1UN6B

The crystal structure of a zinc finger - rna complex reveals two modes of molecular recognition
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
86
structure length
86
Chain Sequence
MYVCHFENCGKAFKKHNQLKVHQFSHTQQLPYECPHEGCDKRFSLPSRLKRHEKVHAGYPCKKDDSCSFVGKTWTLYLKHVAECHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSCRIPTION FACTOR IIIA
publication title Crystal Structure of a Zinc-Finger-RNA Complex Reveals Two Modes of Molecular Recognition
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Rna-binding protein/rna
total genus 25
structure length 86
sequence length 86
chains with identical sequence C, D
ec nomenclature
pdb deposition date 2003-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1un6B02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1un6B01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1un6B03
1JK1A 1G2DC 2M9AA 4R2PA 2ENCA 2EOHA 2YTJA 4R2DA 2EPUA 1X6EA 1B69A 2EE8A 2EL4A 5KL3A 4X9JA 2EOMA 1BB8A 1X6FA 2RSIA 1A1HA 2EOEA 2LCEA 1A1LA 2EMAA 2YRMA 2YRKA 2YSOA 2EOXA 2LVHA 2EQ3A 2EN2A 2I13A 2EM3A 2VRDA 2EM2A 2EM0A 2ENAA 2YSPA 1YUJA 2EMWA 5KL7A 2EL5A 2EMGA 2EN3A 2EOIA 2EOOA 2WBTA 4WSGA 2YTNA 1G2FC 1RMDA 2EOSA 2EPCA 3MHHC 1NCSA 1P47A 3EPHA 2EPZA 2EMKA 4R2AA 2R1FA 4IJDA 2WBSA 2MKNA 1DGCA 3EPLA 4F2JC 5KL6A 2EPRA 2EMFA 2EOZA 2DLKA 1X6HA 1WJPA 2EN6A 2EM8A 2EMXA 2YTPA 2EMLA 1Z1BA 1LLMC 1F2IG 2YTEA 2EORA 2YTOA 1X5WA 4F6MA 4F6NA 2D9HA 2EOJA 2DRPA 2EM7A 2EOQA 2ELZA 2PRTA 2EM5A 2EJ4A 2EPXA 2ENHA 1A1GA 4M9VC 2MKDA 1MEYC 2GLIA 2BB8A 1A1IA 2YU8A 1BBOA 4R2QA 2LT7A 1YUIA 1TN9A 2ELYA 3EPKA 2EMZA 2EM4A 2EM9A 1UN6B 1ZR9A 1UBDC 2EOYA 1KJKA 2NABA 2GHFA 2EQ0A 2MDGA 5KL4A 2EPPA 1ZU1A 2EMYA 2ADRA 2YTFA 2EL6A 3EPJA 2E72A 2YTGA 3UK3C 2EPAA 2EN4A 2RPCA 4R2RA 2LO3A 1A1JA 2CSHA 3MHSC 2YRHA 1X3CA 2YTDA 2WCC3 2EN1A 1YSAC 2J7JA 2LV2A 2HGHA 2CT1A 2JPAA 2YTQA 5KL2A 2EMBA 2EMCA 4IS1C 2JP9A 2DGCA 2EMHA 1AAYA 2EM6A 5KL5A 1JK2A 2EN7A 1TF6A 1A1FA 2A25A 2EP3A 2EQ1A 1A1KA 4GZNC 3VHTB 3M99B 1ZAAC 2EMIA 4R2CA 4R2SA 1TF3A 2YU5A 2WBUA 2CTDA 2EOFA 2EN8A 2DLQA 2YTIA 4FK5C 2DMIA 4R2EA
