A;  2RSI A;  1O0W A;  2ENC A;  1TN9 A;  1X6F A;  2N3G A;  2JPA A;  2JXP A;  3BGH A;  2YRK A;  2LJH A;  4GEQ B;  2RTX A;  1MEY C;  2V87 A;  4DV2 E;  4X9J A;  3C6K A;  4K0K E;  1KYQ A;  3ADI A;  1HNW E;  3VHT B;  3MHH C;  1P47 A;  2ENH A;  2EOJ A;  4R2A A;  2UUA E;  2EOH A;  2JOX A;  1N33 E;  3EPK A;  5LMN E;  4R2Q A;  5A2Q C;  3C6M A;  1ZU1 A;  1T4L B;  2EML A;  3BF2 A;  5A6J A;  2DGC A;  3J81 C;  2RSM A;  3AUZ A;  2YSO A;  4WFT A;  4DV4 E;  4NXN E;  1T38 A;  3KZZ A;  1DI2 A;  5IV8 B;  1I94 E;  2EPX A;  2MC5 A;  2WZO A;  1PDA A;  1Z1B A;  1J5E E;  1IBM E;  4LF5 E;  2DB2 A;  1IMU A;  2UUB E;  4DV7 E;  2PRT A;  2VF1 A;  2EPN A;  1JK1 A;  2EPK X;  1WJP A;  2L8T A;  3HQ1 A;  2DMY A;  1BB8 A;  1WRJ A;  4R2S A;  2NUG A;  2HJJ A;  4LU9 A;  4MLQ A;  2CSH A;  2EMA A;  1YUI A;  4LF9 E;  1N3G A;  4KHP E;  1FKA E;  2RPC A;  4R2P A;  1IQO A;  2UXD E;  2UUC E;  3BBG A;  2BB8 A;  1KJK A;  4DR7 E;  2CT1 A;  2EPC A;  3C4T A;  4TUI A;  2RQL A;  4BHC A;  1X49 A;  4WSG A;  1B69 A;  2F4V E;  2YTJ A;  4LFC E;  1AAY A;  3DJW A;  4O5G A;  4DV6 E;  1HNZ E;  2EP3 A;  4DUZ E;  4ZYH A;  4R2C A;  4P78 A;  2LTR A;  4WX9 A;  3ZOQ B;  4I8O A;  1G2F C;  4JI2 E;  1EH6 A;  1X48 A;  4R2R A;  2DRP A;  4DKK A;  5A6B A;  2EE8 A;  4R2D A;  2UXB E;  3KZY A;  4B3S E;  3TQM A;  1XMQ E;  5KL4 A;  1YYW A;  5ADZ A;  2EL5 A;  2EOE A;  1WHQ A;  2YTG A;  4ZYG A;  4ZYD A;  2WBT A;  2E5L E;  4LF7 E;  2EPA A;  2E72 A;  3EPH A;  1N36 E;  4RHB B;  4GKJ E;  2HHH E;  3JAM C;  1IBL E;  3ECR A;  1A1H A;  4M9V C;  2E1M A;  2R1F A;  2EOX A;  2LVH A;  2YU8 A;  1UBD C;  4X64 E;  4LFA E;  1T4O A;  1A1F A;  2NUE A;  2EPM X;  3EPL A;  2EM2 A;  2EN1 A;  4FK5 C;  3T1Y E;  2HC5 A;  4R8O A;  1IQS A;  4WYQ B;  5TSE A;  4F9A B;  3J80 C;  3IWB A;  1X3C A;  4R2E A;  4Q28 A;  1FJG E;  1STU A;  4OOG C;  2H36 X;  2MDR A;  3K6Q A;  2EM3 A;  2LUP B;  2K7I A;  4DR3 E;  2VQE E;  2VQF E;  2M9A A;  4Q35 B;  2MKD A;  2UXC E;  2EPL X;  2YZT A;  1ZAA C;  1AH5 A;  1RMD A;  2LV2 A;  2LCE A;  2M7Q A;  2B3T B;  2J7J A;  2DLQ A;  1X6H A;  1YYK A;  2FTX B;  4DMI A;  4WXC A;  2FV4 B;  2V89 A;  2JOB A;  2N8X A;  5AE3 A;  5LMU E;  4BCA A;  2LE2 A;  3IWD A;  5AC4 A;  2RS7 A;  2YT4 A;  1EKZ A;  1J26 A;  2MDG A;  4BHB A;  2EM4 A;  1F2I G;  1ZBT A;  2DMI A;  4B3R E;  2EN4 A;  2LO3 A;  5T6J A;  2I9I A;  2YU5 A;  1YZ9 A;  2EMY A;  4DUY E;  5A69 A;  4YY3 E;  1N32 E;  2YTD A;  2V85 A;  2DLK A;  2CPN A;  