1UN6B

The crystal structure of a zinc finger - rna complex reveals two modes of molecular recognition
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
86
structure length
86
Chain Sequence
MYVCHFENCGKAFKKHNQLKVHQFSHTQQLPYECPHEGCDKRFSLPSRLKRHEKVHAGYPCKKDDSCSFVGKTWTLYLKHVAECHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna-binding protein/rna
molecule keywords TRANSCRIPTION FACTOR IIIA
publication title Crystal Structure of a Zinc-Finger-RNA Complex Reveals Two Modes of Molecular Recognition
pubmed doi rcsb
source organism Xenopus laevis
total genus 25
structure length 86
sequence length 86
chains with identical sequence C, D
ec nomenclature
pdb deposition date 2003-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1un6B02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1un6B01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1un6B03
2WBSA 2DLKA 2RSIA 2HGHA 1A1KA 1WJPA 2EMYA 2WCC3 1F2IG 2EE8A 2YU8A 1G2DC 3MHHC 2DRPA 2EMWA 1A1GA 2M9AA 2EPUA 2EPZA 2YTIA 2LO3A 2JP9A 2CT1A 2EPRA 2EMXA 5KL6A 2YTNA 3VHTB 2EM8A 4IJDA 2MKNA 2EOIA 2EM5A 2RPCA 1YUJA 2EOSA 2EPPA 5KL4A 2A25A 3UK3C 4R2RA 2YRKA 2EOFA 2YTOA 2EORA 2E72A 2EQ0A 3EPKA 2EM4A 1A1JA 2EM0A 2EPAA 1TF6A 3M99B 2EJ4A 2WBTA 1X5WA 1BB8A 2EQ1A 1P47A 1TF3A 4F6MA 2LT7A 2PRTA 2CSHA 2EN2A 2EM2A 1JK1A 4M9VC 4R2SA 2EM6A 2EOZA 2EMBA 2EMCA 2DMIA 1AAYA 2EL4A 1UN6B 2CTDA 2YTPA 2EN8A 2EMIA 2YRMA 1X3CA 1TN9A 1DGCA 1A1FA 2LVHA 2EOQA 1YSAC 2D9HA 2YSOA 1A1LA 1ZU1A 4R2DA 2YTDA 2EMLA 2YU5A 2YSPA 1X6HA 2EPCA 2WBUA 2I13A 1BBOA 2EM3A 2ADRA 1X6EA 2DLQA 2EMKA 2EN3A 2EN1A 2EOHA 4R2CA 5KL5A 1ZR9A 5KL2A 4F6NA 1MEYC 2GLIA 5KL7A 2EP3A 2EM7A 4R2EA 1YUIA 2LCEA 4GZNC 2EN6A 2EL6A 2ELYA 1JK2A 3EPJA 2YTGA 2EOYA 1B69A 2EMZA 2YTJA 1A1IA 2EPXA 2EMHA 4R2QA 2EMAA 1KJKA 2J7JA 2ENHA 2R1FA 2DGCA 2GHFA 2ELZA 1NCSA 2YRHA 2YTQA 5KL3A 4R2PA 1A1HA 1G2FC 2JPAA 2EM9A 2EOOA 2EOXA 2EOMA 4WSGA 2EQ3A 3EPHA 4R2AA 2MKDA 4X9JA 4F2JC 2BB8A 3EPLA 4FK5C 2YTFA 2ENAA 1UBDC 2EMFA 1X6FA 2MDGA 2EL5A 1LLMC 2EN7A 2EN4A 1RMDA 2YTEA 4IS1C 2EOJA 2ENCA 2NABA 2EMGA 2VRDA 3MHSC 2LV2A 1Z1BA 2EOEA 1ZAAC
