2EMFA

Solution structure of the c2h2 type zinc finger (region 379-411) of human zinc finger protein 484
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGGKHFECTECGKAFTRKSTLSMHQKIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 484
publication title Solution structure of the C2H2 type zinc finger (region 379-411) of human Zinc finger protein 484
rcsb
source organism Homo sapiens
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emfA01
2EQ0A 2YTOA 2EMWA 2EOXA 2EM9A 2EOMA 2EPAA 2EPRA 2YRHA 5KL3A 1B69A 2NABA 1JK1A 3UK3C 2WBUA 2A25A 2RSIA 4IS1C 2EN7A 2EPPA 1A1HA 1G2FC 2EMIA 2LO3A 5KL4A 2EQ1A 3VHTB 2EJ4A 2EMZA 1TN9A 1P47A 4F2JC 1TF3A 2EMAA 2ADRA 1KJKA 1F2IG 2EPZA 2EOIA 2EM5A 5KL7A 2HGHA 2GLIA 2EOYA 1UBDC 2LCEA 1ZAAC 2EM0A 1X6EA 2M9AA 2WBTA 2EM7A 2LV2A 4F6NA 2CTDA 2D9HA 1X6HA 2CT1A 2YU5A 1YUIA 2YTQA 2CSHA 2EL4A 2EOHA 4R2PA 2EM4A 4IJDA 1MEYC 2EOJA 2J7JA 2YTNA 2DRPA 2JPAA 1X5WA 1A1KA 2EN3A 2MDGA 2YTPA 1BBOA 5KL5A 2EOOA 4GZNC 2EMHA 2EM2A 1ZR9A 2EMLA 4FK5C 1X3CA 2ELYA 2DLQA 2ENAA 4X9JA 1LLMC 2EPUA 3M99B 2EOZA 2EQ3A 2EPXA 2LVHA 1A1FA 2YRMA 1RMDA 2EMKA 2MKNA 5KL2A 3MHHC 2EL6A 1YSAC 2EMBA 1ZU1A 2E72A 2YTFA 2EMCA 1Z1BA 2EOFA 2EN2A 2EMFA 2ENCA 2YTGA 1X6FA 2WBSA 4R2RA 3EPLA 2EOSA 2YSPA 2YRKA 2ELZA 1A1LA 4M9VC 1NCSA 2YTEA 1A1IA 2YTIA 1BB8A 2MKDA 2WCC3 2YU8A 2EN8A 2DLKA 2EM3A 4R2AA 4R2QA 2YSOA 4WSGA 2BB8A 4R2SA 1TF6A 2EOQA 2RPCA 1DGCA 2LT7A 3EPJA 5KL6A 2EN6A 4R2CA 2I13A 2EL5A 2DMIA 2EMXA 2GHFA 2EOEA 2VRDA 2EMGA 1YUJA 1A1JA 1WJPA 2R1FA 4R2EA 3EPHA 1JK2A 2EM8A 2ENHA 2DGCA 2EE8A 2EN4A 1UN6B 2EM6A 2EPCA 3EPKA 1G2DC 2EORA 2PRTA 2EP3A 2YTJA 4F6MA 2EMYA 4R2DA 1AAYA 1A1GA 2EN1A 2YTDA 3MHSC 2JP9A
chains in the Genus database with same CATH superfamily