4J8Z A;  4JYA E;  5CFF E;  5IXM B;  1BBG A;  1X6E A;  4LF8 E;  3RMP A;  4B3T E;  3DF6 A;  3THN A;  1TF6 A;  4F9C B;  1A1K A;  3F6G A;  2YTP A;  2WBU A;  5AAS A;  1SFE A;  4DR4 E;  3F6H A;  1UIL A;  2EMZ A;  1IBK E;  2LT7 A;  4M2Z A;  4TUG A;  1UN6 B;  2JP9 A;  4O24 A;  2ODR D;  2BBG A;  4P7D A;  3J7Y p;  1NCS A;  2YPN A;  3VK6 A;  1EH8 A;  3VYX A;  2HGH A;  5AE2 A;  4F54 A;  2EMK A;  2M1S A;  4DR2 E;  1XMO E;  3HTX A;  4IS1 C;  2EOO A;  2F8B A;  2LMZ A;  4DV3 E;  2EN8 A;  2ELZ A;  2L6M A;  2V86 A;  2YRH A;  5KL5 A;  3H09 A;  5KL6 A;  1ZR9 A;  1PJQ A;  2EMX A;  2JYA A;  2R76 A;  2NUF A;  2WBS A;  4LF6 E;  4BBY A;  4X65 E;  4N4R B;  1A1J A;  3C4B A;  2LJU A;  2EOQ A;  1YFH A;  1RC7 A;  4JI7 E;  2MC6 A;  2EPU A;  4WSP A;  4IJD A;  4JI3 E;  2B9D A;  5LL6 R;  4B3M E;  2NA2 A;  2EPZ A;  2L2M A;  1ZBQ A;  3MHS C;  4X66 E;  3EQ1 A;  4NXM E;  4YHH E;  4L8N A;  2VRD A;  2L33 A;  1WHN A;  5BR8 E;  1UHZ A;  2EJ4 A;  2KHX A;  3VYY A;  2V88 A;  5KL7 A;  1T39 A;  2EM8 A;  2KOU A;  1WXR A;  1YPN A;  2GHF A;  2MKN A;  2EPP A;  4O4K A;  3THO B;  4LFB E;  3ADG A;  2EMG A;  1QU6 A;  1YUJ A;  2EOZ A;  1TF3 A;  2YRM A;  2M4I A;  2YTO A;  1N34 E;  4GKK E;  3BID A;  2LTS A;  2FGG A;  2NAB A;  2EZ6 A;  4DV0 E;  2ELY A;  3KWR A;  2ODR C;  5FLX C;  4GZN C;  4L5N C;  4M30 A;  5KL3 A;  4JI0 E;  2EN7 A;  4WXD A;  2V83 A;  3IWC A;  5IT9 C;  2Q8U A;  4BC9 A;  4KZS A;  2EMW A;  1GQE A;  2EMB A;  2EQ3 A;  2EOI A;  3ADJ A;  4DV5 E;  4F6M A;  2EPO A;  2D9H A;  2K4V A;  2DSY A;  4DR1 E;  2EMH A;  5A6K A;  2ADR A;  2KON A;  2GLI A;  2L92 A;  4F9B B;  2EOS A;  4NHR A;  2EOM A;  1NEI A;  2JR1 A;  1XNQ E;  2EM9 A;  4HEI A;  2L2K B;  1A1I A;  3LLH A;  1PJT A;  2L3C A;  5A6A A;  4BS9 A;  1XNR E;  2EM6 A;  4HTG A;  1QNT A;  4DR6 E;  2VE7 C;  4RH8 A;  4JI4 E;  2YWQ A;  4X8W A;  1RQ0 A;  5F3W A;  1PJS A;  1SR9 A;  1DQ3 A;  2EMI A;  1LLM C;  2G7H A;  5AC5 A;  2LUQ A;  2YTE A;  3EPJ A;  2EN3 A;  2EN2 A;  1EH7 A;  2EWL A;  2EQ1 A;  3HPZ A;  2EMF A;  3P1X A;  2V8Q B;  1YYO A;  1BBO A;  2EM7 A;  1HR0 E;  4OX9 E;  4AQY E;  2A25 A;  1X47 A;  3M99 B;  2YTF A;  2LRS A;  1T4N A;  1L4S A;  2ENA A;  2EOR A;  3JU0 A;  4DV1 E;  3OML A;  1DGC A;  2EMC A;  2ZM6 E;  3JTZ A;  3LML A;  1HNX E;  5KL2 A;  1JK2 A;  2JWO A;  1G2D C;  4KWY A;  2RS6 A;  3L00 A;  5AE1 A;  2CTD A;  3FIG A;  2WCC 3;  2LBS B;  4JI5 E;  2EPR A;  3OTO E;  3T1H E;  4BMJ A;  4DR5 E;  2EOF A;  4BC7 A;  