1UN6B

The crystal structure of a zinc finger - rna complex reveals two modes of molecular recognition
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
86
structure length
86
Chain Sequence
b'MYVCHFENCGKAFKKHNQLKVHQFSHTQQLPYECPHEGCDKRFSLPSRLKRHEKVHAGYPCKKDDSCSFVGKTWTLYLKHVAECHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSCRIPTION FACTOR IIIA
publication title Crystal Structure of a Zinc-Finger-RNA Complex Reveals Two Modes of Molecular Recognition
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Rna-binding protein/rna
total genus 25
structure length 86
sequence length 86
chains with identical sequence C, D
ec nomenclature
pdb deposition date 2003-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1un6B02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1un6B01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1un6B03
4R2EA 2EOMA 2EPPA 2EM9A 2YTFA 2CTDA 2NABA 2VRDA 2EOFA 2EMCA 1X5WA 4F6MA 2YRKA 2YU5A 1TN9A 2YTGA 2ELYA 5KL4A 3EPJA 3MHHC 3UK3C 1G2DC 1ZU1A 2EMZA 2GHFA 1F2IG 2WBUA 2EOXA 1NCSA 2DGCA 1G2FC 2EM2A 3M99B 1DGCA 1RMDA 2E72A 2EM4A 3EPLA 2GLIA 2D9HA 5KL3A 2EN2A 1BBOA 2DLQA 2EOYA 2LCEA 4R2RA 2WBTA 2EOOA 2YU8A 4FK5C 1A1LA 2EOHA 1X6EA 2EMXA 2YTEA 4R2CA 1A1GA 2HGHA 1JK2A 2EPCA 1TF6A 2DMIA 2ENHA 2EMIA 2EP3A 2EM6A 2YRHA 1BB8A 4X9JA 2YTPA 2EM8A 2DRPA 2DLKA 1UN6B 2EE8A 1UBDC 2EPZA 1YSAC 4R2AA 1Z1BA 2BB8A 2EOIA 1X6FA 1LLMC 2ELZA 1ZAAC 2EMWA 2EORA 2YRMA 4WSGA 3EPKA 2EL6A 5KL7A 2EJ4A 2RSIA 2EQ0A 2EMGA 2MKNA 2LV2A 4R2SA 2RPCA 2YTDA 2YTNA 2MKDA 4R2QA 1YUJA 1AAYA 1JK1A 1ZR9A 2EN3A 4R2PA 2PRTA 3MHSC 4M9VC 2EM3A 2LT7A 2EOQA 2WBSA 4F6NA 2JP9A 2ADRA 4IS1C 1A1IA 2EMLA 2YSOA 1KJKA 2EPUA 2LVHA 1P47A 2EMYA 2EQ1A 2J7JA 1TF3A 4F2JC 1X6HA 2EOJA 2YTIA 2EOSA 4GZNC 2EMHA 1MEYC 2R1FA 3EPHA 2EPXA 2YTQA 2EMKA 2YTOA 4IJDA 2EN7A 2EPRA 2LO3A 2EN4A 2CT1A 2EM0A 2YTJA 2EL4A 3VHTB 1A1KA 1WJPA 2M9AA 1A1FA 1A1HA 2EN1A 2EQ3A 2EL5A 5KL6A 2JPAA 2MDGA 2ENAA 2CSHA 5KL5A 1B69A 2EN8A 2ENCA 2EM5A 2EMBA 2I13A 5KL2A 2EOEA 4R2DA 2EPAA 2EMAA 2WCC3 2EN6A 1A1JA 1YUIA 2EOZA 2YSPA 2EMFA 2A25A 1X3CA 2EM7A
