1UN6B

The crystal structure of a zinc finger - rna complex reveals two modes of molecular recognition
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
86
structure length
86
Chain Sequence
MYVCHFENCGKAFKKHNQLKVHQFSHTQQLPYECPHEGCDKRFSLPSRLKRHEKVHAGYPCKKDDSCSFVGKTWTLYLKHVAECHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of a Zinc-Finger-RNA Complex Reveals Two Modes of Molecular Recognition
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Rna-binding protein/rna
molecule keywords TRANSCRIPTION FACTOR IIIA
total genus 25
structure length 86
sequence length 86
chains with identical sequence C, D
ec nomenclature
pdb deposition date 2003-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1un6B02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1un6B01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1un6B03
2WBSA 2DGCA 2VRDA 2EM6A 1X6HA 4R2PA 1A1GA 2EPRA 2MKDA 2LCEA 2CSHA 2DMIA 1X5WA 2BB8A 2EOOA 2WBUA 2EOZA 4IJDA 4GZNC 2YTGA 2LV2A 4F6MA 5KL6A 2EM9A 2EOEA 2ENAA 2EN2A 4R2AA 2HGHA 2ENHA 4F6NA 5KL7A 4IS1C 2EN8A 2DLKA 2EPXA 1ZAAC 2EMHA 3EPKA 2EMWA 2EN1A 2JPAA 1YUIA 2ADRA 2YTFA 2JP9A 2RPCA 1LLMC 1X6FA 5KL4A 1A1KA 5KL2A 2EQ3A 5KL3A 2YSOA 2ELYA 4R2EA 1A1HA 1TF6A 1JK1A 2EM7A 1BBOA 2EOHA 3EPLA 2EMCA 2EOQA 2LVHA 2EOFA 2EPZA 2EMLA 2EOYA 2GHFA 3M99B 2EN4A 2EPCA 2EN3A 1P47A 3EPHA 2WCC3 2EM8A 1YSAC 2PRTA 1TN9A 2LT7A 2A25A 2YU8A 2D9HA 1A1FA 2EMGA 2YRHA 4R2SA 1TF3A 2EOJA 1A1LA 4R2QA 2ELZA 3VHTB 2YTPA 2E72A 2EMKA 1B69A 2EOSA 3MHHC 4WSGA 4M9VC 1X3CA 1G2DC 1ZU1A 2EMIA 2EOIA 2EMXA 1AAYA 2DLQA 2EL5A 2ENCA 1BB8A 2EM4A 2EL6A 2EM5A 2GLIA 3EPJA 2EORA 1YUJA 2EM2A 4FK5C 2EN7A 2DRPA 2EPPA 1RMDA 4R2CA 2YRKA 3MHSC 2YTDA 4R2RA 2WBTA 2EPUA 2YTOA 2EOMA 4R2DA 4X9JA 1WJPA 2EN6A 2CT1A 2YTJA 2YSPA 2YTQA 1UBDC 2YTEA 1JK2A 1A1JA 1G2FC 1KJKA 2MDGA 2R1FA 2M9AA 2CTDA 2EMFA 2EPAA 5KL5A 2LO3A 1UN6B 2EQ0A 2YTIA 2EQ1A 4F2JC 2YU5A 2EMYA 2EMBA 2EOXA 1A1IA 1ZR9A 1X6EA 2I13A 2YTNA 2EJ4A 2EM0A 2EP3A 2J7JA 1Z1BA 2EMZA 2NABA 2RSIA 3UK3C 2EE8A 2YRMA 1F2IG 1MEYC 1NCSA 2EL4A 1DGCA 2EMAA 2MKNA 2EM3A