chains in the Genus database with same CATH superfamily
4F9BB 3T1YE 4JI6E 4R2PA 4B3RE 2WZOA 2ENCA 2KHXA 4HTGA 1X6FA 2RSIA 2L3CA 2JOXA 2YRKA 4Q35B 5IXMB 2YZTA 2EOXA 4F9AB 2VRDA 2ENAA 2MC6A 4BC9A 2V86A 5IT9C 2YTNA 2E1MA 3HPZA 2L2KB 1P47A 1NCSA 2ODRC 2RTXA 1O0WA 2NUGA 4IJDA 2MKNA 2NA2A 1DGCA 4F2JC 3H09A 1J26A 5KL6A 2EOZA 1WXRA 3IWDA 1X6HA 4P7DA 4B3ME 1L4SA 3C6MA 1F2IG 3ADGA 2HHHE 2L92A 4WYQB 4F6MA 1YZ9A 2D9HA 2EOJA 2EPNA 2EM7A 1PJSA 1N32E 4JYAE 2EM5A 2MKDA 4F9CB 1IQSA 3BGHA 5IWAE 2YU8A 2LTSA 3JU0A 2EPLX 3ECRA 4DKKA 3EPKA 2EM9A 1UN6B 1UBDC 2F4VE 2EQ0A 3AUZA 5T6JA 3THNA 3F6GA 4NXME 4KWYA 1AH5A 4NZVA 2EL6A 2B3TB 2DIXA 2KONA 4BMJA 2FV4B 2YTGA 2EN4A 2EPAA 2LO3A 4X64E 3MHSC 2UU9E 2EWLA 3J7Yp 1QU6A 2JPAA 2L2NA 4LF4E 2JYAA 4R03A 2EMCA 2EPKX 4BCAA 5ADZA 4GKKE 1AAYA 1TF6A 2NUFA 2A25A 1N3GA 2EQ1A 5A6BA 4YY3E 3VHTB 4LF8E 5A6AA 4DV6E 2WBUA 2CTDA 2DLQA 2L3JA 3LLHA 4FK5C 2DMIA 4R2EA 4DUZE 2LUPB 1G2DC 2EOHA 2YTJA 4L8NA 2EPOA 2HJJA 5AASA 1B69A 5KL3A 5AE1A 1I94E 4GKJE 4GEQB 4WXDA 3TQMA 2LCEA 4ZYHA 2EMAA 2YRMA 2YSOA 2L6MA 4NHRA 2LMZA 1YYKA 2B7VA 4ZYDA 1FKAE 4M30A 5KL7A 1HNZE 4B3TE 2EOOA 2YT4A 3KZZA 2WBTA 5IV8B 1G2FC 2UXCE 2EOSA 1N33E 4DR6E 4O4KA 2EPZA 2CPNA 2WBSA 2ODRD 5CFFE 1EKZA 2GPIA 2EM8A 2EMLA 2G7HA 2VF1A 2BBGA 2IHR1 4X62E 1LLMC 4DR3E 2YTOA 2LTRA 2DB2A 4F6NA 3AV0A 4M9VC 4L5NC 5LL6R 1MEYC 1T4NA 4RH8A 3J7AG 2ELYA 2EMZA 4HEIA 1HNXE 1KJKA 3MSWA 2MDGA 1ZU1A 1PKPA 2ADRA 2YTFA 4RHBB 1YYOA 2ZM6E 1SR9A 5LMUE 2M1SA 1T38A 3ADLA 4R8OA 3UK3C 2KOUA 4X66E 3K6QA 1HNWE 2YRHA 3ZOQB 1X3CA 2YTDA 4LU9A 1YSAC 2J7JA 2HGHA 2E5LE 4DV5E 5AE3A 1HR0E 3F6HA 1X48A 2DGCA 5LMNE 1N34E 2JWOA 4N4RB 2UUBE 4DV7E 3M99B 4DR2E 1XMOE 1ZAAC 2EMIA 1ZBTA 3T1HE 2V83A 2YU5A 2EOFA 1GQEA 2YTIA 2RSMA 3HTXA 2DSYA 1JK1A 1T4OA 1SFEA 4KHPE 5AC5A 4R2DA 1X6EA 4DV1E 2EE8A 4X9JA 3OMLA 1BB8A 2V89A 4X65E 3J80C 1A1LA 2Q8UA 3THOB 1PJTA 1XNQE 3FIGA 3VK6A 4DR1E 4JV5E 2I13A 2EM3A 2NUEA 2HC5A 4LFCE 2EMWA 1DQ3A 4JI2E 2EMGA 2EN3A 2JXPA 3C4TA 4JI3E 4KZSA 