1UN6B

The crystal structure of a zinc finger - rna complex reveals two modes of molecular recognition
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
86
structure length
86
Chain Sequence
MYVCHFENCGKAFKKHNQLKVHQFSHTQQLPYECPHEGCDKRFSLPSRLKRHEKVHAGYPCKKDDSCSFVGKTWTLYLKHVAECHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of a Zinc-Finger-RNA Complex Reveals Two Modes of Molecular Recognition
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Rna-binding protein/rna
molecule keywords TRANSCRIPTION FACTOR IIIA
total genus 25
structure length 86
sequence length 86
chains with identical sequence C, D
ec nomenclature
pdb deposition date 2003-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1un6B02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1un6B01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1un6B03
4IS1C 4F6MA 2EN3A 2YTOA 2EORA 2DRPA 3MHHC 2DLQA 2EQ3A 5KL2A 2EN8A 2MKNA 4GZNC 1X6EA 1AAYA 2EMFA 2YTQA 2RPCA 2CT1A 2EE8A 2EMZA 2EMXA 2EPPA 2EQ1A 2EPUA 2HGHA 5KL6A 4R2QA 2JP9A 2EMHA 2EM7A 2YTJA 2EMKA 4R2AA 2DLKA 1A1IA 1DGCA 2EMYA 2EOXA 2BB8A 3EPJA 1YSAC 1YUJA 4R2RA 1A1LA 2EMIA 2EM8A 2EOYA 1ZR9A 2D9HA 2EN6A 4WSGA 1NCSA 4R2SA 1A1GA 2EL5A 1ZAAC 2MDGA 2YRKA 1TF3A 2EPCA 2EN7A 2CTDA 1G2DC 2ADRA 1UN6B 4F2JC 1YUIA 1X6FA 2EMCA 2WBSA 1BB8A 2EOSA 2E72A 1X3CA 2EM6A 2YRHA 1F2IG 2EN2A 2ENCA 2MKDA 2YTNA 1X6HA 2EPZA 1TN9A 2EM3A 2YTPA 2LO3A 3M99B 1X5WA 2YSPA 5KL7A 2EPRA 2LV2A 2YTDA 4R2DA 2PRTA 1B69A 2EOOA 4R2CA 2I13A 1WJPA 2LT7A 1G2FC 2EOMA 1UBDC 2NABA 2GHFA 2YTIA 1A1KA 1TF6A 2EM4A 1JK2A 1A1HA 4M9VC 2EOIA 2YU5A 2ELYA 2EN1A 1RMDA 2EMLA 2CSHA 2EL6A 3UK3C 3VHTB 2YTEA 4X9JA 2VRDA 1A1JA 2YSOA 2EMBA 2EN4A 2EOZA 4FK5C 2GLIA 2J7JA 2WBUA 2EMAA 1Z1BA 2M9AA 1BBOA 2EOJA 3MHSC 2A25A 1KJKA 4F6NA 2EM5A 2JPAA 2YTGA 2YRMA 1P47A 2EOFA 2ELZA 5KL4A 2EMWA 1MEYC 3EPHA 1JK1A 2EMGA 2DMIA 2RSIA 2DGCA 2ENAA 2YTFA 2EOHA 3EPLA 2R1FA 2YU8A 2WCC3 2EJ4A 2EM9A 3EPKA 2EOQA 4R2PA 2EL4A 4R2EA 2EOEA 4IJDA 2ENHA 5KL3A 2LVHA 2EPXA 2LCEA 5KL5A 2EPAA 2EQ0A 2WBTA 2EM0A 1A1FA 2EM2A 1LLMC 1ZU1A 2EP3A