chains in the Genus database with same CATH superfamily
2WBSA 4R2PA 3JTZA 1A1GA 3DJWA 1HNWE 4ZYHA 2FGGA 2LCEA 2YZTA 2EZ6A 4L8NA 4B3ME 5AC4A 4IJDA 1YYWA 1J26A 4WFTA 2LV2A 4BHCA 2GPIA 2ENAA 2ENHA 4JI6E 5KL7A 4LF6E 1UILA 5TSEA 2EPNA 2NA2A 4Q35B 4ZYGA 1YFHA 2UXDE 2KONA 2RPCA 4R8OA 2RQLA 3L00A 5AE1A 2YSOA 2DIXA 1WHQA 4YY3E 3EQ1A 5BR8E 2EOFA 4DV3E 4N4RB 1T39A 2H36X 3M99B 4WX9A 1XMOE 3VK6A 2EN4A 2NUEA 2EWLA 4BBYA 1TN9A 4HEIA 4BC7A 2JOBA 4R2QA 2YTPA 2MC6A 2EMKA 2R76A 5AE2A 1YYKA 5ADZA 4GKJE 1ZU1A 2EPOA 2EMXA 4NHRA 3ZOQB 1IQSA 2EL5A 3KZZA 2EM5A 2GLIA 3THNA 1YUJA 2EM2A 4FK5C 4X66E 1O0WA 4JI0E 5A2QC 1RMDA 1NEIA 5A6KA 2YRKA 3MHSC 1HR0E 2YTDA 4DR6E 2EPUA 2B3TB 2K7IA 4B3SE 4X8WA 4R2DA 1WJPA 4GEQB 2JWOA 3VYXA 1T4LB 2YTQA 3LLHA 2YTEA 1A1JA 4LF9E 1J5EE 2IHR1 2R1FA 2MC5A 2V85A 2WZOA 2CTDA 2EQ0A 5A6BD 1GZ6A 2YU5A 2HHHE 2FTXB 1T38A 4JV5E 2EJ4A 2Q8UA 2UXBE 3UK3C 4JI2E 2YRMA 4NXNE 1F2IG 2N8XA 1N32E 1MEYC 3ECRA 3ADIA 2EL4A 4DR2E 2DGCA 2L92A 1YZ9A 3HQ1A 1RC7A 2CSHA 1X47A 5LLQA 2EOOA 2WBUA 2ZM6E 4GZNC 4F6MA 5KL6A 4R2AA 2EN2A 1I94E 3P1XA 3JAMC 2M7QA 4LU9A 4JI7E 4LFCE 1N3GA 1N33E 2DLKA 2V89A 2EN1A 1YUIA 4ZYEA 2JP9A 1X6FA 4JYAE 5KL4A 2DSYA 3J7Yp 1PDAA 2JVAA 2L2KB 2EQ3A 4P7DA 5A6JA 3IWDA 4WSPA 1JK1A 3AV0A 1TF6A 4MLVA 2LJHA 5IV8B 5AASA 2EPCA 1X48A 2RSMA 2JYAA 5A6AA 2FV4B 1WHNA 2PRTA 4DR4E 1FKAE 1UHZA 1N36E 2EMGA 2RTXA 2LTRA 4DR5E 4NXME 1GTKA 2NUFA 1B69A 3J81C 4DV0E 5T6JA 3HXLA 2EOIA 4M0VA 4LFBE 4LTYA 2CPNA 2V83A 2BBGA 3EPJA 1YPNA 2LUQA 2EN7A 4M30A 2LUPB 4AQYE 4JI8E 2UUBE 2E1MA 3JU0A 4B3TE 1IBLE 2YTJA 2EPKX 4O24A 1UBDC 2YT4A 4DV1E 2M9AA 5KL5A 5FLXC 1WRJA 2LO3A 3HPZA 2YTIA 4F2JC 1X49A 4NZVA 4X64E 2EM0A 3T1HE 3F6HA 3ADLA 1MGTA 2F4VE 2M4IA 2KOUA 2ODRC 3J7AG 2L2MA 2LE2A 4HTGA 2EMAA 5AE3A 4DV5E 2LBSB 2EM3A 2VRDA 2EM6A 3ADJA 3KWRA 1X6HA 5CFFE 1N34E 2EPRA 2MKDA 3FIGA 1SR9A 2LJUA 2DMIA 1X5WA 4F9BB 4BCAA 1PJTA 2DB2A 5IT9C 1RQ0A 2EOEA 1IBKE 4WXCA 4DMIA 2EN8A 2EPXA 2EMHA 3EPKA 2EMWA 4DR1E 2ADRA 2YTFA 4KZSA 1LLMC 4JI3E 4DUYE 