4WSGA 2EZ6A 1RMDA 3LMLA 2EPCA 4AQYE 3JTZA 3EQ1A 5F3WA 3EPHA 2UXDE 2EMKA 4R2AA 2R1FA 2L2MA 4YHHE 4TUGA 4WFTA 2EMFA 3BF2A 4DUYE 4JI7E 2DLKA 2EN6A 1WJPA 2EMXA 2YTPA 3J81C 5A69A 1Z1BA 3P1XA 3OTOE 2YTEA 4BS9A 2VQFE 4BHCA 4WXCA 4X8WA 2EOQA 3VYXA 2PRTA 2GLIA 2BB8A 1A1IA 1BBOA 4R2QA 2LT7A 2LJHA 3ADJA 1TN9A 3C4BA 4MLQA 4LFAE 2EM4A 3HPSA 4LTYA 3VYYA 1ZR9A 2EOYA 2EPMX 2GHFA 2LUQA 2EPPA 2YWQA 2EMYA 4JI1E 2K7IA 4B3SE 4M2ZA 5TSEA 4O24A 3EPJA 3KZYA 2E72A 2RPCA 4LF7E 1WHNA 4R2RA 4DV2E 1IBLE 1A1JA 4LFBE 1WRJA 1X49A 2LV2A 1XNRE 2YTQA 2M7QA 2MDRA 2EMBA 2JP9A 1XMQE 1EH6A 4LF5E 2EMHA 1EH8A 4O43A 1JK2A 2EP3A 1A1KA 1ZBQA 1MGTA 1IQOA 4OOGC 1STUA 4R2SA 1GZ6A 1TF3A 3L00A 4LF6E 2EN8A 3C6KA 3ADIA 5LLQA 2JOBA 4TUIA 4Q28A 4DMIA 4O5GA 1IBME 2V85A 2FGGA 4NXNE 2F8BA 2M9AA 4K0KE 2V8QB 3BBGA 4DR7E 2LBSB 1IMUA 2MC5A 2RS7A 1UILA 1T4LB 2EPUA 2N8XA 3JAMC 2EL4A 1PDAA 3IWCA 2EOMA 1YYWA 2UUCE 1YPNA 1A1HA 2DMYA 2H36X 3HXLA 2EOEA 5A6JA 3DF6A 2B7TA 2LVHA 2EQ3A 3IWBA 4JI5E 2EN2A 4M0VA 2EM2A 2EM0A 2M4IA 2YSPA 1YUJA 2RQLA 4ZYEA 5FLXC 1RQ0A 2EL5A 2EOIA 1UHZA 1QNTA 4DV4E 4BHBA 1BBGA 2YPNA 5AE2A 4DV0E 2VE7C 3MHHC 2L8TA 3EPLA 5BR8E 2EPRA 1WHQA 2V88A 2UXBE 1N36E 4I8OA 4MLVA 1PJQA 2FTXB 1DI2A 2EORA 4LF9E 1X5WA 5A6BD 5DNYA 2B9DA 2DRPA 2ELZA 1A1GA 2EJ4A 2EPXA 2VQEE 2ENHA 2JVAA 1FJGE 4OX9E 2N3HA 4P78A 3BIDA 4JI4E 1YUIA 3HQ1A 1T39A 1EH7A 4DR4E 1J5EE 2K4VA 2NABA 5KL4A 4DV3E 4BC7A 3RMPA 2UUAE 1NEIA 2LJUA 1X47A 2LRSA 1IBKE 1GTKA 3DJWA 4J8ZA 4ZYGA 4F54A 5A2QC 2CSHA 4WX9A 2WCC3 4WPYA 2EN1A 2L33A 5A6KA 4JI8E 2I9IA 4WSPA 4DR5E 1KYQA 2CT1A 2JR1A 3QG5C 1YFHA 5KL2A 2R76A 4IS1C 5AC4A 2EM6A 5KL5A 2EN7A 4BBYA 1A1FA 3KWRA 4GZNC 1RC7A 2N3GA 2V87A 2RS6A 4JI0E 2JY9A 4R2CA 2LE2A
chains in the Genus database with same CATH topology