chains in the Genus database with same CATH superfamily
4WXCA 5IXMB 2EN3A 4IS1C 4RH8A 2EQ3A 5KL2A 2EN8A 4GZNC 5A6KA 1EKZA 4M30A 2RSMA 1FJGE 2EPLX 1YYWA 3T1YE 4JYAE 2B3TB 5AC5A 2JP9A 2I9IA 4R8OA 2M1SA 4DR7E 2Q8UA 2F8BA 4HEIA 3J81C 4DV6E 2EOXA 4LF9E 1YSAC 2K4VA 4OOGC 2EMIA 1J26A 4LFAE 1NCSA 4X64E 2EL5A 2YRKA 1TF3A 1IBLE 1L4SA 2EN7A 1XNRE 2ODRD 5T6JA 4GKKE 2L92A 2LTSA 4DR6E 4DV2E 3HTXA 2EOSA 5A2QC 2MC5A 1I94E 2YTNA 3P1XA 3C6KA 1TN9A 4MLQA 1T38A 1HNWE 3ADGA 3KZZA 2LV2A 1IBKE 2PRTA 2EOOA 1WJPA 2UUCE 2L3JA 1PJQA 1G2FC 2UXDE 1UBDC 2NABA 4ZYGA 2HHHE 1A1KA 2DB2A 1A1HA 4AQYE 1N32E 1T4OA 2YU5A 3DJWA 2ELYA 2CPNA 1NEIA 2LJHA 3VHTB 2EWLA 3VYXA 2J7JA 4LFCE 2WBUA 3VYYA 3ZOQB 2M9AA 1BBOA 2FGGA 1KJKA 3BBGA 4O5GA 4N4RB 4DR4E 2YTGA 3AUZA 4JI4E 5KL4A 1GQEA 1JK1A 2MC6A 4DMIA 1KYQA 4WX9A 5CFFE 2V85A 5TSEA 4O4KA 1UILA 4DR2E 4R03A 4R2PA 3LLHA 2LMZA 1BBGA 2LVHA 1N33E 2JOXA 5KL5A 2EPAA 1SFEA 2WBTA 1A1FA 4NHRA 4L8NA 4O43A 2E1MA 2E5LE 2EORA 2BBGA 2DLQA 2HJJA 2MKNA 2FTXB 4DV1E 2RPCA 3BGHA 1EH8A 1RQ0A 2NA2A 2EPUA 2HGHA 4RHBB 1N3GA 2EM7A 3J7Yp 2LUPB 5AE1A 2LE2A 2EMKA 1A1IA 3K6QA 1ZBQA 2JR1A 3IWBA 3TQMA 4BS9A 2BB8A 2LJUA 3EPJA 4DV4E 2LRSA 4WSGA 2D9HA 2GPIA 1A1GA 1ZAAC 2HC5A 1N36E 4ZYEA 2VF1A 2CTDA 4B3SE 2ADRA 4LF5E 1X6FA 4ZYHA 4M0VA 2WBSA 5A6JA 2JY9A 4BBYA 2ENCA 2MKDA 3MSWA 2LBSB 5BR8E 4WPYA 2EPZA 3C6MA 4BC7A 3C4TA 4OX9E 1X5WA 5KL7A 5IWAE 4R2CA 1HNZE 2B7TA 4LU9A 3IWDA 3J7AG 1GTKA 2EOMA 1PKPA 3LMLA 4ZYDA 1JK2A 1STUA 2EN1A 3QG5C 2EL6A 2L2MA 3UK3C 1N34E 3J80C 1HNXE 2N3HA 2V83A 2JVAA 4FK5C 1HR0E 1IBME 2VE7C 1PDAA 1EH7A 4P78A 4HTGA 5IT9C 5LMNE 4B3ME 3C4BA 2L6MA 4X62E 2DMYA 2F4VE 5F3WA 4LF8E 1UHZA 2K7IA 3OTOE 5A6AA 1P47A 1YPNA 1FKAE 1MEYC 1XNQE 4BHCA 1RC7A 2RSIA 1J5EE 2YTFA 3EPLA 2YU8A 4BHBA 5AASA 2EL4A 4R2EA 2EOEA 4LF4E 2NUFA 3VK6A 2LCEA 1MGTA 3T1HE 5LL6R 1T4LB 2EM2A 1LLMC 1ZU1A 1O0WA 4JI2E 2EPNA 3MHHC 1YZ9A 1X6EA 1AAYA 4NXNE 4NXME 2EMFA 2YTQA 2CT1A 2KHXA 2DIXA 4GEQB 4TUIA 3BF2A 4JI0E 2G7HA 2EMHA 3THNA 2YTJA 4P7DA 3DF6A 