1UN6B

The crystal structure of a zinc finger - rna complex reveals two modes of molecular recognition
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
86
structure length
86
Chain Sequence
MYVCHFENCGKAFKKHNQLKVHQFSHTQQLPYECPHEGCDKRFSLPSRLKRHEKVHAGYPCKKDDSCSFVGKTWTLYLKHVAECHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSCRIPTION FACTOR IIIA
publication title Crystal Structure of a Zinc-Finger-RNA Complex Reveals Two Modes of Molecular Recognition
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Rna-binding protein/rna
total genus 25
structure length 86
sequence length 86
chains with identical sequence C, D
ec nomenclature
pdb deposition date 2003-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1un6B02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1un6B01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1un6B03
2EOHA 1X3CA 5KL5A 2NABA 2EPXA 4M9VC 1F2IG 2EM6A 2YU5A 2EMHA 4F6NA 3EPJA 2RSIA 2EOZA 2EOIA 2DRPA 3MHHC 2LT7A 2DGCA 2WBUA 1YSAC 4IS1C 4R2PA 2ELZA 2EOQA 1DGCA 4WSGA 3EPKA 2BB8A 2RPCA 1TF3A 4IJDA 2YTOA 2I13A 2EOMA 2PRTA 2E72A 2JP9A 2EMGA 2M9AA 2EPRA 2EM2A 2R1FA 2YSPA 2EMXA 2EM5A 2HGHA 2EM8A 2EM0A 2EORA 2EPPA 2WBSA 1A1IA 2CT1A 2MKDA 1KJKA 2EM4A 4R2QA 1X5WA 3UK3C 1A1KA 2EOJA 2LVHA 1G2FC 2EOFA 2YTEA 2EOSA 4F6MA 1X6EA 2MDGA 2EM3A 2ENHA 2EPAA 2EL4A 1NCSA 2ADRA 3VHTB 4GZNC 1A1GA 2EMLA 2CSHA 2EMIA 5KL4A 2GLIA 1Z1BA 2EQ0A 2EN8A 2DLKA 2EMYA 2EN4A 1ZR9A 1X6HA 2YSOA 1A1LA 1UN6B 1ZAAC 1TF6A 1X6FA 2YTPA 4F2JC 2LO3A 2EE8A 2JPAA 2ELYA 2DLQA 2LCEA 1RMDA 2EOYA 2EMCA 2EMZA 2EPUA 1LLMC 2DMIA 2EOOA 2YTDA 2EQ1A 2EN3A 1YUIA 4R2AA 3EPHA 2CTDA 1MEYC 2MKNA 2YTJA 1UBDC 2EL5A 2EN2A 2YRKA 1YUJA 2YTGA 3EPLA 1TN9A 2EM9A 3M99B 2ENAA 4R2EA 4R2CA 2WCC3 1G2DC 4R2RA 2EJ4A 1BB8A 4X9JA 1JK1A 2ENCA 1BBOA 2YTIA 2EOXA 2YTQA 2D9HA 2EPCA 2EL6A 2EMKA 2J7JA 1JK2A 2YU8A 1A1FA 2YTNA 4R2SA 2YRHA 2YRMA 2EMWA 2YTFA 5KL2A 1P47A 2EN7A 5KL3A 2LV2A 2VRDA 2EN6A 2EQ3A 2EN1A 1AAYA 4R2DA 5KL7A 2EPZA 2EMAA 2EOEA 1WJPA 2WBTA 2EP3A 5KL6A 1ZU1A 2EM7A 1B69A 2A25A 3MHSC 2EMFA 4FK5C 2GHFA 1A1HA 1A1JA 2EMBA
