1UN6B

The crystal structure of a zinc finger - rna complex reveals two modes of molecular recognition
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
86
structure length
86
Chain Sequence
MYVCHFENCGKAFKKHNQLKVHQFSHTQQLPYECPHEGCDKRFSLPSRLKRHEKVHAGYPCKKDDSCSFVGKTWTLYLKHVAECHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of a Zinc-Finger-RNA Complex Reveals Two Modes of Molecular Recognition
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Rna-binding protein/rna
molecule keywords TRANSCRIPTION FACTOR IIIA
total genus 25
structure length 86
sequence length 86
chains with identical sequence C, D
ec nomenclature
pdb deposition date 2003-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1un6B02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1un6B01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1un6B03
4R2AA 4F6NA 1X6EA 2EMYA 2YSPA 2EM5A 1ZU1A 2LV2A 2WBTA 4R2SA 1A1IA 1X6FA 5KL5A 2EL6A 2MKNA 2EE8A 2EMLA 3VHTB 5KL3A 1UBDC 2YTDA 2GLIA 2MDGA 2ENHA 3M99B 2EN8A 5KL2A 2EPAA 2EM2A 2EM6A 2I13A 1YUJA 1TF6A 2EMAA 1A1JA 2EOEA 2RPCA 1NCSA 2HGHA 2EN7A 2EM7A 2EOOA 4M9VC 2EMXA 2CTDA 2EOYA 3MHHC 1RMDA 4X9JA 2LT7A 2WBUA 2EORA 1BBOA 1MEYC 2YSOA 2EOSA 2E72A 1B69A 2RSIA 2CT1A 1ZR9A 2NABA 1X3CA 2YTFA 2YTQA 1JK2A 2DGCA 3EPHA 3EPJA 4WSGA 4F2JC 2EM9A 3EPKA 3EPLA 2EMWA 2EQ3A 2EMCA 2EM0A 2EN1A 2R1FA 2DLKA 2YRKA 4R2PA 1YUIA 2EPPA 2YU8A 2EPRA 2YTPA 2ENCA 2YTJA 2EL4A 1G2FC 2YTGA 1KJKA 2EOFA 1WJPA 2EOHA 1Z1BA 1UN6B 2J7JA 2CSHA 1X5WA 2LO3A 4R2EA 2ADRA 2EL5A 2EN6A 3UK3C 1A1LA 2EPZA 4IJDA 1TF3A 2YTEA 2YTIA 2YRHA 2EOQA 2JP9A 2EMBA 1ZAAC 4GZNC 2EMHA 2MKDA 2ELYA 2EM4A 2VRDA 2EN2A 2EM3A 2EOXA 2WBSA 2EPUA 2EMZA 1A1FA 2A25A 1LLMC 1A1KA 2YTNA 1TN9A 2LCEA 2M9AA 2WCC3 1JK1A 4R2QA 2YU5A 2YTOA 3MHSC 2D9HA 2EOIA 2EOZA 2EMFA 1G2DC 1A1GA 2EMIA 2BB8A 2DLQA 1P47A 2EN4A 1BB8A 2GHFA 2EOJA 4IS1C 2EQ0A 2LVHA 2EPCA 1YSAC 2EQ1A 1AAYA 2EOMA 2EJ4A 2YRMA 2EP3A 5KL4A 1DGCA 4R2CA 2EMGA 2EM8A 2DMIA 4R2DA 1X6HA 4R2RA 1A1HA 2EPXA 5KL7A 2EN3A 4FK5C 5KL6A 2PRTA 2ENAA 1F2IG 2DRPA 2ELZA 4F6MA 2EMKA 2JPAA