chains in the Genus database with same CATH superfamily
2UUCE 2EM9A 3IWBA 4BBYA 5A69A 2G7HA 1PJSA 1HNXE 3OTOE 2WBUA 4LF6E 3BIDA 3AV0A 2R76A 4BMJA 1O0WA 1DGCA 3VK6A 1XMQE 2DLQA 2EOYA 4R2RA 2EOOA 4O5GA 4DV3E 1GQEA 2YTEA 1N3GA 1WRJA 1A1GA 2ENHA 2EMIA 2RS6A 3JU0A 4JI7E 2LJUA 2YTPA 1YPNA 2F4VE 1T4NA 4BC7A 2EPZA 5A6BA 1YZ9A 1X6FA 4OOGC 2ELZA 3L00A 1ZAAC 2Q8UA 2B3TB 3EPKA 2ZM6E 5KL7A 2KOUA 4NZVA 5A6AA 1RC7A 2LV2A 2M4IA 4DKKA 4M0VA 4R2QA 4NHRA 1IQOA 5TSEA 4LFBE 1DQ3A 4BHCA 2YZTA 3F6GA 2JWOA 2ADRA 1A1IA 2LVHA 3QG5C 1I94E 1P47A 4DUYE 4X66E 4HEIA 3ZOQB 4ZYGA 4F2JC 2E5LE 4LU9A 2EMHA 3KZYA 2JXPA 1MEYC 2R1FA 1X49A 4HTGA 2EMKA 2YTOA 4IJDA 2FTXB 2UUBE 5F3WA 2UXBE 3TQMA 2EM0A 2VF1A 2EL4A 3MSWA 5LLQA 4YY3E 2JOXA 4F9CB 2RQLA 3T1HE 4JV5E 2KONA 3BGHA 2EQ3A 3C4BA 2EL5A 1IQSA 2JYAA 2IHR1 1HR0E 5A6KA 3FIGA 2EMBA 3BBGA 2HJJA 1YFHA 4WPYA 2EOZA 4NXME 2LJHA 4R03A 1QU6A 4KWYA 2ODRD 1GZ6A 2NABA 4WSPA 2EOFA 3JTZA 2KHXA 1X5WA 4F6MA 4DR2E 1TN9A 2YTGA 5KL4A 3UK3C 3MHHC 3J81C 1UILA 2EOXA 1NCSA 2V88A 4P7DA 3AUZA 3OMLA 5AE2A 3EPLA 1BBOA 2WBTA 1FKAE 4X62E 4I8OA 2EOHA 1X6EA 5A6JA 2DMYA 2EMXA 2M1SA 4R2CA 2EPCA 1TF6A 2YRHA 2EM8A 2DLKA 2VQFE 2YPNA 1UBDC 3P1XA 2JVAA 4O4KA 1Z1BA 5AE3A 2EOIA 2V87A 2LMZA 1WHNA 4OX9E 2YRMA 1YYWA 2V8QB 2NUFA 2RSIA 5T6JA 2EPMX 2I9IA 2M7QA 2EMGA 4JI8E 5IWAE 4R2SA 2YTNA 2MKDA 1YUJA 2WZOA 5ADZA 1AAYA 2EN3A 3EQ1A 4L5NC 3C6KA 4WX9A 5AE1A 4M9VC 2WBSA 3BF2A 1DI2A 4IS1C 4X8WA 5FLXC 2L3CA 4F54A 4LTYA 2B9DA 2J7JA 3ADGA 4DMIA 4LFAE 1QNTA 1X6HA 3HTXA 2RTXA 4R8OA 4GZNC 1PKPA 4ZYHA 3EPHA 2EPXA 3J7Yp 4DUZE 4JYAE 3C6MA 2EN4A 2CT1A 5IV8B 3ADJA 2NUGA 1A1HA 5AC5A 4X65E 2RSMA 5KL6A 2JPAA 2MDGA 3KZZA 4J8ZA 5BR8E 1HNWE 3THNA 4O43A 1T38A 1B69A 3J7AG 2ENCA 5A6BD 1AH5A 4R2DA 1GTKA 2EPAA 2WCC3 1A1JA 1YUIA 2EPNA 2YWQA 2EMFA 2A25A 2RS7A 3DJWA 4R2EA 2E1MA 2LUQA 4JI4E 2EOMA 4YHHE 4DV1E 4JI6E 1NEIA 2CTDA 3DF6A 2YRKA 2YU5A 2ELYA 3EPJA 2L92A 1G2FC 3JAMC 2EM2A 2L2NA 4JI0E 4M2ZA 1WHQA 2GLIA 1L4SA 5KL3A 2EN2A 2LRSA 2LCEA 