chains in the Genus database with same CATH superfamily
2E5LE 1X3CA 1WXRA 2F8BA 3HTXA 2NABA 3THNA 3EPJA 2V89A 2EOIA 3JU0A 3MHHC 2DRPA 2LT7A 1STUA 2DMYA 2JVAA 1T38A 4WSPA 1I94E 1IBLE 1J26A 1O0WA 3EPKA 2V86A 4LF7E 1N36E 4O43A 4ZYGA 4LF8E 2L8TA 2ZM6E 2M9AA 4AQYE 2EMXA 2EM8A 2VF1A 2VE7C 2WBSA 3AV0A 5AE1A 2MKDA 1A1IA 4B3TE 4JI4E 4J8ZA 1BBGA 4R2QA 1X5WA 3UK3C 1A1KA 2EOJA 2H36X 2EOFA 2BBGA 2M4IA 1XMOE 4BMJA 5A6BD 2ENHA 4Q28A 3ZOQB 2EL4A 1NCSA 2ADRA 1A1GA 1AH5A 4RH8A 2GLIA 1Z1BA 2DLKA 2EMYA 1ZR9A 1X6HA 1FJGE 1A1LA 1ZAAC 1TF6A 3LMLA 2YTPA 1N33E 1EH7A 4ZYHA 2LCEA 4HEIA 1T4NA 2JYAA 4WX9A 2EMZA 1T4OA 3ECRA 4YHHE 1LLMC 2V87A 2EQ1A 1YUIA 3THOB 1DQ3A 2MKNA 4F9BB 2UU9E 4DV5E 2EPNA 3EQ1A 2YRKA 4DR2E 2V83A 3HXLA 1WRJA 2LUPB 4BBYA 3J7AG 4X9JA 2ENCA 4JI5E 5CFFE 1RC7A 1GZ6A 2YTQA 2D9HA 1SR9A 2EPCA 3JTZA 3ADLA 2EL6A 2J7JA 1JK2A 2FGGA 4BHCA 2L92A 4NXNE 4R2SA 2B3TB 2EMWA 4F9CB 2UXDE 2EN7A 2G7HA 4NHRA 3P1XA 4DMIA 3J81C 4R2DA 5KL7A 2EMAA 2L6MA 1UHZA 2WBTA 4DR5E 1B69A 2A25A 3MHSC 2EMFA 3J80C 2GHFA 1YYOA 2IHR1 5ADZA 2HC5A 2LRSA 3IWDA 4LF6E 2EPXA 3BIDA 2YU5A 1PKPA 2JR1A 2RQLA 3IWBA 4F54A 2EOZA 4BCAA 3OMLA 4R2PA 4LTYA 2JWOA 2EOQA 1KYQA 4MLVA 4DV3E 3BF2A 2RPCA 1TF3A 5IWAE 3ADIA 2EOMA 2JP9A 2LE2A 3AUZA 2YSPA 2Q8UA 3FIGA 2NUGA 2EM5A 4JI7E 2R76A 3OTOE 5A6JA 1KJKA 4ZYEA 3DF6A 4F9AB 2LVHA 1J5EE 2YTEA 2EOSA 2EWLA 3HPZA 2EM3A 1IQSA 2V8QB 4N4RB 3VHTB 4O5GA 2EMLA 4JI0E 4JI1E 3ADJA 1YYWA 4KZSA 1HNZE 2K4VA 3LLHA 2YSOA 3F6HA 4BHBA 5A6AA 3HPSA 2B7VA 2EE8A 4JI3E 2ELYA 3QG5C 3JAMC 1UILA 2DLQA 1GQEA 2WZOA 1PJTA 1RMDA 2EOYA 2EOOA 5TSEA 5IV8B 5LL6R 2UUCE 1X48A 4R2AA 4L5NC 3C4BA 1PDAA 2LJUA 4M0VA 4JV5E 2NUEA 2ODRC 2N8XA 2RSMA 4GKJE 2EN2A 2EPMX 3BGHA 4R2CA 4R2RA 1YYKA 4KHPE 1BBOA 2LJHA 2YTIA 1IQOA 2EOXA 2CPNA 2K7IA 3L00A 3C4TA 2EMKA 2YTNA 4DV7E 2YRHA 2YRMA 2YTFA 5AE3A 1P47A 2EN6A 1AAYA 4DV0E 4X8WA 1WHQA 4DR4E 2LUQA 1T4LB 1WJPA 5KL6A 4LF4E 1ZU1A 4X62E 2EM7A 2KOUA 2UXCE 2F4VE 2LTSA 1A1HA 2EMBA 2DSYA 2EOHA 2L33A 1EKZA 4R8OA 