chains in the Genus database with same CATH superfamily
1IBKE 4LFBE 1A1IA 2L33A 5KL5A 2EL6A 1PKPA 2F8BA 3VHTB 2EPNA 2EZ6A 1UBDC 4NHRA 4JI6E 1WXRA 1UILA 4BMJA 2EPKX 2DMYA 3JAMC 1TF6A 3AUZA 4DV6E 3C6KA 1T38A 1T4NA 2VF1A 4BHCA 1EH6A 2KONA 2UUBE 1RC7A 2LJUA 2WBUA 2LE2A 2JY9A 4GEQB 1MEYC 2EOSA 2FV4B 1B69A 3KZYA 2CT1A 5ADZA 4JI5E 1DQ3A 2L6MA 3HPZA 5IT9C 2UU9E 3EPHA 4GKJE 4LF5E 2FTXB 2EN1A 2DLKA 4R2PA 4DUZE 4X64E 1HR0E 2B7TA 3TQMA 5AE3A 2NUFA 5A6KA 1GZ6A 5AC5A 2EOFA 3ADIA 3ADJA 2LRSA 2LO3A 3THNA 2ADRA 4DV3E 1TF3A 4OOGC 5LL6R 2YTEA 4JI0E 4ZYGA 2LTRA 3KZZA 3DF6A 4DUYE 2ELYA 2VRDA 1X48A 1FKAE 2EM3A 4M30A 2GPIA 2WBSA 4DV1E 1PJSA 1SFEA 1T4LB 1LLMC 5AE1A 1A1KA 3QG5C 2YT4A 5AASA 1JK1A 4WXCA 1EH7A 2YU5A 3MHSC 1YFHA 2D9HA 2EOIA 2EOZA 1G2DC 2B9DA 1YPNA 4RHBB 4LF4E 3VYYA 4TUGA 1P47A 2E1MA 2ZM6E 5A6BA 4LFAE 4MLQA 3HPSA 4JI7E 2KOUA 4IS1C 2UXDE 4DR1E 2M4IA 1N3GA 1XMOE 2DB2A 1X47A 2EOMA 3ZOQB 2EJ4A 2UXBE 2EP3A 1DGCA 2EMGA 2RSMA 2EPXA 3JU0A 5KL7A 2DRPA 1X49A 2R76A 1EH8A 4KWYA 4R2AA 1X6EA 4JI8E 2YSPA 4R2SA 4NXNE 4M2ZA 4X62E 2MC6A 4YHHE 3THOB 2FGGA 4O4KA 2GLIA 1SR9A 2ENHA 3M99B 4DR6E 4JV5E 1IQOA 4BC9A 1IMUA 5IXMB 2E5LE 1IBLE 2NA2A 4F9CB 1PJTA 3K6QA 1DI2A 1NCSA 2HGHA 2EMXA 2CTDA 2EOYA 5AE2A 3MHHC 3BIDA 4BS9A 2EORA 2V86A 2EPLX 4WSPA 1ZR9A 2M7QA 2YTQA 4Q28A 3C6MA 3EPJA 1J26A 2EM9A 2EMWA 1WHNA 2L3JA 2HC5A 2EMCA 4K0KE 4BC7A 4DR5E 3DJWA 1N32E 1T39A 2L92A 2MC5A 2YTPA 2ENCA 2YTJA 2B7VA 3BBGA 2K4VA 4DV7E 3J80C 1BBGA 2JR1A 1WJPA 2EOHA 2V83A 1UN6B 2J7JA 2RS6A 5FLXC 4KHPE 2EN6A 4MLVA 5TSEA 2YTIA 2EMHA 2MKDA 3RMPA 2EN2A 2EOXA 2WZOA 4LF7E 2A25A 2WCC3 2JOBA 3MSWA 2YTOA 4I8OA 2NUEA 5CFFE 2BB8A 4HTGA 3P1XA 4KZSA 2RQLA 2EN4A 4O43A 1IQSA 2LUQA 2LVHA 3LLHA 2RTXA 2YPNA 1AAYA 2YRMA 3C4BA 2DIXA 5KL4A 4X65E 1IBME 2DMIA 1L4SA 4ZYHA 1A1HA 4R2RA 4B3ME 2EWLA 4WFTA 5A6JA 2PRTA 4JI4E 2L3CA 4J8ZA 2ODRD 2YZTA 4JI1E 2EM5A 1ZU1A 2LV2A 2WBTA 1YZ9A 4ZYDA 4P78A 1X6FA 2L8TA 4L8NA 3L00A 2MKNA 2BBGA 1O0WA 5KL3A 2YTDA 1GQEA 2MDGA 2L2NA 2EN8A 5KL2A 