2EQ0A 4RH8A 4DV6E 2HHHE 2EMWA 5KL3A 1B69A 2B7VA 2NABA 1JK1A 5A6AA 3ECRA 2RSIA 4IS1C 2EN7A 2EPPA 2JOBA 1YFHA 1A1HA 4NXME 3KZZA 5KL4A 2HJJA 4O4KA 1ZBTA 2H36X 5A6KA 1TN9A 4MLVA 4N4RB 2EMAA 2ADRA 3DJWA 4TUGA 2GLIA 1UBDC 4ZYHA 1ZAAC 2EM0A 1X6EA 2M9AA 5A6BD 1XNRE 4HEIA 2D9HA 4YHHE 4JYAE 2CT1A 4RHBB 1PJTA 4R2PA 1HNXE 2UUAE 2EZ6A 3C4TA 2R76A 2JR1A 1X5WA 2YZTA 3K6QA 5IV8B 3C6MA 2FTXB 2NUFA 1X49A 2EMHA 2EMLA 4KHPE 2LE2A 2ELYA 2WZOA 1XNQE 2DB2A 2V87A 2L33A 1X48A 2EPOA 2EOZA 1A1FA 1EKZA 2YRMA 1T39A 2EMKA 3MHHC 2L3CA 4DUYE 4YY3E 5TSEA 4TUIA 4DR1E 2M1SA 3F6HA 2CPNA 4DV5E 2EMCA 1IBKE 2UUCE 2ENCA 2RSMA 4O5GA 1SFEA 1YYWA 3VYYA 1N34E 5A69A 1GQEA 1NCSA 1IBLE 4M2ZA 4Q35B 1A1IA 1DQ3A 1X47A 2MKDA 2WCC3 4LF7E 3KWRA 2I9IA 2EM3A 4JI6E 4GKKE 4DV1E 2BB8A 2K7IA 5LMUE 4DUZE 2EOQA 2LT7A 5KL6A 1WHNA 2YPNA 2I13A 2GHFA 1YZ9A 3P1XA 4KWYA 3EPHA 3EQ1A 1JK2A 2LMZA 3TQMA 2EE8A 2EN4A 2JXPA 1UN6B 4DV7E 2YWQA 2EPCA 1MGTA 4GKJE 4WSPA 1GTKA 4M30A 2YTDA 1RC7A 5DNYA 2EWLA 1BBGA 4MLQA 2K4VA 2YTOA 4GEQB 2EOMA 4Q28A 2EPRA 5AE1A 2DIXA 2NUEA 1N3GA 2KONA 3C4BA 4X8WA 1G2FC 2EQ1A 3J7Yp 3VK6A 2EJ4A 1PJSA 2BBGA 1J26A 1P47A 3HTXA 1WHQA 1F2IG 2EPZA 5KL7A 5IT9C 3DF6A 2WBTA 3RMPA 2EM7A 2LV2A 4R8OA 2CTDA 1UHZA 4OX9E 2YU5A 1YUIA 5BR8E 3J7AG 4X65E 2EM4A 3THOB 2N8XA 2YT4A 2J7JA 1N33E 1T4NA 2YTNA 4BMJA 2B9DA 1A1KA 2UUBE 1BBOA 5KL5A 4J8ZA 4ZYDA 2MC6A 4FK5C 2L2MA 1LLMC 2VQEE 2EPUA 4LF6E 2NA2A 4ZYGA 1NEIA 2EQ3A 2N3HA 4NZVA 3OMLA 2MKNA 1PDAA 4JI3E 2V83A 3C6KA 2F4VE 4L8NA 2V85A 2LRSA 4WPYA 1FJGE 2YSPA 1PJQA 4B3TE 4M9VC 2EPLX 4DV4E 4OOGC 4LF9E 2UXCE 2JY9A 4F9BB 3QG5C 2JOXA 3T1HE 5A6BA 2DLKA 5LMNE 4R2QA 2FGGA 4WSGA 3J80C 1TF6A 1DGCA 2RS7A 1XMQE 5A6JA 2EOEA 2VRDA 1IQOA 4R2EA 2EM8A 2DGCA 2EORA 2JWOA 2EP3A 3HXLA 4BBYA 2YTJA 2EMYA 3MHSC 2WBSA 4KZSA 4P78A 4HTGA 2EM9A 1GZ6A 2L6MA 4BS9A 2UU9E 2E1MA 3UK3C 2WBUA 4JV5E 3IWCA 2L92A 2EMIA 2HC5A 2LO3A 5IXMB 3VHTB 3HPZA 2ZM6E 1DI2A 5AC4A 3ADJA 1I94E 2EMZA 2M4IA 4F2JC 1WRJA 2EOIA 2HGHA 2V88A 3KZYA 1FKAE 5T6JA 2L2NA 4F6NA 3HPSA 2E5LE 1X6HA 3LMLA 1IMUA 4AQYE 2M7QA 3F6GA 4M0VA 2CSHA 2EL4A 2LUPB 3BIDA 4DR2E 4LF5E 4IJDA 2MDRA 1MEYC 4JI4E 1WXRA 1QU6A 2JPAA 1ZBQA 4F9AB 3THNA 4WXCA 2EOOA 1KYQA 2N3GA 1ZR9A 5FLXC 4F54A 2FV4B 1X3CA 2DLQA 2ENAA 1J5EE 5LL6R 