4M9VC 4B3RE 1F2IG 4TUGA 2EMHA 4TUIA 4F6NA 2NUFA 3DJWA 4LF5E 1GTKA 2RSIA 2WBUA 5AE2A 4IS1C 1XNQE 4DUZE 4BS9A 2YWQA 4Q35B 2ODRD 4YY3E 3C6KA 1DGCA 3VYXA 4WSGA 5T6JA 1XMQE 1DI2A 4IJDA 2L2MA 2RS6A 1YZ9A 2I13A 2PRTA 2E72A 3J7Yp 2EMGA 3VK6A 2EPRA 2KHXA 4MLQA 1YFHA 4JI8E 2JY9A 2EORA 1RQ0A 2M7QA 2CT1A 2VQEE 2EM4A 4P78A 5IXMB 5AASA 4DV1E 4X65E 4M30A 4F6MA 2V88A 2MDGA 4JI6E 2EPAA 1HNWE 4X66E 4GZNC 2L3CA 4OX9E 2DB2A 2EN4A 4NXME 4RHBB 5A6BA 5LMNE 1EH8A 2EPOA 1X6FA 4F2JC 1IMUA 2JPAA 4DKKA 2EPUA 4P7DA 3T1HE 4WFTA 3K6QA 2N3GA 4LFAE 2EN3A 2YZTA 3RMPA 2HHHE 2L3JA 3KZZA 3EPHA 1MEYC 2YTJA 1UBDC 2RTXA 1HR0E 4DV6E 2L2NA 2L2KB 2EPLX 1PJQA 3EPLA 1TN9A 2EM9A 2ENAA 1T39A 1G2DC 5IT9C 1BB8A 2FV4B 2MDRA 2NA2A 2YT4A 2YU8A 2UXBE 5KL2A 2VRDA 4LFBE 2EQ3A 2UUAE 4L8NA 2FTXB 2EN1A 1NEIA 2EPZA 4WPYA 1QNTA 1N3GA 2B9DA 2EOEA 2EP3A 4OOGC 2LMZA 4R03A 3ADGA 3H09A 4FK5C 1A1JA 4BC9A 4DR6E 5A69A 4DUYE 5KL5A 1N34E 5F3WA 4ZYDA 1MGTA 2JOXA 1IBKE 4WYQB 2EM6A 5AC5A 2JXPA 2DGCA 1YSAC 5LMUE 2ELZA 5LLQA 4WXDA 2B7TA 4LF9E 3BBGA 1YPNA 2BB8A 1FKAE 2YTOA 5FLXC 2RS7A 4KWYA 2R1FA 2EM2A 1IBME 4B3ME 1X47A 3T1YE 3C6MA 2HGHA 3KZYA 1SFEA 2EM0A 2EPPA 2VQFE 1G2FC 2EZ6A 1L4SA 1X6EA 2DIXA 2EPKX 2LBSB 4BC7A 5BR8E 4WXCA 2KONA 1XNRE 2CSHA 2EMIA 4LU9A 5KL4A 2EQ0A 2EN8A 1ZBQA 4DV4E 2MC5A 4NZVA 5AC4A 4LFCE 4M2ZA 2E1MA 2LTRA 4DR7E 1UN6B 3HQ1A 2LO3A 4HTGA 2JOBA 5A2QC 4JYAE 3KWRA 2YPNA 4DR3E 2EMCA 2DMIA 2N3HA 2YTDA 2I9IA 2HJJA 2CTDA 1HNXE 1QU6A 3MSWA 4O24A 2EL5A 1YUJA 2YTGA 4X64E 3M99B 3IWCA 4R2EA 5DNYA 2WCC3 5A6KA 2EJ4A 2UUBE 1JK1A 4B3SE 1EH6A 2M1SA 1N32E 1A1FA 2GPIA 1WHNA 5KL3A 2LV2A 2MC6A 3F6GA 4I8OA 4K0KE 1PJSA 1X49A 3VYYA 4GEQB 4DV2E 4GKKE 4O4KA 4DR1E 4JI2E 3TQMA 1ZBTA 2V85A
chains in the Genus database with same CATH topology