4DR7E 2V85A 2L2MA 4DV5E 1A1JA 2UUAE 2UUCE 2EOEA 3BF2A 3ADGA 2RPCA 3HTXA 2JWOA 4LTYA 3KWRA 4JYAE 2V88A 3OTOE 4X8WA 4DKKA 1RMDA 4BBYA 3J7AG 1BBOA 4BHBA 4LU9A 3F6GA 2E72A 2YWQA 4WX9A 3FIGA 1ZBQA 1X3CA 1JK2A 2DGCA 2V87A 2L2KB 4DV4E 1NEIA 2JYAA 2LMZA 1HNXE 2R1FA 2YRKA 3EQ1A 2IHR1 3T1HE 2EPRA 2DSYA 3ADLA 1XNQE 2LTSA 2Q8UA 1XNRE 3VK6A 1MGTA 1X5WA 2EL5A 3UK3C 2EPZA 2M1SA 1AH5A 4WPYA 2CPNA 2JP9A 2EOQA 2EMBA 5AC4A 1XMQE 1ZAAC 2EM4A 4M0VA 1N36E 5F3WA 4P7DA 1YYWA 4L5NC 4NZVA 2EPUA 1A1FA 1HNZE 3BGHA 3AV0A 2LCEA 4F54A 4O24A 4ZYEA 2EMFA 2LJHA 2EMIA 2N8XA 4RH8A 4DR3E 1YYKA 1QNTA 4DV2E 2JVAA 1STUA 2I9IA 1KYQA 2EQ0A 2V89A 2EPCA 3F6HA 1YSAC 2EQ1A 4DMIA 4LF9E 4B3SE 2NUGA 4R2CA 5LMNE 2EM8A 1X6HA 2LBSB 2N3HA 2EN3A 4LFCE 4LF8E 4F6MA 2EMKA 2H36X 5LMUE 4F6NA 2EMYA 1FJGE 2ELZA 3C4TA 4LF6E 3JTZA 4B3TE 4DR4E 4GKKE 2ODRC 2EE8A 2EMLA 3H09A 1PJQA 2K7IA 3LMLA 2I13A 2EPAA 2EM2A 2EM6A 1YUJA 1QU6A 2EMAA 2N3GA 4JI2E 4OX9E 2UXCE 3HQ1A 2V8QB 2VQFE 4Q35B 2HJJA 1GTKA 2EN7A 2EM7A 5DNYA 2EOOA 4M9VC 4X9JA 2EPOA 4F9AB 2EPMX 2RS7A 2LT7A 4DR2E 1RQ0A 4NXME 1EKZA 1PDAA 2YSOA 1WRJA 1YYOA 2RSIA 2NABA 5IWAE 2YTFA 1WHQA 4WSGA 4F2JC 3IWBA 5BR8E 3EPKA 3VYXA 3EPLA 2EQ3A 4HEIA 2EM0A 4AQYE 1YUIA 4YY3E 2B3TB 2EPPA 5A2QC 2YU8A 2F4VE 4F9BB 2EL4A 4TUIA 1G2FC 2JOXA 2YTGA 1KJKA 5T6JA 2CSHA 4R2EA 3T1YE 1A1LA 4IJDA 3J81C 2YRHA 4BCAA 4GZNC 4DV0E 2G7HA 1J5EE 2VQEE 1N33E 1ZBTA 5LLQA 5A6BD 5A69A 4JI3E 2EMZA 2MDRA 5A6AA 2YTNA 4R8OA 1TN9A 2M9AA 4WXDA 3IWDA 4R2QA 2JXPA 4X66E 1T4OA 4R03A 5IV8B 1UHZA 3IWCA 3OMLA 3ECRA 1A1GA 2DLQA 1HNWE 3J7Yp 4WYQB 1BB8A 2GHFA 2EOJA 2VE7C 3HXLA 2LUPB 1I94E 4R2DA 4O5GA 4FK5C 5KL6A 1F2IG 2ENAA 2HHHE 2KHXA 4N4RB 1Z1BA 4B3RE 2JPAA 1N34E
chains in the Genus database with same CATH topology