2LJHA 3IWDA 5IWAE 2KHXA 1RMDA 3JAMC 2EL6A 4BC9A 1YSAC 4WX9A 4JI7E 5AE2A 4LFBE 1T4LB 2EOFA 2EN2A 2EMFA 3EPLA 2YTGA 1X6FA 2LJUA 4DV0E 2EOSA 2B3TB 2Q8UA 1A1LA 4B3ME 2VE7C 3MSWA 2YTEA 4JI0E 2EPMX 2ODRD 1BB8A 1IQSA 1T4OA 2LBSB 2B7TA 4JI8E 4DR3E 4R2AA 3J81C 2YSOA 3JU0A 1T38A 4R2SA 4BCAA 2DMYA 2RPCA 4F9CB 2EN6A 4WYQB 2ODRC 2VQFE 3AV0A 1YUJA 1STUA 5ADZA 4DV3E 3JTZA 2ENHA 1YPNA 2NUGA 2RQLA 2PRTA 4NHRA 3AUZA 3ADLA 4I8OA 4LTYA 1SR9A 2JP9A 2LTSA 2V86A 2KOUA 3HQ1A 3T1YE 2EOXA 2EPAA 2YRHA 3OTOE 1L4SA 1EH6A 1O0WA 1IBME 2A25A 1RQ0A 3LLHA 2L8TA 2L2KB 4DR4E 4WFTA 4JI2E 5AE3A 5LLQA 2LUQA 2RS6A 2V8QB 1PKPA 1TF3A 1KJKA 2JYAA 2EM5A 5F3WA 2RTXA 2GPIA 2EOYA 4JI5E 2LCEA 3FIGA 4DKKA 2EPKX 2YTQA 1HR0E 1UILA 2EOHA 2G7HA 2EOJA 1AH5A 2DRPA 2UXDE 2F8BA 2IHR1 4LF8E 2EN3A 2MDGA 2YTPA 3IWBA 2V89A 4O24A 4GZNC 3H09A 4WXDA 3BBGA 4X66E 2EM2A 1N32E 4DR6E 1HNZE 4X9JA 3M99B 4LFAE 5AASA 3BGHA 5AC5A 2LVHA 2EPXA 4B3SE 4X64E 4B3RE 4K0KE 5KL2A 5A2QC 1N36E 2EMBA 4DR5E 1ZU1A 4DV2E 4L5NC 1HNWE 2E72A 2YTFA 2LTRA 1Z1BA 3ADIA 2L3JA 4P7DA 4DMIA 5CFFE 4R2RA 2YRKA 2ELZA 2MC5A 3BF2A 2YTIA 4ZYEA 4O43A 4DR7E 3ZOQB 1YYOA 1XMOE 4LF4E 2UXBE 2YU8A 4BC7A 2EN8A 3VYXA 3EPJA 3ADGA 4R2CA 4LFCE 2EL5A 2VF1A 2DMIA 2EMXA 1EH8A 4BHCA 4LU9A 2EMGA 1A1JA 1WJPA 2R1FA 2DSYA 3L00A 2JVAA 4BHBA 4X62E 4NXNE 2EM6A 2EPNA 3EPKA 1G2DC 1YYKA 1QNTA 4R03A 4F6MA 4JI1E 4R2DA 1AAYA 1A1GA 1EH7A 2EN1A
chains in the Genus database with same CATH topology
2EQ0A 2YTOA 2EMWA 2EOXA 2EM9A 2EOMA 2EPAA 2EPRA 2YRHA 5KL3A 1B69A 2NABA 1JK1A 3UK3C 2WBUA 2A25A 2RSIA 4IS1C 2EN7A 2EPPA 1A1HA 1G2FC 2EMIA 2LO3A 5KL4A 2EQ1A 3VHTB 2EJ4A 2EMZA 1TN9A 1P47A 4F2JC 1TF3A 2EMAA 2ADRA 1KJKA 1F2IG 2EPZA 2EOIA 2EM5A 5KL7A 2HGHA 2GLIA 2EOYA 1UBDC 2LCEA 1ZAAC 2EM0A 1X6EA 2M9AA 2WBTA 2EM7A 2LV2A 4F6NA 2CTDA 2D9HA 1X6HA 2CT1A 2YU5A 1YUIA 2YTQA 2CSHA 2EL4A 2EOHA 4R2PA 2EM4A 4IJDA 1MEYC 2EOJA 2J7JA 2YTNA 2DRPA 2JPAA 1X5WA 1A1KA 2EN3A 2MDGA 2YTPA 1BBOA 5KL5A 2EOOA 4GZNC 2EMHA 2EM2A 1ZR9A 2EMLA 4FK5C 1X3CA 2ELYA 2DLQA 2ENAA 4X9JA 1LLMC 2EPUA 3M99B 2EOZA 2EQ3A 2EPXA 2LVHA 1A1FA 2YRMA 1RMDA 2EMKA 2MKNA 5KL2A 3MHHC 2EL6A 1YSAC 2EMBA 1ZU1A 2E72A 2YTFA 2EMCA 1Z1BA 2EOFA 2EN2A 2EMFA 2ENCA 2YTGA 1X6FA 2WBSA 4R2RA 3EPLA 2EOSA 2YSPA 2YRKA 2ELZA 1A1LA 4M9VC 1NCSA 2YTEA 1A1IA 2YTIA 1BB8A 2MKDA 2WCC3 2YU8A 2EN8A 2DLKA 2EM3A 4R2AA 4R2QA 2YSOA 4WSGA 2BB8A 4R2SA 1TF6A 2EOQA 2RPCA 1DGCA 2LT7A 3EPJA 5KL6A 2EN6A 4R2CA 2I13A 2EL5A 2DMIA 2EMXA 2GHFA 2EOEA 2VRDA 2EMGA 1YUJA 1A1JA 1WJPA 2R1FA 4R2EA 3EPHA 1JK2A 2EM8A 2ENHA 2DGCA 2EE8A 2EN4A 1UN6B 2EM6A 2EPCA 3EPKA 1G2DC 2EORA 2PRTA 2EP3A 2YTJA 4F6MA 2EMYA 4R2DA 1AAYA 1A1GA 2EN1A 2YTDA 3MHSC 2JP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EQ0 A;  2YTO A;  2EMW A;  2EOX A;  2EM9 A;  2EOM A;  2EPA A;  2EPR A;  2YRH A;  5KL3 A;  1B69 A;  2NAB A;  1JK1 A;  3UK3 C;  2WBU A;  2A25 A;  2RSI A;  4IS1 C;  2EN7 A;  2EPP A;  1A1H A;  1G2F C;  2EMI A;  2LO3 A;  5KL4 A;  2EQ1 A;  3VHT B;  2EJ4 A;  2EMZ A;  1TN9 A;  1P47 A;  4F2J C;  1TF3 A;  2EMA A;  2ADR A;  1KJK A;  1F2I G;  2EPZ A;  2EOI A;  2EM5 A;  5KL7 A;  2HGH A;  2GLI A;  2EOY A;  1UBD C;  2LCE A;  1ZAA C;  2EM0 A;  1X6E A;  2M9A A;  2WBT A;  2EM7 A;  2LV2 A;  4F6N A;  2CTD A;  2D9H A;  1X6H A;  2CT1 A;  2YU5 A;  1YUI A;  2YTQ A;  2CSH A;  2EL4 A;  2EOH A;  4R2P A;  2EM4 A;  4IJD A;  1MEY C;  2EOJ A;  2J7J A;  2YTN A;  2DRP A;  2JPA A;  1X5W A;  1A1K A;  2EN3 A;  2MDG A;  2YTP A;  1BBO A;  5KL5 A;  2EOO A;  4GZN C;  2EMH A;  2EM2 A;  1ZR9 A;  2EML A;  4FK5 C;  1X3C A;  2ELY A;  2DLQ A;  2ENA A;  4X9J A;  1LLM C;  2EPU A;  3M99 B;  2EOZ A;  2EQ3 A;  2EPX A;  2LVH A;  1A1F A;  2YRM A;  1RMD A;  2EMK A;  2MKN A;  5KL2 A;  3MHH C;  2EL6 A;  1YSA C;  2EMB A;  1ZU1 A;  2E72 A;  2YTF A;  2EMC A;  1Z1B A;  2EOF A;  2EN2 A;  2EMF A;  2ENC A;  2YTG A;  1X6F A;  2WBS A;  4R2R A;  3EPL A;  2EOS A;  2YSP A;  2YRK A;  2ELZ A;  1A1L A;  4M9V C;  1NCS A;  2YTE A;  1A1I A;  2YTI A;  1BB8 A;  2MKD A;  2WCC 3;  