4DR4E 2JY9A 1A1LA 2V85A 4KZSA 2LBSB 4K0KE 4WYQB 4GKJE 4LF7E 2DMIA 4DV5E 1BB8A 2EM6A 1XNQE 4RH8A 5AC4A 5AASA 2L2KB 1X48A 2V89A 1UN6B 1MGTA 3IWCA 1N36E 1YSAC 2HHHE 2GPIA 1HNZE 2BB8A 1J26A 2EMWA 2VQEE 2EORA 4ZYDA 3C4TA 3K6QA 2EL6A 2EJ4A 2YT4A 2EQ0A 2MKNA 2RPCA 2YTDA 1WXRA 4B3SE 1FJGE 4P78A 1T4OA 1ZR9A 3THOB 1JK1A 4R2PA 4LF9E 2EM3A 2LT7A 2EOQA 4NXNE 4F6NA 2EMLA 2L8TA 2YSOA 4DR3E 1N33E 4N4RB 1KJKA 3VYXA 2EMYA 1T39A 4JI5E 2DSYA 2DB2A 2EPOA 2K4VA 1YYKA 4LF4E 2N3GA 2L33A 2YTQA 4B3RE 4DV2E 4DR5E 5LMNE 4X64E 2YTJA 3VHTB 1A1KA 1WJPA 1IBKE 1ZBQA 2B7VA 2UXCE 3ECRA 4RHBB 5CFFE 4O24A 2MC6A 2EN1A 2FV4B 4WXDA 1XMOE 2JR1A 3ADLA 2FGGA 4KHPE 5KL5A 4WXCA 2L2MA 2V83A 2I13A 5KL2A 4BHBA 5IT9C 1IBME 3RMPA 1J5EE 2MDRA 2NUEA 2CPNA 4MLVA 1T4LB 3LMLA 2EM7A 2L6MA 4M30A 2EPPA 1KYQA 2H36X 2YTFA 2VRDA 4DR6E 3IWDA 4DV7E 2EMCA 4AQYE 4Q35B 2JOBA 3T1YE 4LFCE 3ADIA 2UXDE 4TUGA 1G2DC 1ZU1A 2EMZA 2GHFA 5DNYA 1F2IG 2DIXA 4MLQA 3H09A 4JI2E 2DGCA 1EH7A 2BBGA 4GKKE 3M99B 5IXMB 1RMDA 2E72A 2LUPB 1N34E 2EM4A 4L8NA 4BC9A 2D9HA 1N32E 2ODRC 2EPLX 4JI3E 2EZ6A 2UUAE 2YU8A 4FK5C 5LL6R 2LE2A 4DV0E 4Q28A 5A2QC 2HGHA 1IMUA 1JK2A 1UHZA 3HPSA 1PDAA 1EKZA 2EP3A 4X9JA 2DRPA 2EE8A 4B3ME 2UU9E 2LTSA 4DV4E 4R2AA 2N3HA 1STUA 5LMUE 1LLMC 2LTRA 4B3TE 3LLHA 4WSGA 2MC5A 3KWRA 1EH8A 2N8XA 4ZYEA 1SFEA 3J80C 1RQ0A 2PRTA 3MHSC 2L3JA 3F6HA 4LF5E 1ZBTA 2EPKX 2JP9A 4DV6E 3VYYA 1PJTA 2K7IA 2EPUA 2EQ1A 1PJQA 1TF3A 3HPZA 1YYOA 2EOJA 2VE7C 2YTIA 4F9BB 2EOSA 1XNRE 4BS9A 3HXLA 2EN7A 2EPRA 2LO3A 2NA2A 3HQ1A 2M9AA 2F8BA 1A1FA 1EH6A 2V86A 4GEQB 2B7TA 1X47A 4WFTA 2HC5A 1IBLE 4TUIA 4DR7E 2ENAA 2CSHA 4DR1E 4BCAA 4JI1E 2EN8A 4LF8E 2EM5A 2EWLA 2EOEA 1BBGA 2EMAA 2EN6A 1SR9A 2YSPA 4F9AB 1X3CA
chains in the Genus database with same CATH topology