2JY9 A;  2B7V A;  2JVA A;  5A6B D;  4LF4 E;  2EOY A;  2EL4 A;  5DNY A;  3HXL A;  2I13 A;  2EN6 A;  2UU9 E;  4O43 A;  2DIX A;  2N3H A;  2GPI A;  2B7T A;  3ADL A;  2L2N A;  4JI8 E;  3UK3 C;  4MLV A;  4JI6 E;  3QG5 C;  1GTK A;  4JI1 E;  1X5W A;  4F6N A;  5IWA E;  2EM5 A;  2YSP A;  2EL6 A;  1GZ6 A;  2YTN A;  1A1L A;  2YTI A;  3J7A G;  4R03 A;  2EQ0 A;  2IHR 1;  3AV0 A;  4LTY A;  4X62 E;  5LLQ A;  1PKP A;  4NZV A;  1MGT A;  1YSA C;  4ZYE A;  4WPY A;  4M0V A;  4F2J C;  2L3J A;  2YTQ A;  4JV5 E;  2EM0 A; 
#chains in the Genus database with same CATH homology
 2EOM A;  5KL4 A;  2EL5 A;  2EOE A;  2RSI A;  2ENC A;  1A1G A;  1TN9 A;  1NCS A;  1X6F A;  2EM9 A;  2YTG A;  2JPA A;  2WBT A;  2YRK A;  2HGH A;  1A1I A;  2EPA A;  2E72 A;  2EMK A;  3EPH A;  1MEY C;  4IS1 C;  2EOO A;  2EM6 A;  4X9J A;  2EN8 A;  2ELZ A;  3VHT B;  1A1H A;  2YRH A;  5KL5 A;  4M9V C;  3MHH C;  1P47 A;  2R1F A;  5KL6 A;  1ZR9 A;  2EMI A;  2EOX A;  2ENH A;  2EMX A;  2EOJ A;  1LLM C;  4R2A A;  2EOH A;  2LVH A;  2YU8 A;  1UBD C;  2WBS A;  2YTE A;  1UN6 B;  3EPK A;  3EPJ A;  2EN3 A;  1A1F A;  1A1J A;  4R2Q A;  2EN2 A;  3EPL A;  1ZU1 A;  2EOQ A;  2EQ1 A;  2EML A;  2EM2 A;  2EMF A;  2EN1 A;  4FK5 C;  1BBO A;  2EM7 A;  2DGC A;  2EPU A;  4IJD A;  2YSO A;  1X3C A;  4R2E A;  2A25 A;  3M99 B;  2EPZ A;  2YTF A;  3MHS C;  2EPX A;  2ENA A;  2EM3 A;  1Z1B A;  2VRD A;  2EOR A;  1DGC A;  2EMC A;  2EJ4 A;  5KL2 A;  1JK2 A;  2M9A A;  2MKD A;  1G2D C;  2PRT A;  1ZAA C;  5KL7 A;  1JK1 A;  2JP9 A;  2EM8 A;  2CTD A;  2WCC 3;  2GHF A;  2MKN A;  2EPP A;  1RMD A;  2LV2 A;  2LCE A;  1WJP A;  2EPR A;  1BB8 A;  2EMG A;  2J7J A;  2DLQ A;  1X6H A;  2EOF A;  4R2S A;  1YUJ A;  2EOZ A;  1TF3 A;  2CSH A;  2EMA A;  1YUI A;  2EOY A;  2EL4 A;  2YRM A;  2YTO A;  2I13 A;  2EN6 A;  2RPC A;  4R2P A;  2NAB A;  2ELY A;  2BB8 A;  2MDG A;  4GZN C;  3UK3 C;  2EM4 A;  1F2I G;  1KJK A;  5KL3 A;  2DMI A;  2EN7 A;  2EN4 A;  2LO3 A;  2CT1 A;  2EPC A;  1X5W A;  4F6N A;  2YU5 A;  2EM5 A;  2YSP A;  2EL6 A;  2YTN A;  4WSG A;  1B69 A;  1A1L A;  2EMY A;  2EMW A;  2YTI A;  2YTJ A;  2EMB A;  2EQ3 A;  2EOI A;  2YTD A;  1AAY A;  4F6M A;  2DLK A;  2EP3 A;  1X6E A;  2EQ0 A;  2D9H A;  4R2C A;  2EMH A;  1G2F C;  1TF6 A;  1A1K A;  2YTP A;  2WBU A;  4R2R A;  2DRP A;  2ADR A;  1YSA C;  2GLI A;  2EE8 A;  4R2D A;  2EMZ A;  4F2J C;  2LT7 A;  2EOS A;  2YTQ A;  2EM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...