1JK1A 1G2DC 2M9AA 4R2PA 2ENCA 2EOHA 2YTJA 4R2DA 2EPUA 1X6EA 1B69A 2EE8A 2EL4A 5KL3A 4X9JA 2EOMA 1BB8A 1X6FA 2RSIA 1A1HA 2EOEA 2LCEA 1A1LA 2EMAA 2YRMA 2YRKA 2YSOA 2EOXA 2LVHA 2EQ3A 2EN2A 2I13A 2EM3A 2VRDA 2EM2A 2EM0A 2ENAA 2YSPA 1YUJA 2EMWA 5KL7A 2EL5A 2EMGA 2EN3A 2EOIA 2EOOA 2WBTA 4WSGA 2YTNA 1G2FC 1RMDA 2EOSA 2EPCA 3MHHC 1NCSA 1P47A 3EPHA 2EPZA 2EMKA 4R2AA 2R1FA 4IJDA 2WBSA 2MKNA 1DGCA 3EPLA 4F2JC 5KL6A 2EPRA 2EMFA 2EOZA 2DLKA 1X6HA 1WJPA 2EN6A 2EM8A 2EMXA 2YTPA 2EMLA 1Z1BA 1LLMC 1F2IG 2YTEA 2EORA 2YTOA 1X5WA 4F6MA 4F6NA 2D9HA 2EOJA 2DRPA 2EM7A 2EOQA 2ELZA 2PRTA 2EM5A 2EJ4A 2EPXA 2ENHA 1A1GA 4M9VC 2MKDA 1MEYC 2GLIA 2BB8A 1A1IA 2YU8A 1BBOA 4R2QA 2LT7A 1YUIA 1TN9A 2ELYA 3EPKA 2EMZA 2EM4A 2EM9A 1UN6B 1ZR9A 1UBDC 2EOYA 1KJKA 2NABA 2GHFA 2EQ0A 2MDGA 5KL4A 2EPPA 1ZU1A 2EMYA 2ADRA 2YTFA 2EL6A 3EPJA 2E72A 2YTGA 3UK3C 2EPAA 2EN4A 2RPCA 4R2RA 2LO3A 1A1JA 2CSHA 3MHSC 2YRHA 1X3CA 2YTDA 2WCC3 2EN1A 1YSAC 2J7JA 2LV2A 2HGHA 2CT1A 2JPAA 2YTQA 5KL2A 2EMBA 2EMCA 4IS1C 2JP9A 2DGCA 2EMHA 1AAYA 2EM6A 5KL5A 1JK2A 2EN7A 1TF6A 1A1FA 2A25A 2EP3A 2EQ1A 1A1KA 4GZNC 3VHTB 3M99B 1ZAAC 2EMIA 4R2CA 4R2SA 1TF3A 2YU5A 2WBUA 2CTDA 2EOFA 2EN8A 2DLQA 2YTIA 4FK5C 2DMIA 4R2EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JK1 A;  1G2D C;  2M9A A;  4R2P A;  2ENC A;  2EOH A;  2YTJ A;  4R2D A;  2EPU A;  1X6E A;  1B69 A;  2EE8 A;  2EL4 A;  5KL3 A;  4X9J A;  2EOM A;  1BB8 A;  1X6F A;  2RSI A;  1A1H A;  2EOE A;  2LCE A;  1A1L A;  2EMA A;  2YRM A;  2YRK A;  2YSO A;  2EOX A;  2LVH A;  2EQ3 A;  2EN2 A;  2I13 A;  2EM3 A;  2VRD A;  2EM2 A;  2EM0 A;  2ENA A;  2YSP A;  1YUJ A;  2EMW A;  5KL7 A;  2EL5 A;  2EMG A;  2EN3 A;  2EOI A;  2EOO A;  2WBT A;  4WSG A;  2YTN A;  1G2F C;  1RMD A;  2EOS A;  2EPC A;  3MHH C;  1NCS A;  1P47 A;  3EPH A;  2EPZ A;  2EMK A;  4R2A A;  2R1F A;  4IJD A;  2WBS A;  2MKN A;  1DGC A;  3EPL A;  4F2J C;  5KL6 A;  2EPR A;  2EMF A;  2EOZ A;  2DLK A;  1X6H A;  1WJP A;  2EN6 A;  2EM8 A;  2EMX A;  2YTP A;  2EML A;  1Z1B A;  1LLM C;  1F2I G;  2YTE A;  2EOR A;  2YTO A;  1X5W A;  4F6M A;  4F6N A;  2D9H A;  2EOJ A;  2DRP A;  2EM7 A;  2EOQ A;  2ELZ A;  2PRT A;  2EM5 A;  2EJ4 A;  2EPX A;  2ENH A;  1A1G A;  4M9V C;  2MKD A;  1MEY C;  2GLI A;  2BB8 A;  1A1I A;  2YU8 A;  1BBO A;  4R2Q A;  2LT7 A;  1YUI A;  1TN9 A;  2ELY A;  3EPK