4R2EA 2EOMA 2EPPA 2EM9A 2YTFA 2CTDA 2NABA 2VRDA 2EOFA 2EMCA 1X5WA 4F6MA 2YRKA 2YU5A 1TN9A 2YTGA 2ELYA 5KL4A 3EPJA 3MHHC 3UK3C 1G2DC 1ZU1A 2EMZA 2GHFA 1F2IG 2WBUA 2EOXA 1NCSA 2DGCA 1G2FC 2EM2A 3M99B 1DGCA 1RMDA 2E72A 2EM4A 3EPLA 2GLIA 2D9HA 5KL3A 2EN2A 1BBOA 2DLQA 2EOYA 2LCEA 4R2RA 2WBTA 2EOOA 2YU8A 4FK5C 1A1LA 2EOHA 1X6EA 2EMXA 2YTEA 4R2CA 1A1GA 2HGHA 1JK2A 2EPCA 1TF6A 2DMIA 2ENHA 2EMIA 2EP3A 2EM6A 2YRHA 1BB8A 4X9JA 2YTPA 2EM8A 2DRPA 2DLKA 1UN6B 2EE8A 1UBDC 2EPZA 1YSAC 4R2AA 1Z1BA 2BB8A 2EOIA 1X6FA 1LLMC 2ELZA 1ZAAC 2EMWA 2EORA 2YRMA 4WSGA 3EPKA 2EL6A 5KL7A 2EJ4A 2RSIA 2EQ0A 2EMGA 2MKNA 2LV2A 4R2SA 2RPCA 2YTDA 2YTNA 2MKDA 4R2QA 1YUJA 1AAYA 1JK1A 1ZR9A 2EN3A 4R2PA 2PRTA 3MHSC 4M9VC 2EM3A 2LT7A 2EOQA 2WBSA 4F6NA 2JP9A 2ADRA 4IS1C 1A1IA 2EMLA 2YSOA 1KJKA 2EPUA 2LVHA 1P47A 2EMYA 2EQ1A 2J7JA 1TF3A 4F2JC 1X6HA 2EOJA 2YTIA 2EOSA 4GZNC 2EMHA 1MEYC 2R1FA 3EPHA 2EPXA 2YTQA 2EMKA 2YTOA 4IJDA 2EN7A 2EPRA 2LO3A 2EN4A 2CT1A 2EM0A 2YTJA 2EL4A 3VHTB 1A1KA 1WJPA 2M9AA 1A1FA 1A1HA 2EN1A 2EQ3A 2EL5A 5KL6A 2JPAA 2MDGA 2ENAA 2CSHA 5KL5A 1B69A 2EN8A 2ENCA 2EM5A 2EMBA 2I13A 5KL2A 2EOEA 4R2DA 2EPAA 2EMAA 2WCC3 2EN6A 1A1JA 1YUIA 2EOZA 2YSPA 2EMFA 2A25A 1X3CA 2EM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R2E A;  2EOM A;  2EPP A;  2EM9 A;  2YTF A;  2CTD A;  2NAB A;  2VRD A;  2EOF A;  2EMC A;  1X5W A;  4F6M A;  2YRK A;  2YU5 A;  1TN9 A;  2YTG A;  2ELY A;  5KL4 A;  3EPJ A;  3MHH C;  3UK3 C;  1G2D C;  1ZU1 A;  2EMZ A;  2GHF A;  1F2I G;  2WBU A;  2EOX A;  1NCS A;  2DGC A;  1G2F C;  2EM2 A;  3M99 B;  1DGC A;  1RMD A;  2E72 A;  2EM4 A;  3EPL A;  2GLI A;  2D9H A;  5KL3 A;  2EN2 A;  1BBO A;  2DLQ A;  2EOY A;  2LCE A;  4R2R A;  2WBT A;  2EOO A;  2YU8 A;  4FK5 C;  1A1L A;  2EOH A;  1X6E A;  2EMX A;  2YTE A;  4R2C A;  1A1G A;  2HGH A;  1JK2 A;  2EPC A;  1TF6 A;  2DMI A;  2ENH A;  2EMI A;  2EP3 A;  2EM6 A;  2YRH A;  1BB8 A;  4X9J A;  2YTP A;  2EM8 A;  2DRP A;  2DLK A;  1UN6 B;  2EE8 A;  1UBD C;  2EPZ A;  1YSA C;  4R2A A;  1Z1B A;  2BB8 A;  2EOI A;  1X6F A;  1LLM C;  2ELZ A;  1ZAA C;  2EMW A;  2EOR A;  2YRM A;  4WSG A;  3EPK A;  2EL6 A;  5KL7 A;  2EJ4 A;  2RSI A;  2EQ0 A;  2EMG A;  2MKN A;  2LV2 A;  4R2S A;  2RPC A;  2YTD A;  2YTN A;  2MKD A;  4R2Q A;  1YUJ A;  1AAY A;  1JK1 A;  1ZR9 A;  2EN3 A;  4R2P A;  2PRT A;  3MHS