2EOHA 1X3CA 5KL5A 2NABA 2EPXA 4M9VC 1F2IG 2EM6A 2YU5A 2EMHA 4F6NA 3EPJA 2RSIA 2EOZA 2EOIA 2DRPA 3MHHC 2LT7A 2DGCA 2WBUA 1YSAC 4IS1C 4R2PA 2ELZA 2EOQA 1DGCA 4WSGA 3EPKA 2BB8A 2RPCA 1TF3A 4IJDA 2YTOA 2I13A 2EOMA 2PRTA 2E72A 2JP9A 2EMGA 2M9AA 2EPRA 2EM2A 2R1FA 2YSPA 2EMXA 2EM5A 2HGHA 2EM8A 2EM0A 2EORA 2EPPA 2WBSA 1A1IA 2CT1A 2MKDA 1KJKA 2EM4A 4R2QA 1X5WA 3UK3C 1A1KA 2EOJA 2LVHA 1G2FC 2EOFA 2YTEA 2EOSA 4F6MA 1X6EA 2MDGA 2EM3A 2ENHA 2EPAA 2EL4A 1NCSA 2ADRA 3VHTB 4GZNC 1A1GA 2EMLA 2CSHA 2EMIA 5KL4A 2GLIA 1Z1BA 2EQ0A 2EN8A 2DLKA 2EMYA 2EN4A 1ZR9A 1X6HA 2YSOA 1A1LA 1UN6B 1ZAAC 1TF6A 1X6FA 2YTPA 4F2JC 2LO3A 2EE8A 2JPAA 2ELYA 2DLQA 2LCEA 1RMDA 2EOYA 2EMCA 2EMZA 2EPUA 1LLMC 2DMIA 2EOOA 2YTDA 2EQ1A 2EN3A 1YUIA 4R2AA 3EPHA 2CTDA 1MEYC 2MKNA 2YTJA 1UBDC 2EL5A 2EN2A 2YRKA 1YUJA 2YTGA 3EPLA 1TN9A 2EM9A 3M99B 2ENAA 4R2EA 4R2CA 2WCC3 1G2DC 4R2RA 2EJ4A 1BB8A 4X9JA 1JK1A 2ENCA 1BBOA 2YTIA 2EOXA 2YTQA 2D9HA 2EPCA 2EL6A 2EMKA 2J7JA 1JK2A 2YU8A 1A1FA 2YTNA 4R2SA 2YRHA 2YRMA 2EMWA 2YTFA 5KL2A 1P47A 2EN7A 5KL3A 2LV2A 2VRDA 2EN6A 2EQ3A 2EN1A 1AAYA 4R2DA 5KL7A 2EPZA 2EMAA 2EOEA 1WJPA 2WBTA 2EP3A 5KL6A 1ZU1A 2EM7A 1B69A 2A25A 3MHSC 2EMFA 4FK5C 2GHFA 1A1HA 1A1JA 2EMBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOH A;  1X3C A;  5KL5 A;  2NAB A;  2EPX A;  4M9V C;  1F2I G;  2EM6 A;  2YU5 A;  2EMH A;  4F6N A;  3EPJ A;  2RSI A;  2EOZ A;  2EOI A;  2DRP A;  3MHH C;  2LT7 A;  2DGC A;  2WBU A;  1YSA C;  4IS1 C;  4R2P A;  2ELZ A;  2EOQ A;  1DGC A;  4WSG A;  3EPK A;  2BB8 A;  2RPC A;  1TF3 A;  4IJD A;  2YTO A;  2I13 A;  2EOM A;  2PRT A;  2E72 A;  2JP9 A;  2EMG A;  2M9A A;  2EPR A;  2EM2 A;  2R1F A;  2YSP A;  2EMX A;  2EM5 A;  2HGH A;  2EM8 A;  2EM0 A;  2EOR A;  2EPP A;  2WBS A;  1A1I A;  2CT1 A;  2MKD A;  1KJK A;  2EM4 A;  4R2Q A;  1X5W A;  3UK3 C;  1A1K A;  2EOJ A;  2LVH A;  1G2F C;  2EOF A;  2YTE A;  2EOS A;  4F6M A;  1X6E A;  2MDG A;  2EM3 A;  2ENH A;  2EPA A;  2EL4 A;  1NCS A;  2ADR A;  3VHT B;  4GZN C;  1A1G A;  2EML A;  2CSH A;  2EMI A;  5KL4 A;  2GLI A;  1Z1B A;  2EQ0 A;  2EN8 A;  2DLK A;  2EMY A;  2EN4 A;  1ZR9 A;  1X6H A;  2YSO A;  1A1L A;  1UN6 B;  1ZAA C;  1TF6 A;  1X6F A;  2YTP A;  4F2J C;  2LO3 A;  2EE8 A;  2JPA A;  2ELY A;  2DLQ A;  2LCE A;  1RMD A;  2EOY A;  2EMC A;  2EMZ A;  2EPU A;  1LLM C;  2DMI A;  2EOO A;  