4R2AA 4F6NA 1X6EA 2EMYA 2YSPA 2EM5A 1ZU1A 2LV2A 2WBTA 4R2SA 1A1IA 1X6FA 5KL5A 2EL6A 2MKNA 2EE8A 2EMLA 3VHTB 5KL3A 1UBDC 2YTDA 2GLIA 2MDGA 2ENHA 3M99B 2EN8A 5KL2A 2EPAA 2EM2A 2EM6A 2I13A 1YUJA 1TF6A 2EMAA 1A1JA 2EOEA 2RPCA 1NCSA 2HGHA 2EN7A 2EM7A 2EOOA 4M9VC 2EMXA 2CTDA 2EOYA 3MHHC 1RMDA 4X9JA 2LT7A 2WBUA 2EORA 1BBOA 1MEYC 2YSOA 2EOSA 2E72A 1B69A 2RSIA 2CT1A 1ZR9A 2NABA 1X3CA 2YTFA 2YTQA 1JK2A 2DGCA 3EPHA 3EPJA 4WSGA 4F2JC 2EM9A 3EPKA 3EPLA 2EMWA 2EQ3A 2EMCA 2EM0A 2EN1A 2R1FA 2DLKA 2YRKA 4R2PA 1YUIA 2EPPA 2YU8A 2EPRA 2YTPA 2ENCA 2YTJA 2EL4A 1G2FC 2YTGA 1KJKA 2EOFA 1WJPA 2EOHA 1Z1BA 1UN6B 2J7JA 2CSHA 1X5WA 2LO3A 4R2EA 2ADRA 2EL5A 2EN6A 3UK3C 1A1LA 2EPZA 4IJDA 1TF3A 2YTEA 2YTIA 2YRHA 2EOQA 2JP9A 2EMBA 1ZAAC 4GZNC 2EMHA 2MKDA 2ELYA 2EM4A 2VRDA 2EN2A 2EM3A 2EOXA 2WBSA 2EPUA 2EMZA 1A1FA 2A25A 1LLMC 1A1KA 2YTNA 1TN9A 2LCEA 2M9AA 2WCC3 1JK1A 4R2QA 2YU5A 2YTOA 3MHSC 2D9HA 2EOIA 2EOZA 2EMFA 1G2DC 1A1GA 2EMIA 2BB8A 2DLQA 1P47A 2EN4A 1BB8A 2GHFA 2EOJA 4IS1C 2EQ0A 2LVHA 2EPCA 1YSAC 2EQ1A 1AAYA 2EOMA 2EJ4A 2YRMA 2EP3A 5KL4A 1DGCA 4R2CA 2EMGA 2EM8A 2DMIA 4R2DA 1X6HA 4R2RA 1A1HA 2EPXA 5KL7A 2EN3A 4FK5C 5KL6A 2PRTA 2ENAA 1F2IG 2DRPA 2ELZA 4F6MA 2EMKA 2JPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R2A A;  4F6N A;  1X6E A;  2EMY A;  2YSP A;  2EM5 A;  1ZU1 A;  2LV2 A;  2WBT A;  4R2S A;  1A1I A;  1X6F A;  5KL5 A;  2EL6 A;  2MKN A;  2EE8 A;  2EML A;  3VHT B;  5KL3 A;  1UBD C;  2YTD A;  2GLI A;  2MDG A;  2ENH A;  3M99 B;  2EN8 A;  5KL2 A;  2EPA A;  2EM2 A;  2EM6 A;  2I13 A;  1YUJ A;  1TF6 A;  2EMA A;  1A1J A;  2EOE A;  2RPC A;  1NCS A;  2HGH A;  2EN7 A;  2EM7 A;  2EOO A;  4M9V C;  2EMX A;  2CTD A;  2EOY A;  3MHH C;  1RMD A;  4X9J A;  2LT7 A;  2WBU A;  2EOR A;  1BBO A;  1MEY C;  2YSO A;  2EOS A;  2E72 A;  1B69 A;  2RSI A;  2CT1 A;  1ZR9 A;  2NAB A;  1X3C A;  2YTF A;  2YTQ A;  1JK2 A;  2DGC A;  3EPH A;  3EPJ A;  4WSG A;  4F2J C;  2EM9 A;  3EPK A;  3EPL A;  2EMW A;  2EQ3 A;  2EMC A;  2EM0 A;  2EN1 A;  2R1F A;  2DLK A;  2YRK A;  4R2P A;  1YUI A;  2EPP A;  2YU8 A;  2EPR A;  2YTP A;  2ENC A;  2YTJ A;  2EL4 A;  1G2F C;  2YTG A;  1KJK A;  2EOF A;  1WJP A;  2EOH A;  1Z1B A;  1UN6 B;  2J7J A;  2CSH A;  1X5W A;  2LO3 A;  4R2E A;  2ADR A;  2EL5 A;  2EN6 A;  3UK3 C;  1A1L A;  2EPZ A;  4IJD A;  1TF3 A;  2YTE A;  2YTI A;  2YRH