4DUZE 4R2AA 1DGCA 4DUYE 2JXPA 2ODRC 3F6HA 1YUJA 4R2RA 1A1LA 4I8OA 4M2ZA 4JI3E 2EPCA 1G2DC 4B3RE 1YUIA 2KOUA 1X3CA 2EM6A 3KZYA 4F9BB 4TUGA 3H09A 2UXCE 2LO3A 4BC9A 4X65E 3M99B 2YSPA 2EPRA 2N3GA 2I13A 2EPKX 3HXLA 3HPSA 2LT7A 4JI8E 2VQFE 2GHFA 2EM4A 5LMUE 4DV3E 4M9VC 4LFBE 3OMLA 2N8XA 4Q35B 1AH5A 1ZBTA 2RS7A 1RMDA 2EMLA 3KWRA 5LLQA 3IWCA 1YYKA 2YTEA 4X9JA 2VRDA 4X66E 2EN4A 2EOZA 2EMAA 3F6GA 1X48A 3MHSC 2A25A 5ADZA 2UUBE 1IMUA 4DR5E 2NUGA 1X49A 1X47A 4KHPE 2V8QB 2JYAA 4LF6E 2L2KB 2ELZA 2LTRA 4DR1E 5A69A 2EMGA 4YY3E 4DR3E 5A6BA 2L3CA 4O24A 5IV8B 5FLXC 1DQ3A 3ECRA 4WYQB 4Q28A 4IJDA 3ADLA 2EQ0A 3AV0A 2EM0A 2YZTA 2M7QA 2L2NA 2EP3A 2R76A 3HPZA 4F6MA 2YTOA 4MLVA 2DRPA 1IQSA 1EH6A 2M4IA 4YHHE 4F54A 1YYOA 4L5NC 4F9CB 2L8TA 3FIGA 2EE8A 2LUQA 2EMZA 2EMXA 2EPPA 2KONA 2EQ1A 1GZ6A 5KL6A 5A6BD 4R2QA 4BMJA 2NUEA 2DLKA 1T39A 1SR9A 2EMYA 4JI6E 1WRJA 2EPOA 2FV4B 2EM8A 4DV5E 2EOYA 1YFHA 1ZR9A 2EN6A 4R2SA 4B3TE 2MDGA 4LTYA 5DNYA 4NZVA 1WXRA 2ZM6E 1UN6B 3L00A 4WFTA 4F2JC 1XMQE 2EMCA 1XMOE 2JOBA 1BB8A 3ADIA 4J8ZA 1QU6A 1WHNA 2E72A 2YRHA 1F2IG 2VQEE 3ADJA 4F9AB 2EN2A 1X6HA 2EM3A 2H36X 4JI1E 2YTPA 2UU9E 3BIDA 2B7VA 2JWOA 4R2DA 2YTDA 2YPNA 3JTZA 1B69A 5AE3A 2YWQA 4JI7E 4KZSA 4WXDA 2YTIA 1PJSA 1TF6A 3HQ1A 2EOIA 2UUAE 2V88A 2CSHA 5AC4A 2L33A 1A1JA 2YSOA 4DV0E 2EMBA 2RTXA 2DSYA 5AE2A 2YT4A 2GLIA 1T4NA 4DKKA 2EPMX 3JU0A 3EQ1A 3THOB 1Z1BA 2EOJA 2RQLA 4F6NA 4GKJE 1WHQA 2MDRA 2V89A 4K0KE 2EM5A 2JPAA 1IQOA 2WZOA 3RMPA 4BCAA 2YRMA 2EOFA 2EMWA 2RS6A 3EPHA 3JAMC 4JI5E 2DMIA 4DV7E 2DGCA 2B9DA 2ENAA 2V86A 2EOHA 2R1FA 2WCC3 2EJ4A 1PJTA 2EM9A 3EPKA 2EOQA 1QNTA 2ENHA 4KWYA 5KL3A 4WSPA 2IHR1 2EPXA 4LF7E 1DI2A 2EZ6A 4X8WA 2V87A 4JV5E 2UXBE
chains in the Genus database with same CATH topology