A;  2EMZ A;  2EM4 A;  2EM9 A;  1UN6 B;  1ZR9 A;  1UBD C;  2EOY A;  1KJK A;  2NAB A;  2GHF A;  2EQ0 A;  2MDG A;  5KL4 A;  2EPP A;  1ZU1 A;  2EMY A;  2ADR A;  2YTF A;  2EL6 A;  3EPJ A;  2E72 A;  2YTG A;  3UK3 C;  2EPA A;  2EN4 A;  2RPC A;  4R2R A;  2LO3 A;  1A1J A;  2CSH A;  3MHS C;  2YRH A;  1X3C A;  2YTD A;  2WCC 3;  2EN1 A;  1YSA C;  2J7J A;  2LV2 A;  2HGH A;  2CT1 A;  2JPA A;  2YTQ A;  5KL2 A;  2EMB A;  2EMC A;  4IS1 C;  2JP9 A;  2DGC A;  2EMH A;  1AAY A;  2EM6 A;  5KL5 A;  1JK2 A;  2EN7 A;  1TF6 A;  1A1F A;  2A25 A;  2EP3 A;  2EQ1 A;  1A1K A;  4GZN C;  3VHT B;  3M99 B;  1ZAA C;  2EMI A;  4R2C A;  4R2S A;  1TF3 A;  2YU5 A;  2WBU A;  2CTD A;  2EOF A;  2EN8 A;  2DLQ A;  2YTI A;  4FK5 C;  2DMI A;  4R2E A; 
#chains in the Genus database with same CATH topology
 4F9B B;  3T1Y E;  4JI6 E;  4R2P A;  4B3R E;  2WZO A;  2ENC A;  2KHX A;  4HTG A;  1X6F A;  2RSI A;  2L3C A;  2JOX A;  2YRK A;  4Q35 B;  5IXM B;  2YZT A;  2EOX A;  4F9A B;  2VRD A;  2ENA A;  2MC6 A;  4BC9 A;  2V86 A;  5IT9 C;  2YTN A;  2E1M A;  3HPZ A;  2L2K B;  1P47 A;  1NCS A;  2ODR C;  2RTX A;  1O0W A;  2NUG A;  4IJD A;  2MKN A;  2NA2 A;  1DGC A;  4F2J C;  3H09 A;  1J26 A;  5KL6 A;  2EOZ A;  1WXR A;  3IWD A;  1X6H A;  4P7D A;  4B3M E;  1L4S A;  3C6M A;  1F2I G;  3ADG A;  2HHH E;  2L92 A;  4WYQ B;  4F6M A;  1YZ9 A;  2D9H A;  2EOJ A;  2EPN A;  2EM7 A;  1PJS A;  1N32 E;  4JYA E;  2EM5 A;  2MKD A;  4F9C B;  1IQS A;  3BGH A;  5IWA E;  2YU8 A;  2LTS A;  3JU0 A;  2EPL X;  3ECR A;  4DKK A;  3EPK A;  2EM9 A;  1UN6 B;  1UBD C;  2F4V E;  2EQ0 A;  3AUZ A;  5T6J A;  3THN A;  3F6G A;  4NXM E;  4KWY A;  1AH5 A;  4NZV A;  2EL6 A;  2B3T B;  2DIX A;  2KON A;  4BMJ A;  2FV4 B;  2YTG A;  2EN4 A;  2EPA A;  2LO3 A;  4X64 E;  3MHS C;  2UU9 E;  2EWL A;  3J7Y p;  1QU6 A;  2JPA A;  2L2N A;  4LF4 E;  2JYA A;  4R03 A;  2EMC A;  2EPK X;  4BCA A;  5ADZ A;  4GKK E;  1AAY A;  1TF6 A;  2NUF A;  2A25 A;  1N3G A;  2EQ1 A;  5A6B A;  4YY3 E;  3VHT B;  4LF8 E;  5A6A A;  4DV6 E;  2WBU A;  2CTD A;  2DLQ A;  