A;  2EOQ A;  2JP9 A;  2EMB A;  1ZAA C;  4GZN C;  2EMH A;  2MKD A;  2ELY A;  2EM4 A;  2VRD A;  2EN2 A;  2EM3 A;  2EOX A;  2WBS A;  2EPU A;  2EMZ A;  1A1F A;  2A25 A;  1LLM C;  1A1K A;  2YTN A;  1TN9 A;  2LCE A;  2M9A A;  2WCC 3;  1JK1 A;  4R2Q A;  2YU5 A;  2YTO A;  3MHS C;  2D9H A;  2EOI A;  2EOZ A;  2EMF A;  1G2D C;  1A1G A;  2EMI A;  2BB8 A;  2DLQ A;  1P47 A;  2EN4 A;  1BB8 A;  2GHF A;  2EOJ A;  4IS1 C;  2EQ0 A;  2LVH A;  2EPC A;  1YSA C;  2EQ1 A;  1AAY A;  2EOM A;  2EJ4 A;  2YRM A;  2EP3 A;  5KL4 A;  1DGC A;  4R2C A;  2EMG A;  2EM8 A;  2DMI A;  4R2D A;  1X6H A;  4R2R A;  1A1H A;  2EPX A;  5KL7 A;  2EN3 A;  4FK5 C;  5KL6 A;  2PRT A;  2ENA A;  1F2I G;  2DRP A;  2ELZ A;  4F6M A;  2EMK A;  2JPA A; 
#chains in the Genus database with same CATH topology
 1IBK E;  4LFB E;  1A1I A;  2L33 A;  5KL5 A;  2EL6 A;  1PKP A;  2F8B A;  3VHT B;  2EPN A;  2EZ6 A;  1UBD C;  4NHR A;  4JI6 E;  1WXR A;  1UIL A;  4BMJ A;  2EPK X;  2DMY A;  3JAM C;  1TF6 A;  3AUZ A;  4DV6 E;  3C6K A;  1T38 A;  1T4N A;  2VF1 A;  4BHC A;  1EH6 A;  2KON A;  2UUB E;  1RC7 A;  2LJU A;  2WBU A;  2LE2 A;  2JY9 A;  4GEQ B;  1MEY C;  2EOS A;  2FV4 B;  1B69 A;  3KZY A;  2CT1 A;  5ADZ A;  4JI5 E;  1DQ3 A;  2L6M A;  3HPZ A;  5IT9 C;  2UU9 E;  3EPH A;  4GKJ E;  4LF5 E;  2FTX B;  2EN1 A;  2DLK A;  4R2P A;  4DUZ E;  4X64 E;  1HR0 E;  2B7T A;  3TQM A;  5AE3 A;  2NUF A;  5A6K A;  1GZ6 A;  5AC5 A;  2EOF A;  3ADI A;  3ADJ A;  2LRS A;  2LO3 A;  3THN A;  2ADR A;  4DV3 E;  1TF3 A;  4OOG C;  5LL6 R;  2YTE A;  4JI0 E;  4ZYG A;  2LTR A;  3KZZ A;  3DF6 A;  4DUY E;  2ELY A;  2VRD A;  1X48 A;  1FKA E;  2EM3 A;  4M30 A;  2GPI A;  2WBS A;  4DV1 E;  1PJS A;  1SFE A;  1T4L B;  1LLM C;  5AE1 A;  1A1K A;  3QG5 C;  2YT4 A;  5AAS A;  1JK1 A;  4WXC A;  1EH7 A;  2YU5 A;  3MHS C;  1YFH A;  2D9H A;  2EOI A;  2EOZ A;  1G2D C;  2B9D A;  1YPN A;  4RHB B;  4LF4 E;  3VYY A;  4TUG A;  1P47 A;  2E1M A;  2ZM6 E;  5A6B A;  4LFA E;  4MLQ A;  3HPS A;  4JI7 E;  2KOU A;  4IS1 C;  2UXD E;  4DR1 E;  2M4I A;  1N3G