4IS1C 4F6MA 2EN3A 2YTOA 2EORA 2DRPA 3MHHC 2DLQA 2EQ3A 5KL2A 2EN8A 2MKNA 4GZNC 1X6EA 1AAYA 2EMFA 2YTQA 2RPCA 2CT1A 2EE8A 2EMZA 2EMXA 2EPPA 2EQ1A 2EPUA 2HGHA 5KL6A 4R2QA 2JP9A 2EMHA 2EM7A 2YTJA 2EMKA 4R2AA 2DLKA 1A1IA 1DGCA 2EMYA 2EOXA 2BB8A 3EPJA 1YSAC 1YUJA 4R2RA 1A1LA 2EMIA 2EM8A 2EOYA 1ZR9A 2D9HA 2EN6A 4WSGA 1NCSA 4R2SA 1A1GA 2EL5A 1ZAAC 2MDGA 2YRKA 1TF3A 2EPCA 2EN7A 2CTDA 1G2DC 2ADRA 1UN6B 4F2JC 1YUIA 1X6FA 2EMCA 2WBSA 1BB8A 2EOSA 2E72A 1X3CA 2EM6A 2YRHA 1F2IG 2EN2A 2ENCA 2MKDA 2YTNA 1X6HA 2EPZA 1TN9A 2EM3A 2YTPA 2LO3A 3M99B 1X5WA 2YSPA 5KL7A 2EPRA 2LV2A 2YTDA 4R2DA 2PRTA 1B69A 2EOOA 4R2CA 2I13A 1WJPA 2LT7A 1G2FC 2EOMA 1UBDC 2NABA 2GHFA 2YTIA 1A1KA 1TF6A 2EM4A 1JK2A 1A1HA 4M9VC 2EOIA 2YU5A 2ELYA 2EN1A 1RMDA 2EMLA 2CSHA 2EL6A 3UK3C 3VHTB 2YTEA 4X9JA 2VRDA 1A1JA 2YSOA 2EMBA 2EN4A 2EOZA 4FK5C 2GLIA 2J7JA 2WBUA 2EMAA 1Z1BA 2M9AA 1BBOA 2EOJA 3MHSC 2A25A 1KJKA 4F6NA 2EM5A 2JPAA 2YTGA 2YRMA 1P47A 2EOFA 2ELZA 5KL4A 2EMWA 1MEYC 3EPHA 1JK1A 2EMGA 2DMIA 2RSIA 2DGCA 2ENAA 2YTFA 2EOHA 3EPLA 2R1FA 2YU8A 2WCC3 2EJ4A 2EM9A 3EPKA 2EOQA 4R2PA 2EL4A 4R2EA 2EOEA 4IJDA 2ENHA 5KL3A 2LVHA 2EPXA 2LCEA 5KL5A 2EPAA 2EQ0A 2WBTA 2EM0A 1A1FA 2EM2A 1LLMC 1ZU1A 2EP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IS1 C;  4F6M A;  2EN3 A;  2YTO A;  2EOR A;  2DRP A;  3MHH C;  2DLQ A;  2EQ3 A;  5KL2 A;  2EN8 A;  2MKN A;  4GZN C;  1X6E A;  1AAY A;  2EMF A;  2YTQ A;  2RPC A;  2CT1 A;  2EE8 A;  2EMZ A;  2EMX A;  2EPP A;  2EQ1 A;  2EPU A;  2HGH A;  5KL6 A;  4R2Q A;  2JP9 A;  2EMH A;  2EM7 A;  2YTJ A;  2EMK A;  4R2A A;  2DLK A;  1A1I A;  1DGC A;  2EMY A;  2EOX A;  2BB8 A;  3EPJ A;  1YSA C;  1YUJ A;  4R2R A;  1A1L A;  2EMI A;  2EM8 A;  2EOY A;  1ZR9 A;  2D9H A;  2EN6 A;  4WSG A;  1NCS A;  4R2S A;  1A1G A;  2EL5 A;  1ZAA C;  2MDG A;  2YRK A;  1TF3 A;  2EPC A;  2EN7 A;  2CTD A;  1G2D C;  2ADR A;  1UN6 B;  4F2J C;  1YUI A;  1X6F A;  2EMC A;  2WBS A;  1BB8 A;  2EOS A;  2E72 A;  1X3C A;  2EM6 A;  2YRH A;  1F2I G;  2EN2 A;  2ENC A;  2MKD A;  2YTN A;  1X6H A;  2EPZ A;  1TN9 A;  2EM3 A;  2YTP A;  2LO3 A;  3M99 B;  1X5W A;  2YSP A;  5KL7 A;  2EPR A;  2LV2 A;  2YTD A;  4R2D A;  2PRT A;  1B69 A;  2EOO A;  4R2C A;  2I13 A;  1WJP A;  2LT7 A;  1G2F C;  2EOM A;  1UBD C;  2NAB A;  2GHF A;  2YTI A;  1A1K A;  1TF6 A;  2EM4 A;  1JK2 A;  1A1H A;  4M9V