2YTD A;  2EQ1 A;  2EN3 A;  1YUI A;  4R2A A;  3EPH A;  2CTD A;  1MEY C;  2MKN A;  2YTJ A;  1UBD C;  2EL5 A;  2EN2 A;  2YRK A;  1YUJ A;  2YTG A;  3EPL A;  1TN9 A;  2EM9 A;  3M99 B;  2ENA A;  4R2E A;  4R2C A;  2WCC 3;  1G2D C;  4R2R A;  2EJ4 A;  1BB8 A;  4X9J A;  1JK1 A;  2ENC A;  1BBO A;  2YTI A;  2EOX A;  2YTQ A;  2D9H A;  2EPC A;  2EL6 A;  2EMK A;  2J7J A;  1JK2 A;  2YU8 A;  1A1F A;  2YTN A;  4R2S A;  2YRH A;  2YRM A;  2EMW A;  2YTF A;  5KL2 A;  1P47 A;  2EN7 A;  5KL3 A;  2LV2 A;  2VRD A;  2EN6 A;  2EQ3 A;  2EN1 A;  1AAY A;  4R2D A;  5KL7 A;  2EPZ A;  2EMA A;  2EOE A;  1WJP A;  2WBT A;  2EP3 A;  5KL6 A;  1ZU1 A;  2EM7 A;  1B69 A;  2A25 A;  3MHS C;  2EMF A;  4FK5 C;  2GHF A;  1A1H A;  1A1J A;  2EMB A; 
#chains in the Genus database with same CATH topology
 2E5L E;  1X3C A;  1WXR A;  2F8B A;  3HTX A;  2NAB A;  3THN A;  3EPJ A;  2V89 A;  2EOI A;  3JU0 A;  3MHH C;  2DRP A;  2LT7 A;  1STU A;  2DMY A;  2JVA A;  1T38 A;  4WSP A;  1I94 E;  1IBL E;  1J26 A;  1O0W A;  3EPK A;  2V86 A;  4LF7 E;  1N36 E;  4O43 A;  4ZYG A;  4LF8 E;  2L8T A;  2ZM6 E;  2M9A A;  4AQY E;  2EMX A;  2EM8 A;  2VF1 A;  2VE7 C;  2WBS A;  3AV0 A;  5AE1 A;  2MKD A;  1A1I A;  4B3T E;  4JI4 E;  4J8Z A;  1BBG A;  4R2Q A;  1X5W A;  3UK3 C;  1A1K A;  2EOJ A;  2H36 X;  2EOF A;  2BBG A;  2M4I A;  1XMO E;  4BMJ A;  5A6B D;  2ENH A;  4Q28 A;  3ZOQ B;  2EL4 A;  1NCS A;  2ADR A;  1A1G A;  1AH5 A;  4RH8 A;  2GLI A;  1Z1B A;  2DLK A;  2EMY A;  1ZR9 A;  1X6H A;  1FJG E;  1A1L A;  1ZAA C;  1TF6 A;  3LML A;  2YTP A;  1N33 E;  1EH7 A;  4ZYH A;  2LCE A;  4HEI A;  1T4N A;  2JYA A;  4WX9 A;  2EMZ A;  1T4O A;  3ECR A;  4YHH E;  1LLM C;  2V87 A;  2EQ1 A;  1YUI A;  3THO B;  1DQ3 A;  2MKN A;  4F9B B;  2UU9 E;  4DV5 E;  2EPN A;  3EQ1 A;  2YRK A;  4DR2 E;  2V83 A;  3HXL A;  1WRJ A;  2LUP B;  4BBY A;  3J7A G;  4X9J A;  2ENC A;  4JI5 E;  5CFF E;  1RC7 A;  1GZ6 A;  2YTQ A;  2D9H A;  1SR9 A;  2EPC A;  3JTZ A;  3ADL A;  2EL6 A;  2J7J A;  1JK2 A;  2FGG A;  4BHC A;  2L92 A;  4NXN E;  4R2S A;  