A;  1XMO E;  2DB2 A;  1X47 A;  2EOM A;  3ZOQ B;  2EJ4 A;  2UXB E;  2EP3 A;  1DGC A;  2EMG A;  2RSM A;  2EPX A;  3JU0 A;  5KL7 A;  2DRP A;  1X49 A;  2R76 A;  1EH8 A;  4KWY A;  4R2A A;  1X6E A;  4JI8 E;  2YSP A;  4R2S A;  4NXN E;  4M2Z A;  4X62 E;  2MC6 A;  4YHH E;  3THO B;  2FGG A;  4O4K A;  2GLI A;  1SR9 A;  2ENH A;  3M99 B;  4DR6 E;  4JV5 E;  1IQO A;  4BC9 A;  1IMU A;  5IXM B;  2E5L E;  1IBL E;  2NA2 A;  4F9C B;  1PJT A;  3K6Q A;  1DI2 A;  1NCS A;  2HGH A;  2EMX A;  2CTD A;  2EOY A;  5AE2 A;  3MHH C;  3BID A;  4BS9 A;  2EOR A;  2V86 A;  2EPL X;  4WSP A;  1ZR9 A;  2M7Q A;  2YTQ A;  4Q28 A;  3C6M A;  3EPJ A;  1J26 A;  2EM9 A;  2EMW A;  1WHN A;  2L3J A;  2HC5 A;  2EMC A;  4K0K E;  4BC7 A;  4DR5 E;  3DJW A;  1N32 E;  1T39 A;  2L92 A;  2MC5 A;  2YTP A;  2ENC A;  2YTJ A;  2B7V A;  3BBG A;  2K4V A;  4DV7 E;  3J80 C;  1BBG A;  2JR1 A;  1WJP A;  2EOH A;  2V83 A;  1UN6 B;  2J7J A;  2RS6 A;  5FLX C;  4KHP E;  2EN6 A;  4MLV A;  5TSE A;  2YTI A;  2EMH A;  2MKD A;  3RMP A;  2EN2 A;  2EOX A;  2WZO A;  4LF7 E;  2A25 A;  2WCC 3;  2JOB A;  3MSW A;  2YTO A;  4I8O A;  2NUE A;  5CFF E;  2BB8 A;  4HTG A;  3P1X A;  4KZS A;  2RQL A;  2EN4 A;  4O43 A;  1IQS A;  2LUQ A;  2LVH A;  3LLH A;  2RTX A;  2YPN A;  1AAY A;  2YRM A;  3C4B A;  2DIX A;  5KL4 A;  4X65 E;  1IBM E;  2DMI A;  1L4S A;  4ZYH A;  1A1H A;  4R2R A;  4B3M E;  2EWL A;  4WFT A;  5A6J A;  2PRT A;  4JI4 E;  2L3C A;  4J8Z A;  2ODR D;  2YZT A;  4JI1 E;  2EM5 A;  1ZU1 A;  2LV2 A;  2WBT A;  1YZ9 A;  4ZYD A;  4P78 A;  1X6F A;  2L8T A;  4L8N A;  3L00 A;  2MKN A;  2BBG A;  1O0W A;  5KL3 A;  2YTD A;  1GQE A;  2MDG A;  2L2N A;  2EN8 A;  5KL2 A;  4DR7 E;  2V85 A;  2L2M A;  4DV5 E;  1A1J A;  2UUA E;  2UUC E;  2EOE A;  3BF2 A;  3ADG A;  2RPC A;  3HTX A;  2JWO A;  4LTY A;  3KWR A;  4JYA E;  2V88 A;  3OTO E;  4X8W A;  4DKK A;  1RMD A;  4BBY A;  3J7A G;  1BBO A;  4BHB A;  4LU9 A;  3F6G A;  2E72 A;  2YWQ A;  4WX9 A;  3FIG A;  1ZBQ A;  1X3C A;  1JK2 A;  2DGC A;  2V87 A;  2L2K B;  4DV4 E;  1NEI A;  2JYA A;  