2YU8 A;  2EN8 A;  2DLK A;  2EM3 A;  4R2A A;  4R2Q A;  2YSO A;  4WSG A;  2BB8 A;  4R2S A;  1TF6 A;  2EOQ A;  2RPC A;  1DGC A;  2LT7 A;  3EPJ A;  5KL6 A;  2EN6 A;  4R2C A;  2I13 A;  2EL5 A;  2DMI A;  2EMX A;  2GHF A;  2EOE A;  2VRD A;  2EMG A;  1YUJ A;  1A1J A;  1WJP A;  2R1F A;  4R2E A;  3EPH A;  1JK2 A;  2EM8 A;  2ENH A;  2DGC A;  2EE8 A;  2EN4 A;  1UN6 B;  2EM6 A;  2EPC A;  3EPK A;  1G2D C;  2EOR A;  2PRT A;  2EP3 A;  2YTJ A;  4F6M A;  2EMY A;  4R2D A;  1AAY A;  1A1G A;  2EN1 A;  2YTD A;  3MHS C;  2JP9 A; 
#chains in the Genus database with same CATH topology
 2EQ0 A;  4RH8 A;  4DV6 E;  2HHH E;  2EMW A;  5KL3 A;  1B69 A;  2B7V A;  2NAB A;  1JK1 A;  5A6A A;  3ECR A;  2RSI A;  4IS1 C;  2EN7 A;  2EPP A;  2JOB A;  1YFH A;  1A1H A;  4NXM E;  3KZZ A;  5KL4 A;  2HJJ A;  4O4K A;  1ZBT A;  2H36 X;  5A6K A;  1TN9 A;  4MLV A;  4N4R B;  2EMA A;  2ADR A;  3DJW A;  4TUG A;  2GLI A;  1UBD C;  4ZYH A;  1ZAA C;  2EM0 A;  1X6E A;  2M9A A;  5A6B D;  1XNR E;  4HEI A;  2D9H A;  4YHH E;  4JYA E;  2CT1 A;  4RHB B;  1PJT A;  4R2P A;  1HNX E;  2UUA E;  2EZ6 A;  3C4T A;  2R76 A;  2JR1 A;  1X5W A;  2YZT A;  3K6Q A;  5IV8 B;  3C6M A;  2FTX B;  2NUF A;  1X49 A;  2EMH A;  2EML A;  4KHP E;  2LE2 A;  2ELY A;  2WZO A;  1XNQ E;  2DB2 A;  2V87 A;  2L33 A;  1X48 A;  2EPO A;  2EOZ A;  1A1F A;  1EKZ A;  2YRM A;  1T39 A;  2EMK A;  3MHH C;  2L3C A;  4DUY E;  4YY3 E;  5TSE A;  4TUI A;  4DR1 E;  2M1S A;  3F6H A;  2CPN A;  4DV5 E;  2EMC A;  1IBK E;  2UUC E;  2ENC A;  2RSM A;  4O5G A;  1SFE A;  1YYW A;  3VYY A;  1N34 E;  5A69 A;  1GQE A;  1NCS A;  1IBL E;  4M2Z A;  4Q35 B;  1A1I A;  1DQ3 A;  1X47 A;  2MKD A;  2WCC 3;  4LF7 E;  3KWR A;  2I9I A;  2EM3 A;  4JI6 E;  4GKK E;  4DV1 E;  2BB8 A;  2K7I A;  5LMU E;  4DUZ E;  2EOQ A;  2LT7 A;  5KL6 A;  1WHN A;  2YPN A;  2I13 A;  2GHF A;  1YZ9 A;  3P1X A;  4KWY A;  3EPH A;  3EQ1 A;  1JK2 A;  2LMZ A;  3TQM A;  2EE8 A;  2EN4 A;  2JXP A;  1UN6 B;  4DV7 E;  2YWQ A;  2EPC A;  1MGT A;  