C;  4M9V C;  2EM3 A;  2LT7 A;  2EOQ A;  2WBS A;  4F6N A;  2JP9 A;  2ADR A;  4IS1 C;  1A1I A;  2EML A;  2YSO A;  1KJK A;  2EPU A;  2LVH A;  1P47 A;  2EMY A;  2EQ1 A;  2J7J A;  1TF3 A;  4F2J C;  1X6H A;  2EOJ A;  2YTI A;  2EOS A;  4GZN C;  2EMH A;  1MEY C;  2R1F A;  3EPH A;  2EPX A;  2YTQ A;  2EMK A;  2YTO A;  4IJD A;  2EN7 A;  2EPR A;  2LO3 A;  2EN4 A;  2CT1 A;  2EM0 A;  2YTJ A;  2EL4 A;  3VHT B;  1A1K A;  1WJP A;  2M9A A;  1A1F A;  1A1H A;  2EN1 A;  2EQ3 A;  2EL5 A;  5KL6 A;  2JPA A;  2MDG A;  2ENA A;  2CSH A;  5KL5 A;  1B69 A;  2EN8 A;  2ENC A;  2EM5 A;  2EMB A;  2I13 A;  5KL2 A;  2EOE A;  4R2D A;  2EPA A;  2EMA A;  2WCC 3;  2EN6 A;  1A1J A;  1YUI A;  2EOZ A;  2YSP A;  2EMF A;  2A25 A;  1X3C A;  2EM7 A; 
#chains in the Genus database with same CATH topology
 2UUC E;  2EM9 A;  3IWB A;  4BBY A;  5A69 A;  2G7H A;  1PJS A;  1HNX E;  3OTO E;  2WBU A;  4LF6 E;  3BID A;  3AV0 A;  2R76 A;  4BMJ A;  1O0W A;  1DGC A;  3VK6 A;  1XMQ E;  2DLQ A;  2EOY A;  4R2R A;  2EOO A;  4O5G A;  4DV3 E;  1GQE A;  2YTE A;  1N3G A;  1WRJ A;  1A1G A;  2ENH A;  2EMI A;  2RS6 A;  3JU0 A;  4JI7 E;  2LJU A;  2YTP A;  1YPN A;  2F4V E;  1T4N A;  4BC7 A;  2EPZ A;  5A6B A;  1YZ9 A;  1X6F A;  4OOG C;  2ELZ A;  3L00 A;  1ZAA C;  2Q8U A;  2B3T B;  3EPK A;  2ZM6 E;  5KL7 A;  2KOU A;  4NZV A;  5A6A A;  1RC7 A;  2LV2 A;  2M4I A;  4DKK A;  4M0V A;  4R2Q A;  4NHR A;  1IQO A;  5TSE A;  4LFB E;  1DQ3 A;  4BHC A;  2YZT A;  3F6G A;  2JWO A;  2ADR A;  1A1I A;  2LVH A;  3QG5 C;  1I94 E;  1P47 A;  4DUY E;  4X66 E;  4HEI A;  3ZOQ B;  4ZYG A;  4F2J C;  2E5L E;  4LU9 A;  2EMH A;  3KZY A;  2JXP A;  1MEY C;  2R1F A;  1X49 A;  4HTG A;  2EMK A;  2YTO A;  4IJD A;  2FTX B;  2UUB E;  5F3W A;  2UXB E;  3TQM A;  2EM0 A;  2VF1 A;  2EL4 A;  3MSW A;  5LLQ A;  4YY3 E;  2JOX A;  4F9C B;  2RQL A;  3T1H E;  4JV5 E;  2KON A;  3BGH A;  2EQ3 A;  3C4B A;  2EL5 A;  1IQS A;  2JYA A;  2IHR 1;  1HR0 E;  5A6K A;  3FIG A;  2EMB A;  3BBG A;  2HJJ A;  1YFH A;  4WPY A;  2EOZ A;  4NXM E;  2LJH A;  4R03 A;  