2L3J A;  3LLH A;  4FK5 C;  2DMI A;  4R2E A;  4DUZ E;  2LUP B;  1G2D C;  2EOH A;  2YTJ A;  4L8N A;  2EPO A;  2HJJ A;  5AAS A;  1B69 A;  5KL3 A;  5AE1 A;  1I94 E;  4GKJ E;  4GEQ B;  4WXD A;  3TQM A;  2LCE A;  4ZYH A;  2EMA A;  2YRM A;  2YSO A;  2L6M A;  4NHR A;  2LMZ A;  1YYK A;  2B7V A;  4ZYD A;  1FKA E;  4M30 A;  5KL7 A;  1HNZ E;  4B3T E;  2EOO A;  2YT4 A;  3KZZ A;  2WBT A;  5IV8 B;  1G2F C;  2UXC E;  2EOS A;  1N33 E;  4DR6 E;  4O4K A;  2EPZ A;  2CPN A;  2WBS A;  2ODR D;  5CFF E;  1EKZ A;  2GPI A;  2EM8 A;  2EML A;  2G7H A;  2VF1 A;  2BBG A;  2IHR 1;  4X62 E;  1LLM C;  4DR3 E;  2YTO A;  2LTR A;  2DB2 A;  4F6N A;  3AV0 A;  4M9V C;  4L5N C;  5LL6 R;  1MEY C;  1T4N A;  4RH8 A;  3J7A G;  2ELY A;  2EMZ A;  4HEI A;  1HNX E;  1KJK A;  3MSW A;  2MDG A;  1ZU1 A;  1PKP A;  2ADR A;  2YTF A;  4RHB B;  1YYO A;  2ZM6 E;  1SR9 A;  5LMU E;  2M1S A;  1T38 A;  3ADL A;  4R8O A;  3UK3 C;  2KOU A;  4X66 E;  3K6Q A;  1HNW E;  2YRH A;  3ZOQ B;  1X3C A;  2YTD A;  4LU9 A;  1YSA C;  2J7J A;  2HGH A;  2E5L E;  4DV5 E;  5AE3 A;  1HR0 E;  3F6H A;  1X48 A;  2DGC A;  5LMN E;  1N34 E;  2JWO A;  4N4R B;  2UUB E;  4DV7 E;  3M99 B;  4DR2 E;  1XMO E;  1ZAA C;  2EMI A;  1ZBT A;  3T1H E;  2V83 A;  2YU5 A;  2EOF A;  1GQE A;  2YTI A;  2RSM A;  3HTX A;  2DSY A;  1JK1 A;  1T4O A;  1SFE A;  4KHP E;  5AC5 A;  4R2D A;  1X6E A;  4DV1 E;  2EE8 A;  4X9J A;  3OML A;  1BB8 A;  2V89 A;  4X65 E;  3J80 C;  1A1L A;  2Q8U A;  3THO B;  1PJT A;  1XNQ E;  3FIG A;  3VK6 A;  4DR1 E;  4JV5 E;  2I13 A;  2EM3 A;  2NUE A;  2HC5 A;  4LFC E;  2EMW A;  1DQ3 A;  4JI2 E;  2EMG A;  2EN3 A;  2JXP A;  3C4T A;  4JI3 E;  4KZS A;  4WSG A;  2EZ6 A;  1RMD A;  3LML A;  2EPC A;  4AQY E;  3JTZ A;  3EQ1 A;  5F3W A;  3EPH A;  2UXD E;  2EMK A;  4R2A A;  2R1F A;  2L2M A;  4YHH E;  4TUG A;  4WFT A;  2EMF A;  3BF2 A;  4DUY E;  4JI7 E;  2DLK A;  2EN6 A;  1WJP A;  2EMX A;  2YTP A;  3J81 C;  5A69 A;  1Z1B A;  3P1X A;  3OTO E;  2YTE A;  4BS9 A;  2VQF E;  4BHC A;  4WXC A;  4X8W A;  2EOQ A;  3VYX A;  2PRT A;  2GLI