4GKJ E;  4WSP A;  1GTK A;  4M30 A;  2YTD A;  1RC7 A;  5DNY A;  2EWL A;  1BBG A;  4MLQ A;  2K4V A;  2YTO A;  4GEQ B;  2EOM A;  4Q28 A;  2EPR A;  5AE1 A;  2DIX A;  2NUE A;  1N3G A;  2KON A;  3C4B A;  4X8W A;  1G2F C;  2EQ1 A;  3J7Y p;  3VK6 A;  2EJ4 A;  1PJS A;  2BBG A;  1J26 A;  1P47 A;  3HTX A;  1WHQ A;  1F2I G;  2EPZ A;  5KL7 A;  5IT9 C;  3DF6 A;  2WBT A;  3RMP A;  2EM7 A;  2LV2 A;  4R8O A;  2CTD A;  1UHZ A;  4OX9 E;  2YU5 A;  1YUI A;  5BR8 E;  3J7A G;  4X65 E;  2EM4 A;  3THO B;  2N8X A;  2YT4 A;  2J7J A;  1N33 E;  1T4N A;  2YTN A;  4BMJ A;  2B9D A;  1A1K A;  2UUB E;  1BBO A;  5KL5 A;  4J8Z A;  4ZYD A;  2MC6 A;  4FK5 C;  2L2M A;  1LLM C;  2VQE E;  2EPU A;  4LF6 E;  2NA2 A;  4ZYG A;  1NEI A;  2EQ3 A;  2N3H A;  4NZV A;  3OML A;  2MKN A;  1PDA A;  4JI3 E;  2V83 A;  3C6K A;  2F4V E;  4L8N A;  2V85 A;  2LRS A;  4WPY A;  1FJG E;  2YSP A;  1PJQ A;  4B3T E;  4M9V C;  2EPL X;  4DV4 E;  4OOG C;  4LF9 E;  2UXC E;  2JY9 A;  4F9B B;  3QG5 C;  2JOX A;  3T1H E;  5A6B A;  2DLK A;  5LMN E;  4R2Q A;  2FGG A;  4WSG A;  3J80 C;  1TF6 A;  1DGC A;  2RS7 A;  1XMQ E;  5A6J A;  2EOE A;  2VRD A;  1IQO A;  4R2E A;  2EM8 A;  2DGC A;  2EOR A;  2JWO A;  2EP3 A;  3HXL A;  4BBY A;  2YTJ A;  2EMY A;  3MHS C;  2WBS A;  4KZS A;  4P78 A;  4HTG A;  2EM9 A;  1GZ6 A;  2L6M A;  4BS9 A;  2UU9 E;  2E1M A;  3UK3 C;  2WBU A;  4JV5 E;  3IWC A;  2L92 A;  2EMI A;  2HC5 A;  2LO3 A;  5IXM B;  3VHT B;  3HPZ A;  2ZM6 E;  1DI2 A;  5AC4 A;  3ADJ A;  1I94 E;  2EMZ A;  2M4I A;  4F2J C;  1WRJ A;  2EOI A;  2HGH A;  2V88 A;  3KZY A;  1FKA E;  5T6J A;  2L2N A;  4F6N A;  3HPS A;  2E5L E;  1X6H A;  3LML A;  1IMU A;  4AQY E;  2M7Q A;  3F6G A;  4M0V A;  2CSH A;  2EL4 A;  2LUP B;  3BID A;  4DR2 E;  4LF5 E;  4IJD A;  2MDR A;  1MEY C;  4JI4 E;  1WXR A;  1QU6 A;  2JPA A;  1ZBQ A;  4F9A B;  3THN A;  4WXC A;  2EOO A;  1KYQ A;  2N3G A;  1ZR9 A;  5FLX C;  4F54 A;  2FV4 B;  1X3C A;  2DLQ A;  2ENA A;  1J5E E;  5LL6 R;  2LJH A;  3IWD A;  5IWA