1QU6 A;  4KWY A;  2ODR D;  1GZ6 A;  2NAB A;  4WSP A;  2EOF A;  3JTZ A;  2KHX A;  1X5W A;  4F6M A;  4DR2 E;  1TN9 A;  2YTG A;  5KL4 A;  3UK3 C;  3MHH C;  3J81 C;  1UIL A;  2EOX A;  1NCS A;  2V88 A;  4P7D A;  3AUZ A;  3OML A;  5AE2 A;  3EPL A;  1BBO A;  2WBT A;  1FKA E;  4X62 E;  4I8O A;  2EOH A;  1X6E A;  5A6J A;  2DMY A;  2EMX A;  2M1S A;  4R2C A;  2EPC A;  1TF6 A;  2YRH A;  2EM8 A;  2DLK A;  2VQF E;  2YPN A;  1UBD C;  3P1X A;  2JVA A;  4O4K A;  1Z1B A;  5AE3 A;  2EOI A;  2V87 A;  2LMZ A;  1WHN A;  4OX9 E;  2YRM A;  1YYW A;  2V8Q B;  2NUF A;  2RSI A;  5T6J A;  2EPM X;  2I9I A;  2M7Q A;  2EMG A;  4JI8 E;  5IWA E;  4R2S A;  2YTN A;  2MKD A;  1YUJ A;  2WZO A;  5ADZ A;  1AAY A;  2EN3 A;  3EQ1 A;  4L5N C;  3C6K A;  4WX9 A;  5AE1 A;  4M9V C;  2WBS A;  3BF2 A;  1DI2 A;  4IS1 C;  4X8W A;  5FLX C;  2L3C A;  4F54 A;  4LTY A;  2B9D A;  2J7J A;  3ADG A;  4DMI A;  4LFA E;  1QNT A;  1X6H A;  3HTX A;  2RTX A;  4R8O A;  4GZN C;  1PKP A;  4ZYH A;  3EPH A;  2EPX A;  3J7Y p;  4DUZ E;  4JYA E;  3C6M A;  2EN4 A;  2CT1 A;  5IV8 B;  3ADJ A;  2NUG A;  1A1H A;  5AC5 A;  4X65 E;  2RSM A;  5KL6 A;  2JPA A;  2MDG A;  3KZZ A;  4J8Z A;  5BR8 E;  1HNW E;  3THN A;  4O43 A;  1T38 A;  1B69 A;  3J7A G;  2ENC A;  5A6B D;  1AH5 A;  4R2D A;  1GTK A;  2EPA A;  2WCC 3;  1A1J A;  1YUI A;  2EPN A;  2YWQ A;  2EMF A;  2A25 A;  2RS7 A;  3DJW A;  4R2E A;  2E1M A;  2LUQ A;  4JI4 E;  2EOM A;  4YHH E;  4DV1 E;  4JI6 E;  1NEI A;  2CTD A;  3DF6 A;  2YRK A;  2YU5 A;  2ELY A;  3EPJ A;  2L92 A;  1G2F C;  3JAM C;  2EM2 A;  2L2N A;  4JI0 E;  4M2Z A;  1WHQ A;  2GLI A;  1L4S A;  5KL3 A;  2EN2 A;  2LRS A;  2LCE A;  4DR4 E;  2JY9 A;  1A1L A;  2V85 A;  4KZS A;  2LBS B;  4K0K E;  4WYQ B;  4GKJ E;  4LF7 E;  2DMI A;  4DV5 E;  1BB8 A;  2EM6 A;  1XNQ E;  4RH8 A;  5AC4 A;  5AAS A;  2L2K B;  1X48 A;  2V89 A;  1UN6 B;  1MGT A;  3IWC A;  1N36 E;  1YSA C;  2HHH E;  2GPI A;  1HNZ E;  2BB8 A;  1J26 A;  2EMW A;  2VQE E;  2EOR A;  4ZYD A;  3C4T A;  3K6Q A;  2EL6 A;  2EJ4 A;  2YT4 A;  2EQ0 A;  2MKN