A;  2BB8 A;  1A1I A;  1BBO A;  4R2Q A;  2LT7 A;  2LJH A;  3ADJ A;  1TN9 A;  3C4B A;  4MLQ A;  4LFA E;  2EM4 A;  3HPS A;  4LTY A;  3VYY A;  1ZR9 A;  2EOY A;  2EPM X;  2GHF A;  2LUQ A;  2EPP A;  2YWQ A;  2EMY A;  4JI1 E;  2K7I A;  4B3S E;  4M2Z A;  5TSE A;  4O24 A;  3EPJ A;  3KZY A;  2E72 A;  2RPC A;  4LF7 E;  1WHN A;  4R2R A;  4DV2 E;  1IBL E;  1A1J A;  4LFB E;  1WRJ A;  1X49 A;  2LV2 A;  1XNR E;  2YTQ A;  2M7Q A;  2MDR A;  2EMB A;  2JP9 A;  1XMQ E;  1EH6 A;  4LF5 E;  2EMH A;  1EH8 A;  4O43 A;  1JK2 A;  2EP3 A;  1A1K A;  1ZBQ A;  1MGT A;  1IQO A;  4OOG C;  1STU A;  4R2S A;  1GZ6 A;  1TF3 A;  3L00 A;  4LF6 E;  2EN8 A;  3C6K A;  3ADI A;  5LLQ A;  2JOB A;  4TUI A;  4Q28 A;  4DMI A;  4O5G A;  1IBM E;  2V85 A;  2FGG A;  4NXN E;  2F8B A;  2M9A A;  4K0K E;  2V8Q B;  3BBG A;  4DR7 E;  2LBS B;  1IMU A;  2MC5 A;  2RS7 A;  1UIL A;  1T4L B;  2EPU A;  2N8X A;  3JAM C;  2EL4 A;  1PDA A;  3IWC A;  2EOM A;  1YYW A;  2UUC E;  1YPN A;  1A1H A;  2DMY A;  2H36 X;  3HXL A;  2EOE A;  5A6J A;  3DF6 A;  2B7T A;  2LVH A;  2EQ3 A;  3IWB A;  4JI5 E;  2EN2 A;  4M0V A;  2EM2 A;  2EM0 A;  2M4I A;  2YSP A;  1YUJ A;  2RQL A;  4ZYE A;  5FLX C;  1RQ0 A;  2EL5 A;  2EOI A;  1UHZ A;  1QNT A;  4DV4 E;  4BHB A;  1BBG A;  2YPN A;  5AE2 A;  4DV0 E;  2VE7 C;  3MHH C;  2L8T A;  3EPL A;  5BR8 E;  2EPR A;  1WHQ A;  2V88 A;  2UXB E;  1N36 E;  4I8O A;  4MLV A;  1PJQ A;  2FTX B;  1DI2 A;  2EOR A;  4LF9 E;  1X5W A;  5A6B D;  5DNY A;  2B9D A;  2DRP A;  2ELZ A;  1A1G A;  2EJ4 A;  2EPX A;  2VQE E;  2ENH A;  2JVA A;  1FJG E;  4OX9 E;  2N3H A;  4P78 A;  3BID A;  4JI4 E;  1YUI A;  3HQ1 A;  1T39 A;  1EH7 A;  4DR4 E;  1J5E E;  2K4V A;  2NAB A;  5KL4 A;  4DV3 E;  4BC7 A;  3RMP A;  2UUA E;  1NEI A;  2LJU A;  1X47 A;  2LRS A;  1IBK E;  1GTK A;  3DJW A;  4J8Z A;  4ZYG A;  4F54 A;  5A2Q C;  2CSH A;  4WX9 A;  2WCC 3;  4WPY A;  2EN1 A;  2L33 A;  5A6K A;  4JI8 E;  2I9I A;  4WSP A;  4DR5 E;  1KYQ A;  2CT1 A;  2JR1 A;  3QG5 C;  1YFH A;  5KL2 A;  2R76 A;  4IS1 C;  5AC4 A;  2EM6 A;  5KL5 A;  2EN7 A;  4BBY A;  1A1F A;  3KWR A;  4GZN C;  1RC7 A;  2N3G A;  2V87 A;  2RS6 A;  4JI0 E;  2JY9 A;  4R2C A;  2LE2 A; 