E;  2KHX A;  1RMD A;  3JAM C;  2EL6 A;  4BC9 A;  1YSA C;  4WX9 A;  4JI7 E;  5AE2 A;  4LFB E;  1T4L B;  2EOF A;  2EN2 A;  2EMF A;  3EPL A;  2YTG A;  1X6F A;  2LJU A;  4DV0 E;  2EOS A;  2B3T B;  2Q8U A;  1A1L A;  4B3M E;  2VE7 C;  3MSW A;  2YTE A;  4JI0 E;  2EPM X;  2ODR D;  1BB8 A;  1IQS A;  1T4O A;  2LBS B;  2B7T A;  4JI8 E;  4DR3 E;  4R2A A;  3J81 C;  2YSO A;  3JU0 A;  1T38 A;  4R2S A;  4BCA A;  2DMY A;  2RPC A;  4F9C B;  2EN6 A;  4WYQ B;  2ODR C;  2VQF E;  3AV0 A;  1YUJ A;  1STU A;  5ADZ A;  4DV3 E;  3JTZ A;  2ENH A;  1YPN A;  2NUG A;  2RQL A;  2PRT A;  4NHR A;  3AUZ A;  3ADL A;  4I8O A;  4LTY A;  1SR9 A;  2JP9 A;  2LTS A;  2V86 A;  2KOU A;  3HQ1 A;  3T1Y E;  2EOX A;  2EPA A;  2YRH A;  3OTO E;  1L4S A;  1EH6 A;  1O0W A;  1IBM E;  2A25 A;  1RQ0 A;  3LLH A;  2L8T A;  2L2K B;  4DR4 E;  4WFT A;  4JI2 E;  5AE3 A;  5LLQ A;  2LUQ A;  2RS6 A;  2V8Q B;  1PKP A;  1TF3 A;  1KJK A;  2JYA A;  2EM5 A;  5F3W A;  2RTX A;  2GPI A;  2EOY A;  4JI5 E;  2LCE A;  3FIG A;  4DKK A;  2EPK X;  2YTQ A;  1HR0 E;  1UIL A;  2EOH A;  2G7H A;  2EOJ A;  1AH5 A;  2DRP A;  2UXD E;  2F8B A;  2IHR 1;  4LF8 E;  2EN3 A;  2MDG A;  2YTP A;  3IWB A;  2V89 A;  4O24 A;  4GZN C;  3H09 A;  4WXD A;  3BBG A;  4X66 E;  2EM2 A;  1N32 E;  4DR6 E;  1HNZ E;  4X9J A;  3M99 B;  4LFA E;  5AAS A;  3BGH A;  5AC5 A;  2LVH A;  2EPX A;  4B3S E;  4X64 E;  4B3R E;  4K0K E;  5KL2 A;  5A2Q C;  1N36 E;  2EMB A;  4DR5 E;  1ZU1 A;  4DV2 E;  4L5N C;  1HNW E;  2E72 A;  2YTF A;  2LTR A;  1Z1B A;  3ADI A;  2L3J A;  4P7D A;  4DMI A;  5CFF E;  4R2R A;  2YRK A;  2ELZ A;  2MC5 A;  3BF2 A;  2YTI A;  4ZYE A;  4O43 A;  4DR7 E;  3ZOQ B;  1YYO A;  1XMO E;  4LF4 E;  2UXB E;  2YU8 A;  4BC7 A;  2EN8 A;  3VYX A;  3EPJ A;  3ADG A;  4R2C A;  4LFC E;  2EL5 A;  2VF1 A;  2DMI A;  2EMX A;  1EH8 A;  4BHC A;  4LU9 A;  2EMG A;  1A1J A;  1WJP A;  2R1F A;  2DSY A;  3L00 A;  2JVA A;  4BHB A;  4X62 E;  4NXN E;  2EM6 A;  2EPN A;  3EPK A;  1G2D C;  1YYK A;  1QNT A;  4R03 A;  4F6M A;  4JI1 E;  4R2D A;  1AAY A;  1A1G A;  1EH7 A;  2EN1 A; 