C;  2EOI A;  2YU5 A;  2ELY A;  2EN1 A;  1RMD A;  2EML A;  2CSH A;  2EL6 A;  3UK3 C;  3VHT B;  2YTE A;  4X9J A;  2VRD A;  1A1J A;  2YSO A;  2EMB A;  2EN4 A;  2EOZ A;  4FK5 C;  2GLI A;  2J7J A;  2WBU A;  2EMA A;  1Z1B A;  2M9A A;  1BBO A;  2EOJ A;  3MHS C;  2A25 A;  1KJK A;  4F6N A;  2EM5 A;  2JPA A;  2YTG A;  2YRM A;  1P47 A;  2EOF A;  2ELZ A;  5KL4 A;  2EMW A;  1MEY C;  3EPH A;  1JK1 A;  2EMG A;  2DMI A;  2RSI A;  2DGC A;  2ENA A;  2YTF A;  2EOH A;  3EPL A;  2R1F A;  2YU8 A;  2WCC 3;  2EJ4 A;  2EM9 A;  3EPK A;  2EOQ A;  4R2P A;  2EL4 A;  4R2E A;  2EOE A;  4IJD A;  2ENH A;  5KL3 A;  2LVH A;  2EPX A;  2LCE A;  5KL5 A;  2EPA A;  2EQ0 A;  2WBT A;  2EM0 A;  1A1F A;  2EM2 A;  1LLM C;  1ZU1 A;  2EP3 A; 
#chains in the Genus database with same CATH topology
 4WXC A;  5IXM B;  2EN3 A;  4IS1 C;  4RH8 A;  2EQ3 A;  5KL2 A;  2EN8 A;  4GZN C;  5A6K A;  1EKZ A;  4M30 A;  2RSM A;  1FJG E;  2EPL X;  1YYW A;  3T1Y E;  4JYA E;  2B3T B;  5AC5 A;  2JP9 A;  2I9I A;  4R8O A;  2M1S A;  4DR7 E;  2Q8U A;  2F8B A;  4HEI A;  3J81 C;  4DV6 E;  2EOX A;  4LF9 E;  1YSA C;  2K4V A;  4OOG C;  2EMI A;  1J26 A;  4LFA E;  1NCS A;  4X64 E;  2EL5 A;  2YRK A;  1TF3 A;  1IBL E;  1L4S A;  2EN7 A;  1XNR E;  2ODR D;  5T6J A;  4GKK E;  2L92 A;  2LTS A;  4DR6 E;  4DV2 E;  3HTX A;  2EOS A;  5A2Q C;  2MC5 A;  1I94 E;  2YTN A;  3P1X A;  3C6K A;  1TN9 A;  4MLQ A;  1T38 A;  1HNW E;  3ADG A;  3KZZ A;  2LV2 A;  1IBK E;  2PRT A;  2EOO A;  1WJP A;  2UUC E;  2L3J A;  1PJQ A;  1G2F C;  2UXD E;  1UBD C;  2NAB A;  4ZYG A;  2HHH E;  1A1K A;  2DB2 A;  1A1H A;  4AQY E;  1N32 E;  1T4O A;  2YU5 A;  3DJW A;  2ELY A;  2CPN A;  1NEI A;  2LJH A;  3VHT B;  2EWL A;  3VYX A;  2J7J A;  4LFC E;  2WBU A;  3VYY A;  3ZOQ B;  2M9A A;  1BBO A;  2FGG A;  1KJK A;  3BBG A;  4O5G A;  4N4R B;  4DR4 E;  2YTG A;  3AUZ A;  4JI4 E;  5KL4 A;  1GQE A;  1JK1 A;  2MC6 A;  4DMI A;  1KYQ A;  4WX9 A;  5CFF E;  2V85 A;  5TSE A;  4O4K A;  1UIL A;  4DR2 E;  4R03 A;  4R2P A;  3LLH A;  2LMZ A;  1BBG A;  2LVH A;  1N33 