A;  2RPC A;  2YTD A;  1WXR A;  4B3S E;  1FJG E;  4P78 A;  1T4O A;  1ZR9 A;  3THO B;  1JK1 A;  4R2P A;  4LF9 E;  2EM3 A;  2LT7 A;  2EOQ A;  4NXN E;  4F6N A;  2EML A;  2L8T A;  2YSO A;  4DR3 E;  1N33 E;  4N4R B;  1KJK A;  3VYX A;  2EMY A;  1T39 A;  4JI5 E;  2DSY A;  2DB2 A;  2EPO A;  2K4V A;  1YYK A;  4LF4 E;  2N3G A;  2L33 A;  2YTQ A;  4B3R E;  4DV2 E;  4DR5 E;  5LMN E;  4X64 E;  2YTJ A;  3VHT B;  1A1K A;  1WJP A;  1IBK E;  1ZBQ A;  2B7V A;  2UXC E;  3ECR A;  4RHB B;  5CFF E;  4O24 A;  2MC6 A;  2EN1 A;  2FV4 B;  4WXD A;  1XMO E;  2JR1 A;  3ADL A;  2FGG A;  4KHP E;  5KL5 A;  4WXC A;  2L2M A;  2V83 A;  2I13 A;  5KL2 A;  4BHB A;  5IT9 C;  1IBM E;  3RMP A;  1J5E E;  2MDR A;  2NUE A;  2CPN A;  4MLV A;  1T4L B;  3LML A;  2EM7 A;  2L6M A;  4M30 A;  2EPP A;  1KYQ A;  2H36 X;  2YTF A;  2VRD A;  4DR6 E;  3IWD A;  4DV7 E;  2EMC A;  4AQY E;  4Q35 B;  2JOB A;  3T1Y E;  4LFC E;  3ADI A;  2UXD E;  4TUG A;  1G2D C;  1ZU1 A;  2EMZ A;  2GHF A;  5DNY A;  1F2I G;  2DIX A;  4MLQ A;  3H09 A;  4JI2 E;  2DGC A;  1EH7 A;  2BBG A;  4GKK E;  3M99 B;  5IXM B;  1RMD A;  2E72 A;  2LUP B;  1N34 E;  2EM4 A;  4L8N A;  4BC9 A;  2D9H A;  1N32 E;  2ODR C;  2EPL X;  4JI3 E;  2EZ6 A;  2UUA E;  2YU8 A;  4FK5 C;  5LL6 R;  2LE2 A;  4DV0 E;  4Q28 A;  5A2Q C;  2HGH A;  1IMU A;  1JK2 A;  1UHZ A;  3HPS A;  1PDA A;  1EKZ A;  2EP3 A;  4X9J A;  2DRP A;  2EE8 A;  4B3M E;  2UU9 E;  2LTS A;  4DV4 E;  4R2A A;  2N3H A;  1STU A;  5LMU E;  1LLM C;  2LTR A;  4B3T E;  3LLH A;  4WSG A;  2MC5 A;  3KWR A;  1EH8 A;  2N8X A;  4ZYE A;  1SFE A;  3J80 C;  1RQ0 A;  2PRT A;  3MHS C;  2L3J A;  3F6H A;  4LF5 E;  1ZBT A;  2EPK X;  2JP9 A;  4DV6 E;  3VYY A;  1PJT A;  2K7I A;  2EPU A;  2EQ1 A;  1PJQ A;  1TF3 A;  3HPZ A;  1YYO A;  2EOJ A;  2VE7 C;  2YTI A;  4F9B B;  2EOS A;  1XNR E;  4BS9 A;  3HXL A;  2EN7 A;  2EPR A;  2LO3 A;  2NA2 A;  3HQ1 A;  2M9A A;  2F8B A;  1A1F A;  1EH6 A;  2V86 A;  4GEQ B;  2B7T A;  1X47 A;  4WFT A;  2HC5 A;  1IBL E;  4TUI A;  4DR7 E;  2ENA A;  2CSH A;  4DR1 E;  4BCA A;  4JI1 E;  2EN8 A;  4LF8 E;  2EM5 A;  2EWL A;  2EOE A;  1BBG A;  2EMA A;  2EN6 A;  1SR9 A;  2YSP A;  4F9A B;  1X3C A; 