1A1KA 4DR3E 5KL2A 2L6MA 5LMNE 2ELYA 1XMQE 3HPSA 1BBOA 5LMUE 2EOHA 2EMCA 1QNTA 2EOQA 2LVHA 2EMLA 2I9IA 4JI4E 2GHFA 2YWQA 4F54A 3EPHA 1PJQA 3MSWA 3H09A 2WCC3 1YSAC 2LRSA 1BBGA 1SFEA 3KZYA 2B7TA 2JY9A 2LT7A 2A25A 1IMUA 3LMLA 3TQMA 2D9HA 1A1FA 1TF3A 4J8ZA 2DMYA 1T4OA 2EOJA 4LF7E 3C4TA 2ELZA 3VHTB 2E72A 4BHBA 1EKZA 2JOXA 4JI5E 3THOB 2EOSA 4M9VC 4WSGA 3VYYA 1X3CA 1G2DC 1AAYA 1QU6A 2EORA 4L5NC 2RS7A 2DRPA 2EPPA 2HC5A 3C6MA 2MDRA 4R2CA 4WPYA 4ZYDA 2WBTA 1FJGE 4K0KE 3F6GA 4O4KA 3T1YE 2YTOA 5LL6R 2EN6A 1YYOA 2CT1A 2UUAE 4DV4E 2V87A 4BC9A 4OOGC 3C4BA 5IXMB 1KJKA 1JK2A 1G2FC 1DI2A 4LF5E 4F9AB 2L3JA 2EQ1A 3RMPA 1A1IA 2I13A 5AC5A 2YTNA 4RHBB 4BS9A 2HJJA 2K4VA 4DKKA 5DNYA 2EMZA 2NABA 2N3GA 1DQ3A 1EH8A 1T4NA 5IWAE 4DV6E 5F3WA 4LFAE 3ADGA 4B3RE 2N3HA 3AUZA 2L8TA 5A6BA 4JI1E 2G7HA 3BIDA 2BB8A 2VE7C 2EOZA 5A69A 2YTGA 3BGHA 2UU9E 2EM9A 2HGHA 4LF4E 1AH5A 4F6NA 3BF2A 1L4SA 4F9CB 4TUIA 2JXPA 4IS1C 1ZAAC 4X62E 2JPAA 4M2ZA 4WYQB 2V86A 2YPNA 4RH8A 1XNQE 2RS6A 3J80C 1STUA 5KL3A 1ZBQA 4R2EA 2VQEE 1A1HA 1HNXE 1PJSA 4I8OA 1XNRE 2EM7A 3IWBA 4P78A 2VQFE 4DR7E 3EPLA 2L33A 2M1SA 4YHHE 4LF8E 3DF6A 2EPZA 2EOYA 3K6QA 2B7VA 2B9DA 2EN3A 1P47A 2EM8A 1PKPA 2V88A 2YU8A 3OTOE 1IQOA 3QG5C 2YRHA 4R2SA 4BMJA 2F8BA 1A1LA 1EH6A 2L2NA 4X65E 3C6KA 2E5LE 4KHPE 3MHHC 2UXCE 1WXRA 4DV7E 4TUGA 2EMIA 2DLQA 2ENCA 4WXDA 1BB8A 2EM4A 2L3CA 1IBME 2EL6A 4Q28A 4GKKE 4O5GA 1ZBTA 2EPLX 3HTXA 4R2RA 2JR1A 2KHXA 4R03A 2UUCE 2EOMA 4X9JA 1EH7A 4O43A 2YSPA 3OMLA 4MLQA 4OX9E 4DUZE 2MDGA 2EMFA 2EPAA 1GQEA 1UN6B 2EPMX 4KWYA 2EMYA 2EMBA 2EOXA 1ZR9A 1X6EA 2ODRD 3IWCA 2NUGA 2EP3A 2J7JA 2V8QB 1Z1BA 1KYQA 2RSIA 2VF1A 1HNZE 2EE8A 2LMZA 1NCSA 1DGCA 3BBGA 2LTSA 4DV2E 2MKNA
chains in the Genus database with same CATH topology