E;  2JOX A;  5KL5 A;  2EPA A;  1SFE A;  2WBT A;  1A1F A;  4NHR A;  4L8N A;  4O43 A;  2E1M A;  2E5L E;  2EOR A;  2BBG A;  2DLQ A;  2HJJ A;  2MKN A;  2FTX B;  4DV1 E;  2RPC A;  3BGH A;  1EH8 A;  1RQ0 A;  2NA2 A;  2EPU A;  2HGH A;  4RHB B;  1N3G A;  2EM7 A;  3J7Y p;  2LUP B;  5AE1 A;  2LE2 A;  2EMK A;  1A1I A;  3K6Q A;  1ZBQ A;  2JR1 A;  3IWB A;  3TQM A;  4BS9 A;  2BB8 A;  2LJU A;  3EPJ A;  4DV4 E;  2LRS A;  4WSG A;  2D9H A;  2GPI A;  1A1G A;  1ZAA C;  2HC5 A;  1N36 E;  4ZYE A;  2VF1 A;  2CTD A;  4B3S E;  2ADR A;  4LF5 E;  1X6F A;  4ZYH A;  4M0V A;  2WBS A;  5A6J A;  2JY9 A;  4BBY A;  2ENC A;  2MKD A;  3MSW A;  2LBS B;  5BR8 E;  4WPY A;  2EPZ A;  3C6M A;  4BC7 A;  3C4T A;  4OX9 E;  1X5W A;  5KL7 A;  5IWA E;  4R2C A;  1HNZ E;  2B7T A;  4LU9 A;  3IWD A;  3J7A G;  1GTK A;  2EOM A;  1PKP A;  3LML A;  4ZYD A;  1JK2 A;  1STU A;  2EN1 A;  3QG5 C;  2EL6 A;  2L2M A;  3UK3 C;  1N34 E;  3J80 C;  1HNX E;  2N3H A;  2V83 A;  2JVA A;  4FK5 C;  1HR0 E;  1IBM E;  2VE7 C;  1PDA A;  1EH7 A;  4P78 A;  4HTG A;  5IT9 C;  5LMN E;  4B3M E;  3C4B A;  2L6M A;  4X62 E;  2DMY A;  2F4V E;  5F3W A;  4LF8 E;  1UHZ A;  2K7I A;  3OTO E;  5A6A A;  1P47 A;  1YPN A;  1FKA E;  1MEY C;  1XNQ E;  4BHC A;  1RC7 A;  2RSI A;  1J5E E;  2YTF A;  3EPL A;  2YU8 A;  4BHB A;  5AAS A;  2EL4 A;  4R2E A;  2EOE A;  4LF4 E;  2NUF A;  3VK6 A;  2LCE A;  1MGT A;  3T1H E;  5LL6 R;  1T4L B;  2EM2 A;  1LLM C;  1ZU1 A;  1O0W A;  4JI2 E;  2EPN A;  3MHH C;  1YZ9 A;  1X6E A;  1AAY A;  4NXN E;  4NXM E;  2EMF A;  2YTQ A;  2CT1 A;  2KHX A;  2DIX A;  4GEQ B;  4TUI A;  3BF2 A;  4JI0 E;  2G7H A;  2EMH A;  3THN A;  2YTJ A;  4P7D A;  3DF6 A;  4DUZ E;  4R2A A;  1DGC A;  4DUY E;  2JXP A;  2ODR C;  3F6H A;  1YUJ A;  4R2R A;  1A1L A;  4I8O A;  4M2Z A;  4JI3 E;  2EPC A;  1G2D C;  4B3R E;  1YUI A;  2KOU A;  1X3C A;  2EM6 A;  3KZY A;  4F9B B;  4TUG A;  3H09 A;  2UXC E;  2LO3 A;  4BC9 A;  4X65 E;  3M99 B;  2YSP A;  2EPR A;  2N3G A;  2I13 A;  2EPK X;  3HXL A;  3HPS A;  2LT7 A;  4JI8 E;  2VQF E;  2GHF A;  