#chains in the Genus database with same CATH homology
 1JK1 A;  1G2D C;  2M9A A;  4R2P A;  2ENC A;  2EOH A;  2YTJ A;  4R2D A;  2EPU A;  1X6E A;  1B69 A;  2EE8 A;  2EL4 A;  5KL3 A;  4X9J A;  2EOM A;  1BB8 A;  1X6F A;  2RSI A;  1A1H A;  2EOE A;  2LCE A;  1A1L A;  2EMA A;  2YRM A;  2YRK A;  2YSO A;  2EOX A;  2LVH A;  2EQ3 A;  2EN2 A;  2I13 A;  2EM3 A;  2VRD A;  2EM2 A;  2EM0 A;  2ENA A;  2YSP A;  1YUJ A;  2EMW A;  5KL7 A;  2EL5 A;  2EMG A;  2EN3 A;  2EOI A;  2EOO A;  2WBT A;  4WSG A;  2YTN A;  1G2F C;  1RMD A;  2EOS A;  2EPC A;  3MHH C;  1NCS A;  1P47 A;  3EPH A;  2EPZ A;  2EMK A;  4R2A A;  2R1F A;  4IJD A;  2WBS A;  2MKN A;  1DGC A;  3EPL A;  4F2J C;  5KL6 A;  2EPR A;  2EMF A;  2EOZ A;  2DLK A;  1X6H A;  1WJP A;  2EN6 A;  2EM8 A;  2EMX A;  2YTP A;  2EML A;  1Z1B A;  1LLM C;  1F2I G;  2YTE A;  2EOR A;  2YTO A;  1X5W A;  4F6M A;  4F6N A;  2D9H A;  2EOJ A;  2DRP A;  2EM7 A;  2EOQ A;  2ELZ A;  2PRT A;  2EM5 A;  2EJ4 A;  2EPX A;  2ENH A;  1A1G A;  4M9V C;  2MKD A;  1MEY C;  2GLI A;  2BB8 A;  1A1I A;  2YU8 A;  1BBO A;  4R2Q A;  2LT7 A;  1YUI A;  1TN9 A;  2ELY A;  3EPK A;  2EMZ A;  2EM4 A;  2EM9 A;  1UN6 B;  1ZR9 A;  1UBD C;  2EOY A;  1KJK A;  2NAB A;  2GHF A;  2EQ0 A;  2MDG A;  5KL4 A;  2EPP A;  1ZU1 A;  2EMY A;  2ADR A;  2YTF A;  2EL6 A;  3EPJ A;  2E72 A;  2YTG A;  3UK3 C;  2EPA A;  2EN4 A;  2RPC A;  4R2R A;  2LO3 A;  1A1J A;  2CSH A;  3MHS C;  2YRH A;  1X3C A;  2YTD A;  2WCC 3;  2EN1 A;  1YSA C;  2J7J A;  2LV2 A;  2HGH A;  2CT1 A;  2JPA A;  2YTQ A;  5KL2 A;  2EMB A;  2EMC A;  4IS1 C;  2JP9 A;  2DGC A;  2EMH A;  1AAY A;  2EM6 A;  5KL5 A;  1JK2 A;  2EN7 A;  1TF6 A;  1A1F A;  2A25 A;  2EP3 A;  2EQ1 A;  1A1K A;  4GZN C;  3VHT B;  3M99 B;  1ZAA C;  2EMI A;  4R2C A;  4R2S A;  1TF3 A;  2YU5 A;  2WBU A;  2CTD A;  2EOF A;  2EN8 A;  2DLQ A;  2YTI A;  4FK5 C;  2DMI A;  4R2E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...