2WBSA 2DGCA 2VRDA 2EM6A 1X6HA 4R2PA 1A1GA 2EPRA 2MKDA 2LCEA 2CSHA 2DMIA 1X5WA 2BB8A 2EOOA 2WBUA 2EOZA 4IJDA 4GZNC 2YTGA 2LV2A 4F6MA 5KL6A 2EM9A 2EOEA 2ENAA 2EN2A 4R2AA 2HGHA 2ENHA 4F6NA 5KL7A 4IS1C 2EN8A 2DLKA 2EPXA 1ZAAC 2EMHA 3EPKA 2EMWA 2EN1A 2JPAA 1YUIA 2ADRA 2YTFA 2JP9A 2RPCA 1LLMC 1X6FA 5KL4A 1A1KA 5KL2A 2EQ3A 5KL3A 2YSOA 2ELYA 4R2EA 1A1HA 1TF6A 1JK1A 2EM7A 1BBOA 2EOHA 3EPLA 2EMCA 2EOQA 2LVHA 2EOFA 2EPZA 2EMLA 2EOYA 2GHFA 3M99B 2EN4A 2EPCA 2EN3A 1P47A 3EPHA 2WCC3 2EM8A 1YSAC 2PRTA 1TN9A 2LT7A 2A25A 2YU8A 2D9HA 1A1FA 2EMGA 2YRHA 4R2SA 1TF3A 2EOJA 1A1LA 4R2QA 2ELZA 3VHTB 2YTPA 2E72A 2EMKA 1B69A 2EOSA 3MHHC 4WSGA 4M9VC 1X3CA 1G2DC 1ZU1A 2EMIA 2EOIA 2EMXA 1AAYA 2DLQA 2EL5A 2ENCA 1BB8A 2EM4A 2EL6A 2EM5A 2GLIA 3EPJA 2EORA 1YUJA 2EM2A 4FK5C 2EN7A 2DRPA 2EPPA 1RMDA 4R2CA 2YRKA 3MHSC 2YTDA 4R2RA 2WBTA 2EPUA 2YTOA 2EOMA 4R2DA 4X9JA 1WJPA 2EN6A 2CT1A 2YTJA 2YSPA 2YTQA 1UBDC 2YTEA 1JK2A 1A1JA 1G2FC 1KJKA 2MDGA 2R1FA 2M9AA 2CTDA 2EMFA 2EPAA 5KL5A 2LO3A 1UN6B 2EQ0A 2YTIA 2EQ1A 4F2JC 2YU5A 2EMYA 2EMBA 2EOXA 1A1IA 1ZR9A 1X6EA 2I13A 2YTNA 2EJ4A 2EM0A 2EP3A 2J7JA 1Z1BA 2EMZA 2NABA 2RSIA 3UK3C 2EE8A 2YRMA 1F2IG 1MEYC 1NCSA 2EL4A 1DGCA 2EMAA 2MKNA 2EM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WBS A;  2DGC A;  2VRD A;  2EM6 A;  1X6H A;  4R2P A;  1A1G A;  2EPR A;  2MKD A;  2LCE A;  2CSH A;  2DMI A;  1X5W A;  2BB8 A;  2EOO A;  2WBU A;  2EOZ A;  4IJD A;  4GZN C;  2YTG A;  2LV2 A;  4F6M A;  5KL6 A;  2EM9 A;  2EOE A;  2ENA A;  2EN2 A;  4R2A A;  2HGH A;  2ENH A;  4F6N A;  5KL7 A;  4IS1 C;  2EN8 A;  2DLK A;  2EPX A;  1ZAA C;  2EMH A;  3EPK A;  2EMW A;  2EN1 A;  2JPA A;  1YUI A;  2ADR A;  2YTF A;  2JP9 A;  2RPC A;  1LLM C;  1X6F A;  5KL4 A;  1A1K A;  5KL2 A;  2EQ3 A;  5KL3 A;  2YSO A;  2ELY A;  4R2E A;  1A1H A;  1TF6 A;  1JK1 A;  2EM7 A;  1BBO A;  2EOH A;  3EPL A;  2EMC A;  2EOQ A;  2LVH A;  2EOF A;  2EPZ A;  2EML A;  2EOY A;  2GHF A;  3M99 B;  2EN4 A;  2EPC A;  2EN3 A;  1P47 A;  3EPH A;  2WCC 3;  2EM8 A;  1YSA C;  2PRT A;  1TN9 A;  2LT7 A;  2A25 A;  2YU8 A;  2D9H A;  1A1F A;  2EMG A;  2YRH A;  4R2S A;  1TF3 A;  2EOJ A;  1A1L A;  4R2Q A;  2ELZ A;  3VHT B;  2YTP A;  2E72 A;  2EMK A;  1B69 A;  2EOS A;  3MHH C;  4WSG A;  4M9V C;  1X3C A;  1G2D C;  1ZU1 A;  2EMI A;  2EOI A;  2EMX A;  1AAY A;  2DLQ A;  2EL5 A;  2ENC