2B3T B;  2EMW A;  4F9C B;  2UXD E;  2EN7 A;  2G7H A;  4NHR A;  3P1X A;  4DMI A;  3J81 C;  4R2D A;  5KL7 A;  2EMA A;  2L6M A;  1UHZ A;  2WBT A;  4DR5 E;  1B69 A;  2A25 A;  3MHS C;  2EMF A;  3J80 C;  2GHF A;  1YYO A;  2IHR 1;  5ADZ A;  2HC5 A;  2LRS A;  3IWD A;  4LF6 E;  2EPX A;  3BID A;  2YU5 A;  1PKP A;  2JR1 A;  2RQL A;  3IWB A;  4F54 A;  2EOZ A;  4BCA A;  3OML A;  4R2P A;  4LTY A;  2JWO A;  2EOQ A;  1KYQ A;  4MLV A;  4DV3 E;  3BF2 A;  2RPC A;  1TF3 A;  5IWA E;  3ADI A;  2EOM A;  2JP9 A;  2LE2 A;  3AUZ A;  2YSP A;  2Q8U A;  3FIG A;  2NUG A;  2EM5 A;  4JI7 E;  2R76 A;  3OTO E;  5A6J A;  1KJK A;  4ZYE A;  3DF6 A;  4F9A B;  2LVH A;  1J5E E;  2YTE A;  2EOS A;  2EWL A;  3HPZ A;  2EM3 A;  1IQS A;  2V8Q B;  4N4R B;  3VHT B;  4O5G A;  2EML A;  4JI0 E;  4JI1 E;  3ADJ A;  1YYW A;  4KZS A;  1HNZ E;  2K4V A;  3LLH A;  2YSO A;  3F6H A;  4BHB A;  5A6A A;  3HPS A;  2B7V A;  2EE8 A;  4JI3 E;  2ELY A;  3QG5 C;  3JAM C;  1UIL A;  2DLQ A;  1GQE A;  2WZO A;  1PJT A;  1RMD A;  2EOY A;  2EOO A;  5TSE A;  5IV8 B;  5LL6 R;  2UUC E;  1X48 A;  4R2A A;  4L5N C;  3C4B A;  1PDA A;  2LJU A;  4M0V A;  4JV5 E;  2NUE A;  2ODR C;  2N8X A;  2RSM A;  4GKJ E;  2EN2 A;  2EPM X;  3BGH A;  4R2C A;  4R2R A;  1YYK A;  4KHP E;  1BBO A;  2LJH A;  2YTI A;  1IQO A;  2EOX A;  2CPN A;  2K7I A;  3L00 A;  3C4T A;  2EMK A;  2YTN A;  4DV7 E;  2YRH A;  2YRM A;  2YTF A;  5AE3 A;  1P47 A;  2EN6 A;  1AAY A;  4DV0 E;  4X8W A;  1WHQ A;  4DR4 E;  2LUQ A;  1T4L B;  1WJP A;  5KL6 A;  4LF4 E;  1ZU1 A;  4X62 E;  2EM7 A;  2KOU A;  2UXC E;  2F4V E;  2LTS A;  1A1H A;  2EMB A;  2DSY A;  2EOH A;  2L33 A;  1EKZ A;  4R8O A;  4M9V C;  4B3R E;  1F2I G;  4TUG A;  2EMH A;  4TUI A;  4F6N A;  2NUF A;  3DJW A;  4LF5 E;  1GTK A;  2RSI A;  2WBU A;  5AE2 A;  4IS1 C;  1XNQ E;  4DUZ E;  4BS9 A;  2YWQ A;  4Q35 B;  2ODR D;  4YY3 E;  3C6K A;  1DGC A;  3VYX A;  4WSG A;  5T6J A;  1XMQ E;  1DI2 A;  4IJD A;  2L2M A;  2RS6 A;  1YZ9 A;  2I13 A;  2PRT A;  2E72 A;  3J7Y p;  2EMG A;  3VK6 A;  2EPR A;  2KHX A;  4MLQ A;  1YFH A;  4JI8 E;  2JY9 A;  2EOR A;  1RQ0 A;  2M7Q A;  2CT1 A;  2VQE E;  2EM4 A;  4P78 A;  5IXM B;  5AAS A;  4DV1 E;  4X65 E;  4M30 A;  4F6M A;  2V88 A;  2MDG A;  4JI6 E;  2EPA A;  1HNW E;  4X66 E;  4GZN C;  2L3C A;  4OX9 E;  2DB2 A;  2EN4 A;  4NXM E;  4RHB B;  5A6B A;  5LMN E;  1EH8 A;  2EPO A;  1X6F A;  4F2J C;  1IMU A;  2JPA A;  4DKK A;  2EPU A;  4P7D A;  3T1H E;  4WFT A;  3K6Q A;  2N3G A;  4LFA E;  2EN3 A;  2YZT A;  3RMP A;  2HHH E;  2L3J A;  3KZZ A;  3EPH A;  1MEY C;  2YTJ A;  1UBD C;  2RTX A;  1HR0 E;  4DV6 E;  2L2N A;  2L2K B;  2EPL X;  1PJQ A;  3EPL A;  1TN9 A;  2EM9 A;  2ENA A;  1T39 A;  1G2D C;  5IT9 C;  1BB8 A;  2FV4 B;  2MDR A;  2NA2 A;  2YT4 A;  2YU8 A;  2UXB E;  5KL2 A;  2VRD A;  4LFB E;  2EQ3 A;  2UUA E;  4L8N A;  2FTX B;  2EN1 A;  1NEI A;  2EPZ A;  4WPY A;  1QNT A;  1N3G A;  2B9D A;  2EOE A;  2EP3 A;  4OOG C;  2LMZ A;  4R03 A;  3ADG A;  3H09 A;  4FK5 C;  1A1J A;  4BC9 A;  4DR6 E;  5A69 A;  4DUY E;  5KL5 A;  1N34 E;  5F3W A;  4ZYD A;  1MGT A;  2JOX A;  1IBK E;  4WYQ B;  2EM6 A;  5AC5 A;  2JXP A;  2DGC A;  1YSA C;  5LMU E;  2ELZ A;  5LLQ A;  4WXD A;  2B7T A;  4LF9 E;  3BBG A;  1YPN A;  2BB8 A;  1FKA E;  2YTO A;  5FLX C;  2RS7 A;  4KWY A;  2R1F A;  2EM2 A;  1IBM E;  4B3M E;  1X47 A;  3T1Y E;  3C6M A;  2HGH A;  3KZY A;  1SFE A;  2EM0 A;  2EPP A;  2VQF E;  1G2F C;  2EZ6 A;  1L4S A;  1X6E A;  2DIX A;  2EPK X;  2LBS B;  4BC7 A;  5BR8 E;  4WXC A;  2KON A;  1XNR E;  2CSH A;  2EMI A;  4LU9 A;  5KL4 A;  2EQ0 A;  2EN8 A;  1ZBQ A;  4DV4 E;  2MC5 A;  4NZV A;  5AC4 A;  4LFC E;  4M2Z A;  2E1M A;  2LTR A;  4DR7 E;  1UN6 B;  3HQ1 A;  2LO3 A;  4HTG A;  2JOB A;  5A2Q C;  4JYA E;  3KWR A;  2YPN A;  4DR3 E;  2EMC A;  2DMI A;  2N3H A;  2YTD A;  2I9I A;  2HJJ A;  2CTD A;  1HNX E;  1QU6 A;  3MSW A;  4O24 A;  2EL5 A;  1YUJ A;  2YTG A;  4X64 E;  3M99 B;  3IWC A;  4R2E A;  5DNY A;  2WCC 3;  5A6K A;  2EJ4 A;  2UUB E;  1JK1 A;  4B3S E;  1EH6 A;  2M1S A;  1N32 E;  1A1F A;  2GPI A;  1WHN A;  5KL3 A;  2LV2 A;  2MC6 A;  3F6G A;  4I8O A;  4K0K E;  1PJS A;  1X49 A;  3VYY A;  4GEQ B;  4DV2 E;  4GKK E;  4O4K A;  4DR1 E;  4JI2 E;  3TQM A;  1ZBT A;  2V85 A; 