2EM4 A;  5LMU E;  4DV3 E;  4M9V C;  4LFB E;  3OML A;  2N8X A;  4Q35 B;  1AH5 A;  1ZBT A;  2RS7 A;  1RMD A;  2EML A;  3KWR A;  5LLQ A;  3IWC A;  1YYK A;  2YTE A;  4X9J A;  2VRD A;  4X66 E;  2EN4 A;  2EOZ A;  2EMA A;  3F6G A;  1X48 A;  3MHS C;  2A25 A;  5ADZ A;  2UUB E;  1IMU A;  4DR5 E;  2NUG A;  1X49 A;  1X47 A;  4KHP E;  2V8Q B;  2JYA A;  4LF6 E;  2L2K B;  2ELZ A;  2LTR A;  4DR1 E;  5A69 A;  2EMG A;  4YY3 E;  4DR3 E;  5A6B A;  2L3C A;  4O24 A;  5IV8 B;  5FLX C;  1DQ3 A;  3ECR A;  4WYQ B;  4Q28 A;  4IJD A;  3ADL A;  2EQ0 A;  3AV0 A;  2EM0 A;  2YZT A;  2M7Q A;  2L2N A;  2EP3 A;  2R76 A;  3HPZ A;  4F6M A;  2YTO A;  4MLV A;  2DRP A;  1IQS A;  1EH6 A;  2M4I A;  4YHH E;  4F54 A;  1YYO A;  4L5N C;  4F9C B;  2L8T A;  3FIG A;  2EE8 A;  2LUQ A;  2EMZ A;  2EMX A;  2EPP A;  2KON A;  2EQ1 A;  1GZ6 A;  5KL6 A;  5A6B D;  4R2Q A;  4BMJ A;  2NUE A;  2DLK A;  1T39 A;  1SR9 A;  2EMY A;  4JI6 E;  1WRJ A;  2EPO A;  2FV4 B;  2EM8 A;  4DV5 E;  2EOY A;  1YFH A;  1ZR9 A;  2EN6 A;  4R2S A;  4B3T E;  2MDG A;  4LTY A;  5DNY A;  4NZV A;  1WXR A;  2ZM6 E;  1UN6 B;  3L00 A;  4WFT A;  4F2J C;  1XMQ E;  2EMC A;  1XMO E;  2JOB A;  1BB8 A;  3ADI A;  4J8Z A;  1QU6 A;  1WHN A;  2E72 A;  2YRH A;  1F2I G;  2VQE E;  3ADJ A;  4F9A B;  2EN2 A;  1X6H A;  2EM3 A;  2H36 X;  4JI1 E;  2YTP A;  2UU9 E;  3BID A;  2B7V A;  2JWO A;  4R2D A;  2YTD A;  2YPN A;  3JTZ A;  1B69 A;  5AE3 A;  2YWQ A;  4JI7 E;  4KZS A;  4WXD A;  2YTI A;  1PJS A;  1TF6 A;  3HQ1 A;  2EOI A;  2UUA E;  2V88 A;  2CSH A;  5AC4 A;  2L33 A;  1A1J A;  2YSO A;  4DV0 E;  2EMB A;  2RTX A;  2DSY A;  5AE2 A;  2YT4 A;  2GLI A;  1T4N A;  4DKK A;  2EPM X;  3JU0 A;  3EQ1 A;  3THO B;  1Z1B A;  2EOJ A;  2RQL A;  4F6N A;  4GKJ E;  1WHQ A;  2MDR A;  2V89 A;  4K0K E;  2EM5 A;  2JPA A;  1IQO A;  2WZO A;  3RMP A;  4BCA A;  2YRM A;  2EOF A;  2EMW A;  2RS6 A;  3EPH A;  3JAM C;  4JI5 E;  2DMI A;  4DV7 E;  2DGC A;  2B9D A;  2ENA A;  2V86 A;  2EOH A;  2R1F A;  2WCC 3;  2EJ4 A;  1PJT A;  2EM9 A;  3EPK A;  2EOQ A;  1QNT A;  2ENH A;  4KWY A;  5KL3 A;  4WSP A;  2IHR 1;  2EPX A;  4LF7 E;  1DI2 A;  2EZ6 A;  4X8W A;  2V87 A;  4JV5 E;  2UXB E; 