A;  1BB8 A;  2EM4 A;  2EL6 A;  2EM5 A;  2GLI A;  3EPJ A;  2EOR A;  1YUJ A;  2EM2 A;  4FK5 C;  2EN7 A;  2DRP A;  2EPP A;  1RMD A;  4R2C A;  2YRK A;  3MHS C;  2YTD A;  4R2R A;  2WBT A;  2EPU A;  2YTO A;  2EOM A;  4R2D A;  4X9J A;  1WJP A;  2EN6 A;  2CT1 A;  2YTJ A;  2YSP A;  2YTQ A;  1UBD C;  2YTE A;  1JK2 A;  1A1J A;  1G2F C;  1KJK A;  2MDG A;  2R1F A;  2M9A A;  2CTD A;  2EMF A;  2EPA A;  5KL5 A;  2LO3 A;  1UN6 B;  2EQ0 A;  2YTI A;  2EQ1 A;  4F2J C;  2YU5 A;  2EMY A;  2EMB A;  2EOX A;  1A1I A;  1ZR9 A;  1X6E A;  2I13 A;  2YTN A;  2EJ4 A;  2EM0 A;  2EP3 A;  2J7J A;  1Z1B A;  2EMZ A;  2NAB A;  2RSI A;  3UK3 C;  2EE8 A;  2YRM A;  1F2I G;  1MEY C;  1NCS A;  2EL4 A;  1DGC A;  2EMA A;  2MKN A;  2EM3 A; 
#chains in the Genus database with same CATH topology
 2WBS A;  4R2P A;  3JTZ A;  1A1G A;  3DJW A;  1HNW E;  4ZYH A;  2FGG A;  2LCE A;  2YZT A;  2EZ6 A;  4L8N A;  4B3M E;  5AC4 A;  4IJD A;  1YYW A;  1J26 A;  4WFT A;  2LV2 A;  4BHC A;  2GPI A;  2ENA A;  2ENH A;  4JI6 E;  5KL7 A;  4LF6 E;  1UIL A;  5TSE A;  2EPN A;  2NA2 A;  4Q35 B;  4ZYG A;  1YFH A;  2UXD E;  2KON A;  2RPC A;  4R8O A;  2RQL A;  3L00 A;  5AE1 A;  2YSO A;  2DIX A;  1WHQ A;  4YY3 E;  3EQ1 A;  5BR8 E;  2EOF A;  4DV3 E;  4N4R B;  1T39 A;  2H36 X;  3M99 B;  4WX9 A;  1XMO E;  3VK6 A;  2EN4 A;  2NUE A;  2EWL A;  4BBY A;  1TN9 A;  4HEI A;  4BC7 A;  2JOB A;  4R2Q A;  2YTP A;  2MC6 A;  2EMK A;  2R76 A;  5AE2 A;  1YYK A;  5ADZ A;  4GKJ E;  1ZU1 A;  2EPO A;  2EMX A;  4NHR A;  3ZOQ B;  1IQS A;  2EL5 A;  3KZZ A;  2EM5 A;  2GLI A;  3THN A;  1YUJ A;  2EM2 A;  4FK5 C;  4X66 E;  1O0W A;  4JI0 E;  5A2Q C;  1RMD A;  1NEI A;  5A6K A;  2YRK A;  3MHS C;  1HR0 E;  2YTD A;  4DR6 E;  2EPU A;  2B3T B;  2K7I A;  4B3S E;  4X8W A;  4R2D A;  1WJP A;  4GEQ B;  2JWO A;  3VYX A;  1T4L B;  2YTQ A;  3LLH A;  2YTE A;  1A1J A;  4LF9 E;  1J5E E;  2IHR 1;  2R1F A;  2MC5 A;  2V85 A;  2WZO A;  2CTD A;  2EQ0 A;  5A6B D;  1GZ6 A;  2YU5 A;  2HHH E;  2FTX B;  1T38 A;  4JV5 E;  2EJ4 A;  2Q8U A;  2UXB E;  3UK3 