2LMZ A;  1HNX E;  2R1F A;  2YRK A;  3EQ1 A;  2IHR 1;  3T1H E;  2EPR A;  2DSY A;  3ADL A;  1XNQ E;  2LTS A;  2Q8U A;  1XNR E;  3VK6 A;  1MGT A;  1X5W A;  2EL5 A;  3UK3 C;  2EPZ A;  2M1S A;  1AH5 A;  4WPY A;  2CPN A;  2JP9 A;  2EOQ A;  2EMB A;  5AC4 A;  1XMQ E;  1ZAA C;  2EM4 A;  4M0V A;  1N36 E;  5F3W A;  4P7D A;  1YYW A;  4L5N C;  4NZV A;  2EPU A;  1A1F A;  1HNZ E;  3BGH A;  3AV0 A;  2LCE A;  4F54 A;  4O24 A;  4ZYE A;  2EMF A;  2LJH A;  2EMI A;  2N8X A;  4RH8 A;  4DR3 E;  1YYK A;  1QNT A;  4DV2 E;  2JVA A;  1STU A;  2I9I A;  1KYQ A;  2EQ0 A;  2V89 A;  2EPC A;  3F6H A;  1YSA C;  2EQ1 A;  4DMI A;  4LF9 E;  4B3S E;  2NUG A;  4R2C A;  5LMN E;  2EM8 A;  1X6H A;  2LBS B;  2N3H A;  2EN3 A;  4LFC E;  4LF8 E;  4F6M A;  2EMK A;  2H36 X;  5LMU E;  4F6N A;  2EMY A;  1FJG E;  2ELZ A;  3C4T A;  4LF6 E;  3JTZ A;  4B3T E;  4DR4 E;  4GKK E;  2ODR C;  2EE8 A;  2EML A;  3H09 A;  1PJQ A;  2K7I A;  3LML A;  2I13 A;  2EPA A;  2EM2 A;  2EM6 A;  1YUJ A;  1QU6 A;  2EMA A;  2N3G A;  4JI2 E;  4OX9 E;  2UXC E;  3HQ1 A;  2V8Q B;  2VQF E;  4Q35 B;  2HJJ A;  1GTK A;  2EN7 A;  2EM7 A;  5DNY A;  2EOO A;  4M9V C;  4X9J A;  2EPO A;  4F9A B;  2EPM X;  2RS7 A;  2LT7 A;  4DR2 E;  1RQ0 A;  4NXM E;  1EKZ A;  1PDA A;  2YSO A;  1WRJ A;  1YYO A;  2RSI A;  2NAB A;  5IWA E;  2YTF A;  1WHQ A;  4WSG A;  4F2J C;  3IWB A;  5BR8 E;  3EPK A;  3VYX A;  3EPL A;  2EQ3 A;  4HEI A;  2EM0 A;  4AQY E;  1YUI A;  4YY3 E;  2B3T B;  2EPP A;  5A2Q C;  2YU8 A;  2F4V E;  4F9B B;  2EL4 A;  4TUI A;  1G2F C;  2JOX A;  2YTG A;  1KJK A;  5T6J A;  2CSH A;  4R2E A;  3T1Y E;  1A1L A;  4IJD A;  3J81 C;  2YRH A;  4BCA A;  4GZN C;  4DV0 E;  2G7H A;  1J5E E;  2VQE E;  1N33 E;  1ZBT A;  5LLQ A;  5A6B D;  5A69 A;  4JI3 E;  2EMZ A;  2MDR A;  5A6A A;  2YTN A;  4R8O A;  1TN9 A;  2M9A A;  4WXD A;  3IWD A;  4R2Q A;  2JXP A;  4X66 E;  1T4O A;  4R03 A;  5IV8 B;  1UHZ A;  3IWC A;  3OML A;  3ECR A;  1A1G A;  2DLQ A;  1HNW E;  3J7Y p;  4WYQ B;  1BB8 A;  2GHF A;  2EOJ A;  2VE7 C;  3HXL A;  2LUP B;  1I94 E;  4R2D A;  4O5G A;  4FK5 C;  5KL6 A;  1F2I G;  2ENA A;  2HHH E;  2KHX A;  4N4R B;  1Z1B A;  4B3R E;  2JPA A;  1N34 E; 