#chains in the Genus database with same CATH homology
 4IS1 C;  4F6M A;  2EN3 A;  2YTO A;  2EOR A;  2DRP A;  3MHH C;  2DLQ A;  2EQ3 A;  5KL2 A;  2EN8 A;  2MKN A;  4GZN C;  1X6E A;  1AAY A;  2EMF A;  2YTQ A;  2RPC A;  2CT1 A;  2EE8 A;  2EMZ A;  2EMX A;  2EPP A;  2EQ1 A;  2EPU A;  2HGH A;  5KL6 A;  4R2Q A;  2JP9 A;  2EMH A;  2EM7 A;  2YTJ A;  2EMK A;  4R2A A;  2DLK A;  1A1I A;  1DGC A;  2EMY A;  2EOX A;  2BB8 A;  3EPJ A;  1YSA C;  1YUJ A;  4R2R A;  1A1L A;  2EMI A;  2EM8 A;  2EOY A;  1ZR9 A;  2D9H A;  2EN6 A;  4WSG A;  1NCS A;  4R2S A;  1A1G A;  2EL5 A;  1ZAA C;  2MDG A;  2YRK A;  1TF3 A;  2EPC A;  2EN7 A;  2CTD A;  1G2D C;  2ADR A;  1UN6 B;  4F2J C;  1YUI A;  1X6F A;  2EMC A;  2WBS A;  1BB8 A;  2EOS A;  2E72 A;  1X3C A;  2EM6 A;  2YRH A;  1F2I G;  2EN2 A;  2ENC A;  2MKD A;  2YTN A;  1X6H A;  2EPZ A;  1TN9 A;  2EM3 A;  2YTP A;  2LO3 A;  3M99 B;  1X5W A;  2YSP A;  5KL7 A;  2EPR A;  2LV2 A;  2YTD A;  4R2D A;  2PRT A;  1B69 A;  2EOO A;  4R2C A;  2I13 A;  1WJP A;  2LT7 A;  1G2F C;  2EOM A;  1UBD C;  2NAB A;  2GHF A;  2YTI A;  1A1K A;  1TF6 A;  2EM4 A;  1JK2 A;  1A1H A;  4M9V C;  2EOI A;  2YU5 A;  2ELY A;  2EN1 A;  1RMD A;  2EML A;  2CSH A;  2EL6 A;  3UK3 C;  3VHT B;  2YTE A;  4X9J A;  2VRD A;  1A1J A;  2YSO A;  2EMB A;  2EN4 A;  2EOZ A;  4FK5 C;  2GLI A;  2J7J A;  2WBU A;  2EMA A;  1Z1B A;  2M9A A;  1BBO A;  2EOJ A;  3MHS C;  2A25 A;  1KJK A;  4F6N A;  2EM5 A;  2JPA A;  2YTG A;  2YRM A;  1P47 A;  2EOF A;  2ELZ A;  5KL4 A;  2EMW A;  1MEY C;  3EPH A;  1JK1 A;  2EMG A;  2DMI A;  2RSI A;  2DGC A;  2ENA A;  2YTF A;  2EOH A;  3EPL A;  2R1F A;  2YU8 A;  2WCC 3;  2EJ4 A;  2EM9 A;  3EPK A;  2EOQ A;  4R2P A;  2EL4 A;  4R2E A;  2EOE A;  4IJD A;  2ENH A;  5KL3 A;  2LVH A;  2EPX A;  2LCE A;  5KL5 A;  2EPA A;  2EQ0 A;  2WBT A;  2EM0 A;  1A1F A;  2EM2 A;  1LLM C;  1ZU1 A;  2EP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...