C;  4JI2 E;  2YRM A;  4NXN E;  1F2I G;  2N8X A;  1N32 E;  1MEY C;  3ECR A;  3ADI A;  2EL4 A;  4DR2 E;  2DGC A;  2L92 A;  1YZ9 A;  3HQ1 A;  1RC7 A;  2CSH A;  1X47 A;  5LLQ A;  2EOO A;  2WBU A;  2ZM6 E;  4GZN C;  4F6M A;  5KL6 A;  4R2A A;  2EN2 A;  1I94 E;  3P1X A;  3JAM C;  2M7Q A;  4LU9 A;  4JI7 E;  4LFC E;  1N3G A;  1N33 E;  2DLK A;  2V89 A;  2EN1 A;  1YUI A;  4ZYE A;  2JP9 A;  1X6F A;  4JYA E;  5KL4 A;  2DSY A;  3J7Y p;  1PDA A;  2JVA A;  2L2K B;  2EQ3 A;  4P7D A;  5A6J A;  3IWD A;  4WSP A;  1JK1 A;  3AV0 A;  1TF6 A;  4MLV A;  2LJH A;  5IV8 B;  5AAS A;  2EPC A;  1X48 A;  2RSM A;  2JYA A;  5A6A A;  2FV4 B;  1WHN A;  2PRT A;  4DR4 E;  1FKA E;  1UHZ A;  1N36 E;  2EMG A;  2RTX A;  2LTR A;  4DR5 E;  4NXM E;  1GTK A;  2NUF A;  1B69 A;  3J81 C;  4DV0 E;  5T6J A;  3HXL A;  2EOI A;  4M0V A;  4LFB E;  4LTY A;  2CPN A;  2V83 A;  2BBG A;  3EPJ A;  1YPN A;  2LUQ A;  2EN7 A;  4M30 A;  2LUP B;  4AQY E;  4JI8 E;  2UUB E;  2E1M A;  3JU0 A;  4B3T E;  1IBL E;  2YTJ A;  2EPK X;  4O24 A;  1UBD C;  2YT4 A;  4DV1 E;  2M9A A;  5KL5 A;  5FLX C;  1WRJ A;  2LO3 A;  3HPZ A;  2YTI A;  4F2J C;  1X49 A;  4NZV A;  4X64 E;  2EM0 A;  3T1H E;  3F6H A;  3ADL A;  1MGT A;  2F4V E;  2M4I A;  2KOU A;  2ODR C;  3J7A G;  2L2M A;  2LE2 A;  4HTG A;  2EMA A;  5AE3 A;  4DV5 E;  2LBS B;  2EM3 A;  2VRD A;  2EM6 A;  3ADJ A;  3KWR A;  1X6H A;  5CFF E;  1N34 E;  2EPR A;  2MKD A;  3FIG A;  1SR9 A;  2LJU A;  2DMI A;  1X5W A;  4F9B B;  4BCA A;  1PJT A;  2DB2 A;  5IT9 C;  1RQ0 A;  2EOE A;  1IBK E;  4WXC A;  4DMI A;  2EN8 A;  2EPX A;  2EMH A;  3EPK A;  2EMW A;  4DR1 E;  2ADR A;  2YTF A;  4KZS A;  1LLM C;  4JI3 E;  4DUY E;  1A1K A;  4DR3 E;  5KL2 A;  2L6M A;  5LMN E;  2ELY A;  1XMQ E;  3HPS A;  1BBO A;  5LMU E;  2EOH A;  2EMC A;  1QNT A;  2EOQ A;  2LVH A;  2EML A;  2I9I A;  4JI4 E;  2GHF A;  2YWQ A;  4F54 A;  3EPH A;  1PJQ A;  3MSW A;  3H09 A;  2WCC 3;  1YSA C;  2LRS A;  1BBG A;  1SFE A;  3KZY A;  2B7T A;  2JY9 A;  2LT7 A;  2A25 A;  1IMU A;  3LML A;  3TQM A;  2D9H A;  1A1F A;  