#chains in the Genus database with same CATH homology
 2EQ0 A;  2YTO A;  2EMW A;  2EOX A;  2EM9 A;  2EOM A;  2EPA A;  2EPR A;  2YRH A;  5KL3 A;  1B69 A;  2NAB A;  1JK1 A;  3UK3 C;  2WBU A;  2A25 A;  2RSI A;  4IS1 C;  2EN7 A;  2EPP A;  1A1H A;  1G2F C;  2EMI A;  2LO3 A;  5KL4 A;  2EQ1 A;  3VHT B;  2EJ4 A;  2EMZ A;  1TN9 A;  1P47 A;  4F2J C;  1TF3 A;  2EMA A;  2ADR A;  1KJK A;  1F2I G;  2EPZ A;  2EOI A;  2EM5 A;  5KL7 A;  2HGH A;  2GLI A;  2EOY A;  1UBD C;  2LCE A;  1ZAA C;  2EM0 A;  1X6E A;  2M9A A;  2WBT A;  2EM7 A;  2LV2 A;  4F6N A;  2CTD A;  2D9H A;  1X6H A;  2CT1 A;  2YU5 A;  1YUI A;  2YTQ A;  2CSH A;  2EL4 A;  2EOH A;  4R2P A;  2EM4 A;  4IJD A;  1MEY C;  2EOJ A;  2J7J A;  2YTN A;  2DRP A;  2JPA A;  1X5W A;  1A1K A;  2EN3 A;  2MDG A;  2YTP A;  1BBO A;  5KL5 A;  2EOO A;  4GZN C;  2EMH A;  2EM2 A;  1ZR9 A;  2EML A;  4FK5 C;  1X3C A;  2ELY A;  2DLQ A;  2ENA A;  4X9J A;  1LLM C;  2EPU A;  3M99 B;  2EOZ A;  2EQ3 A;  2EPX A;  2LVH A;  1A1F A;  2YRM A;  1RMD A;  2EMK A;  2MKN A;  5KL2 A;  3MHH C;  2EL6 A;  1YSA C;  2EMB A;  1ZU1 A;  2E72 A;  2YTF A;  2EMC A;  1Z1B A;  2EOF A;  2EN2 A;  2EMF A;  2ENC A;  2YTG A;  1X6F A;  2WBS A;  4R2R A;  3EPL A;  2EOS A;  2YSP A;  2YRK A;  2ELZ A;  1A1L A;  4M9V C;  1NCS A;  2YTE A;  1A1I A;  2YTI A;  1BB8 A;  2MKD A;  2WCC 3;  2YU8 A;  2EN8 A;  2DLK A;  2EM3 A;  4R2A A;  4R2Q A;  2YSO A;  4WSG A;  2BB8 A;  4R2S A;  1TF6 A;  2EOQ A;  2RPC A;  1DGC A;  2LT7 A;  3EPJ A;  5KL6 A;  2EN6 A;  4R2C A;  2I13 A;  2EL5 A;  2DMI A;  2EMX A;  2GHF A;  2EOE A;  2VRD A;  2EMG A;  1YUJ A;  1A1J A;  1WJP A;  2R1F A;  4R2E A;  3EPH A;  1JK2 A;  2EM8 A;  2ENH A;  2DGC A;  2EE8 A;  2EN4 A;  1UN6 B;  2EM6 A;  2EPC A;  3EPK A;  1G2D C;  2EOR A;  2PRT A;  2EP3 A;  2YTJ A;  4F6M A;  2EMY A;  4R2D A;  1AAY A;  1A1G A;  2EN1 A;  2YTD A;  3MHS C;  2JP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...