#chains in the Genus database with same CATH homology
 4R2A A;  4F6N A;  1X6E A;  2EMY A;  2YSP A;  2EM5 A;  1ZU1 A;  2LV2 A;  2WBT A;  4R2S A;  1A1I A;  1X6F A;  5KL5 A;  2EL6 A;  2MKN A;  2EE8 A;  2EML A;  3VHT B;  5KL3 A;  1UBD C;  2YTD A;  2GLI A;  2MDG A;  2ENH A;  3M99 B;  2EN8 A;  5KL2 A;  2EPA A;  2EM2 A;  2EM6 A;  2I13 A;  1YUJ A;  1TF6 A;  2EMA A;  1A1J A;  2EOE A;  2RPC A;  1NCS A;  2HGH A;  2EN7 A;  2EM7 A;  2EOO A;  4M9V C;  2EMX A;  2CTD A;  2EOY A;  3MHH C;  1RMD A;  4X9J A;  2LT7 A;  2WBU A;  2EOR A;  1BBO A;  1MEY C;  2YSO A;  2EOS A;  2E72 A;  1B69 A;  2RSI A;  2CT1 A;  1ZR9 A;  2NAB A;  1X3C A;  2YTF A;  2YTQ A;  1JK2 A;  2DGC A;  3EPH A;  3EPJ A;  4WSG A;  4F2J C;  2EM9 A;  3EPK A;  3EPL A;  2EMW A;  2EQ3 A;  2EMC A;  2EM0 A;  2EN1 A;  2R1F A;  2DLK A;  2YRK A;  4R2P A;  1YUI A;  2EPP A;  2YU8 A;  2EPR A;  2YTP A;  2ENC A;  2YTJ A;  2EL4 A;  1G2F C;  2YTG A;  1KJK A;  2EOF A;  1WJP A;  2EOH A;  1Z1B A;  1UN6 B;  2J7J A;  2CSH A;  1X5W A;  2LO3 A;  4R2E A;  2ADR A;  2EL5 A;  2EN6 A;  3UK3 C;  1A1L A;  2EPZ A;  4IJD A;  1TF3 A;  2YTE A;  2YTI A;  2YRH A;  2EOQ A;  2JP9 A;  2EMB A;  1ZAA C;  4GZN C;  2EMH A;  2MKD A;  2ELY A;  2EM4 A;  2VRD A;  2EN2 A;  2EM3 A;  2EOX A;  2WBS A;  2EPU A;  2EMZ A;  1A1F A;  2A25 A;  1LLM C;  1A1K A;  2YTN A;  1TN9 A;  2LCE A;  2M9A A;  2WCC 3;  1JK1 A;  4R2Q A;  2YU5 A;  2YTO A;  3MHS C;  2D9H A;  2EOI A;  2EOZ A;  2EMF A;  1G2D C;  1A1G A;  2EMI A;  2BB8 A;  2DLQ A;  1P47 A;  2EN4 A;  1BB8 A;  2GHF A;  2EOJ A;  4IS1 C;  2EQ0 A;  2LVH A;  2EPC A;  1YSA C;  2EQ1 A;  1AAY A;  2EOM A;  2EJ4 A;  2YRM A;  2EP3 A;  5KL4 A;  1DGC A;  4R2C A;  2EMG A;  2EM8 A;  2DMI A;  4R2D A;  1X6H A;  4R2R A;  1A1H A;  2EPX A;  5KL7 A;  2EN3 A;  4FK5 C;  5KL6 A;  2PRT A;  2ENA A;  1F2I G;  2DRP A;  2ELZ A;  4F6M A;  2EMK A;  2JPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...