1TF3 A;  4J8Z A;  2DMY A;  1T4O A;  2EOJ A;  4LF7 E;  3C4T A;  2ELZ A;  3VHT B;  2E72 A;  4BHB A;  1EKZ A;  2JOX A;  4JI5 E;  3THO B;  2EOS A;  4M9V C;  4WSG A;  3VYY A;  1X3C A;  1G2D C;  1AAY A;  1QU6 A;  2EOR A;  4L5N C;  2RS7 A;  2DRP A;  2EPP A;  2HC5 A;  3C6M A;  2MDR A;  4R2C A;  4WPY A;  4ZYD A;  2WBT A;  1FJG E;  4K0K E;  3F6G A;  4O4K A;  3T1Y E;  2YTO A;  5LL6 R;  2EN6 A;  1YYO A;  2CT1 A;  2UUA E;  4DV4 E;  2V87 A;  4BC9 A;  4OOG C;  3C4B A;  5IXM B;  1KJK A;  1JK2 A;  1G2F C;  1DI2 A;  4LF5 E;  4F9A B;  2L3J A;  2EQ1 A;  3RMP A;  1A1I A;  2I13 A;  5AC5 A;  2YTN A;  4RHB B;  4BS9 A;  2HJJ A;  2K4V A;  4DKK A;  5DNY A;  2EMZ A;  2NAB A;  2N3G A;  1DQ3 A;  1EH8 A;  1T4N A;  5IWA E;  4DV6 E;  5F3W A;  4LFA E;  3ADG A;  4B3R E;  2N3H A;  3AUZ A;  2L8T A;  5A6B A;  4JI1 E;  2G7H A;  3BID A;  2BB8 A;  2VE7 C;  2EOZ A;  5A69 A;  2YTG A;  3BGH A;  2UU9 E;  2EM9 A;  2HGH A;  4LF4 E;  1AH5 A;  4F6N A;  3BF2 A;  1L4S A;  4F9C B;  4TUI A;  2JXP A;  4IS1 C;  1ZAA C;  4X62 E;  2JPA A;  4M2Z A;  4WYQ B;  2V86 A;  2YPN A;  4RH8 A;  1XNQ E;  2RS6 A;  3J80 C;  1STU A;  5KL3 A;  1ZBQ A;  4R2E A;  2VQE E;  1A1H A;  1HNX E;  1PJS A;  4I8O A;  1XNR E;  2EM7 A;  3IWB A;  4P78 A;  2VQF E;  4DR7 E;  3EPL A;  2L33 A;  2M1S A;  4YHH E;  4LF8 E;  3DF6 A;  2EPZ A;  2EOY A;  3K6Q A;  2B7V A;  2B9D A;  2EN3 A;  1P47 A;  2EM8 A;  1PKP A;  2V88 A;  2YU8 A;  3OTO E;  1IQO A;  3QG5 C;  2YRH A;  4R2S A;  4BMJ A;  2F8B A;  1A1L A;  1EH6 A;  2L2N A;  4X65 E;  3C6K A;  2E5L E;  4KHP E;  3MHH C;  2UXC E;  1WXR A;  4DV7 E;  4TUG A;  2EMI A;  2DLQ A;  2ENC A;  4WXD A;  1BB8 A;  2EM4 A;  2L3C A;  1IBM E;  2EL6 A;  4Q28 A;  4GKK E;  4O5G A;  1ZBT A;  2EPL X;  3HTX A;  4R2R A;  2JR1 A;  2KHX A;  4R03 A;  2UUC E;  2EOM A;  4X9J A;  1EH7 A;  4O43 A;  2YSP A;  3OML A;  4MLQ A;  4OX9 E;  4DUZ E;  2MDG A;  2EMF A;  2EPA A;  1GQE A;  1UN6 B;  2EPM X;  4KWY A;  2EMY A;  2EMB A;  2EOX A;  1ZR9 A;  1X6E A;  2ODR D;  3IWC A;  2NUG A;  2EP3 A;  2J7J A;  2V8Q B;  1Z1B A;  1KYQ A;  2RSI A;  2VF1 A;  1HNZ E;  2EE8 A;  2LMZ A;  1NCS A;  1DGC A;  3BBG A;  2LTS A;  4DV2 E;  2MKN A; 