#chains in the Genus database with same CATH homology
 2EOH A;  1X3C A;  5KL5 A;  2NAB A;  2EPX A;  4M9V C;  1F2I G;  2EM6 A;  2YU5 A;  2EMH A;  4F6N A;  3EPJ A;  2RSI A;  2EOZ A;  2EOI A;  2DRP A;  3MHH C;  2LT7 A;  2DGC A;  2WBU A;  1YSA C;  4IS1 C;  4R2P A;  2ELZ A;  2EOQ A;  1DGC A;  4WSG A;  3EPK A;  2BB8 A;  2RPC A;  1TF3 A;  4IJD A;  2YTO A;  2I13 A;  2EOM A;  2PRT A;  2E72 A;  2JP9 A;  2EMG A;  2M9A A;  2EPR A;  2EM2 A;  2R1F A;  2YSP A;  2EMX A;  2EM5 A;  2HGH A;  2EM8 A;  2EM0 A;  2EOR A;  2EPP A;  2WBS A;  1A1I A;  2CT1 A;  2MKD A;  1KJK A;  2EM4 A;  4R2Q A;  1X5W A;  3UK3 C;  1A1K A;  2EOJ A;  2LVH A;  1G2F C;  2EOF A;  2YTE A;  2EOS A;  4F6M A;  1X6E A;  2MDG A;  2EM3 A;  2ENH A;  2EPA A;  2EL4 A;  1NCS A;  2ADR A;  3VHT B;  4GZN C;  1A1G A;  2EML A;  2CSH A;  2EMI A;  5KL4 A;  2GLI A;  1Z1B A;  2EQ0 A;  2EN8 A;  2DLK A;  2EMY A;  2EN4 A;  1ZR9 A;  1X6H A;  2YSO A;  1A1L A;  1UN6 B;  1ZAA C;  1TF6 A;  1X6F A;  2YTP A;  4F2J C;  2LO3 A;  2EE8 A;  2JPA A;  2ELY A;  2DLQ A;  2LCE A;  1RMD A;  2EOY A;  2EMC A;  2EMZ A;  2EPU A;  1LLM C;  2DMI A;  2EOO A;  2YTD A;  2EQ1 A;  2EN3 A;  1YUI A;  4R2A A;  3EPH A;  2CTD A;  1MEY C;  2MKN A;  2YTJ A;  1UBD C;  2EL5 A;  2EN2 A;  2YRK A;  1YUJ A;  2YTG A;  3EPL A;  1TN9 A;  2EM9 A;  3M99 B;  2ENA A;  4R2E A;  4R2C A;  2WCC 3;  1G2D C;  4R2R A;  2EJ4 A;  1BB8 A;  4X9J A;  1JK1 A;  2ENC A;  1BBO A;  2YTI A;  2EOX A;  2YTQ A;  2D9H A;  2EPC A;  2EL6 A;  2EMK A;  2J7J A;  1JK2 A;  2YU8 A;  1A1F A;  2YTN A;  4R2S A;  2YRH A;  2YRM A;  2EMW A;  2YTF A;  5KL2 A;  1P47 A;  2EN7 A;  5KL3 A;  2LV2 A;  2VRD A;  2EN6 A;  2EQ3 A;  2EN1 A;  1AAY A;  4R2D A;  5KL7 A;  2EPZ A;  2EMA A;  2EOE A;  1WJP A;  2WBT A;  2EP3 A;  5KL6 A;  1ZU1 A;  2EM7 A;  1B69 A;  2A25 A;  3MHS C;  2EMF A;  4FK5 C;  2GHF A;  1A1H A;  1A1J A;  2EMB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...