#chains in the Genus database with same CATH homology
 4R2E A;  2EOM A;  2EPP A;  2EM9 A;  2YTF A;  2CTD A;  2NAB A;  2VRD A;  2EOF A;  2EMC A;  1X5W A;  4F6M A;  2YRK A;  2YU5 A;  1TN9 A;  2YTG A;  2ELY A;  5KL4 A;  3EPJ A;  3MHH C;  3UK3 C;  1G2D C;  1ZU1 A;  2EMZ A;  2GHF A;  1F2I G;  2WBU A;  2EOX A;  1NCS A;  2DGC A;  1G2F C;  2EM2 A;  3M99 B;  1DGC A;  1RMD A;  2E72 A;  2EM4 A;  3EPL A;  2GLI A;  2D9H A;  5KL3 A;  2EN2 A;  1BBO A;  2DLQ A;  2EOY A;  2LCE A;  4R2R A;  2WBT A;  2EOO A;  2YU8 A;  4FK5 C;  1A1L A;  2EOH A;  1X6E A;  2EMX A;  2YTE A;  4R2C A;  1A1G A;  2HGH A;  1JK2 A;  2EPC A;  1TF6 A;  2DMI A;  2ENH A;  2EMI A;  2EP3 A;  2EM6 A;  2YRH A;  1BB8 A;  4X9J A;  2YTP A;  2EM8 A;  2DRP A;  2DLK A;  1UN6 B;  2EE8 A;  1UBD C;  2EPZ A;  1YSA C;  4R2A A;  1Z1B A;  2BB8 A;  2EOI A;  1X6F A;  1LLM C;  2ELZ A;  1ZAA C;  2EMW A;  2EOR A;  2YRM A;  4WSG A;  3EPK A;  2EL6 A;  5KL7 A;  2EJ4 A;  2RSI A;  2EQ0 A;  2EMG A;  2MKN A;  2LV2 A;  4R2S A;  2RPC A;  2YTD A;  2YTN A;  2MKD A;  4R2Q A;  1YUJ A;  1AAY A;  1JK1 A;  1ZR9 A;  2EN3 A;  4R2P A;  2PRT A;  3MHS C;  4M9V C;  2EM3 A;  2LT7 A;  2EOQ A;  2WBS A;  4F6N A;  2JP9 A;  2ADR A;  4IS1 C;  1A1I A;  2EML A;  2YSO A;  1KJK A;  2EPU A;  2LVH A;  1P47 A;  2EMY A;  2EQ1 A;  2J7J A;  1TF3 A;  4F2J C;  1X6H A;  2EOJ A;  2YTI A;  2EOS A;  4GZN C;  2EMH A;  1MEY C;  2R1F A;  3EPH A;  2EPX A;  2YTQ A;  2EMK A;  2YTO A;  4IJD A;  2EN7 A;  2EPR A;  2LO3 A;  2EN4 A;  2CT1 A;  2EM0 A;  2YTJ A;  2EL4 A;  3VHT B;  1A1K A;  1WJP A;  2M9A A;  1A1F A;  1A1H A;  2EN1 A;  2EQ3 A;  2EL5 A;  5KL6 A;  2JPA A;  2MDG A;  2ENA A;  2CSH A;  5KL5 A;  1B69 A;  2EN8 A;  2ENC A;  2EM5 A;  2EMB A;  2I13 A;  5KL2 A;  2EOE A;  4R2D A;  2EPA A;  2EMA A;  2WCC 3;  2EN6 A;  1A1J A;  1YUI A;  2EOZ A;  2YSP A;  2EMF A;  2A25 A;  1X3C A;  2EM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...