#chains in the Genus database with same CATH homology
 2WBS A;  2DGC A;  2VRD A;  2EM6 A;  1X6H A;  4R2P A;  1A1G A;  2EPR A;  2MKD A;  2LCE A;  2CSH A;  2DMI A;  1X5W A;  2BB8 A;  2EOO A;  2WBU A;  2EOZ A;  4IJD A;  4GZN C;  2YTG A;  2LV2 A;  4F6M A;  5KL6 A;  2EM9 A;  2EOE A;  2ENA A;  2EN2 A;  4R2A A;  2HGH A;  2ENH A;  4F6N A;  5KL7 A;  4IS1 C;  2EN8 A;  2DLK A;  2EPX A;  1ZAA C;  2EMH A;  3EPK A;  2EMW A;  2EN1 A;  2JPA A;  1YUI A;  2ADR A;  2YTF A;  2JP9 A;  2RPC A;  1LLM C;  1X6F A;  5KL4 A;  1A1K A;  5KL2 A;  2EQ3 A;  5KL3 A;  2YSO A;  2ELY A;  4R2E A;  1A1H A;  1TF6 A;  1JK1 A;  2EM7 A;  1BBO A;  2EOH A;  3EPL A;  2EMC A;  2EOQ A;  2LVH A;  2EOF A;  2EPZ A;  2EML A;  2EOY A;  2GHF A;  3M99 B;  2EN4 A;  2EPC A;  2EN3 A;  1P47 A;  3EPH A;  2WCC 3;  2EM8 A;  1YSA C;  2PRT A;  1TN9 A;  2LT7 A;  2A25 A;  2YU8 A;  2D9H A;  1A1F A;  2EMG A;  2YRH A;  4R2S A;  1TF3 A;  2EOJ A;  1A1L A;  4R2Q A;  2ELZ A;  3VHT B;  2YTP A;  2E72 A;  2EMK A;  1B69 A;  2EOS A;  3MHH C;  4WSG A;  4M9V C;  1X3C A;  1G2D C;  1ZU1 A;  2EMI A;  2EOI A;  2EMX A;  1AAY A;  2DLQ A;  2EL5 A;  2ENC A;  1BB8 A;  2EM4 A;  2EL6 A;  2EM5 A;  2GLI A;  3EPJ A;  2EOR A;  1YUJ A;  2EM2 A;  4FK5 C;  2EN7 A;  2DRP A;  2EPP A;  1RMD A;  4R2C A;  2YRK A;  3MHS C;  2YTD A;  4R2R A;  2WBT A;  2EPU A;  2YTO A;  2EOM A;  4R2D A;  4X9J A;  1WJP A;  2EN6 A;  2CT1 A;  2YTJ A;  2YSP A;  2YTQ A;  1UBD C;  2YTE A;  1JK2 A;  1A1J A;  1G2F C;  1KJK A;  2MDG A;  2R1F A;  2M9A A;  2CTD A;  2EMF A;  2EPA A;  5KL5 A;  2LO3 A;  1UN6 B;  2EQ0 A;  2YTI A;  2EQ1 A;  4F2J C;  2YU5 A;  2EMY A;  2EMB A;  2EOX A;  1A1I A;  1ZR9 A;  1X6E A;  2I13 A;  2YTN A;  2EJ4 A;  2EM0 A;  2EP3 A;  2J7J A;  1Z1B A;  2EMZ A;  2NAB A;  2RSI A;  3UK3 C;  2EE8 A;  2YRM A;  1F2I G;  1MEY C;  1NCS A;  2EL4 A;  1DGC A;  2EMA A;  2MKN A;  2EM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...