chains in the Genus database with same CATH superfamily
2RSIA 1F2IG 2EE8A 1RQ0A 1NEIA 3C4BA 3IWCA 1G2DC 3KWRA 2EMWA 2EPUA 2EPZA 1BBGA 4GKJE 2UXCE 2YTNA 1GQEA 4LF4E 3THNA 1I94E 2NA2A 5KL4A 2JXPA 2VE7C 3KZZA 1FJGE 1XNQE 4P78A 2EORA 4BMJA 2JOXA 1YYWA 1A1JA 1IBME 2EM0A 2EPAA 3BIDA 3M99B 2WBTA 4GKKE 2YT4A 1P47A 3ZOQB 4YY3E 2VQFE 4F6MA 2LT7A 2R76A 3AUZA 2EN2A 1WRJA 2EM2A 2L33A 4JI0E 3ADIA 1HNWE 4WSPA 2EMCA 1AAYA 1UN6B 4DR2E 2MC5A 2YRMA 1X3CA 4M30A 4LFCE 4YHHE 2EOQA 1YSAC 1YFHA 2D9HA 1YYOA 1X49A 2V87A 2Q8UA 2FGGA 4RH8A 3J7AG 2EPCA 5A6BD 4Q28A 2GLIA 5KL7A 2EP3A 2B9DA 1JK2A 3T1YE 2EL6A 4WPYA 5DNYA 4WYQB 1A1IA 1WXRA 2I9IA 2EMHA 4LF8E 2L2MA 1T38A 1QNTA 4BC7A 2F4VE 2R1FA 2EPMX 2YRHA 2JPAA 2KHXA 3C6KA 2EOOA 4X64E 2HJJA 4M0VA 2WZOA 3F6HA 3ADGA 4R2AA 1IBKE 4BC9A 1N32E 3HTXA 2YTFA 4DUZE 1WHQA 2L6MA 1UBDC 2RQLA 4JI6E 2EL5A 2JOBA 4L8NA 2EN4A 2MDRA 5A2QC 3THOB 2EOJA 2LRSA 3VYYA 2KOUA 3MHSC 4WXCA 5AE3A 2IHR1 2EMFA 5LMUE 1T4OA 2DLKA 4DV2E 2HGHA 4BCAA 4DR6E 4LFBE 4DV7E 4BHBA 2FTXB 4TUGA 4JYAE 3HQ1A 2JYAA 2LO3A 1KYQA 2CT1A 4RHBB 4DR7E 3FIGA 4WX9A 4AQYE 1HNZE 2EM5A 2MKNA 2RPCA 3UK3C 5A6BA 2B7VA 4X65E 2MC6A 2E72A 4J8ZA 1HNXE 3AV0A 1TF6A 4JI2E 3ADJA 3MSWA 3QG5C 1X5WA 4B3RE 1BB8A 2EQ1A 2E5LE 1ZBQA 1IMUA 2PRTA 4F54A 4OOGC 3HPSA 4JI5E 2LUPB 1JK1A 2UU9E 4F9CB 2YWQA 4DR1E 2HHHE 1HR0E 2M1SA 2YTPA 3KZYA 4M2ZA 2EMIA 1XMQE 1DGCA 4TUIA 2YSOA 4DV6E 2F8BA 4R2DA 2YU5A 2EZ6A 2I13A 4LF6E 4DMIA 4X62E 2EMKA 2YPNA 2EN1A 2EOHA 5KL5A 4B3ME 1MEYC 4F6NA 1RC7A 2G7HA 4DKKA 2EM7A 2NUEA 2JVAA 3JAMC 1DQ3A 2UUBE 1YPNA 2ELYA 1WHNA 2LJUA 3EPJA 4O43A 2LTRA 2LUQA 4R2QA 2EMAA 4R8OA 2RSMA 2ENHA 1J26A 5AASA 2GHFA 2ELZA 1NCSA 5KL3A 4WSGA 2EQ3A 3EPHA 4LFAE 2DIXA 2UUAE 1PJTA 3EPLA 4FK5C 2ODRD 2LJHA 2ENAA 4KWYA 4B3TE 2L3CA 4LF5E 2JWOA 2VQEE 4OX9E 5CFFE 4IS1C 2UXDE 4DR3E 4P7DA 2ODRC 4F9BB 4O5GA 1PKPA 2ENCA 4LTYA 4K0KE 1SR9A 4ZYEA 4DV5E 4DUYE 1ZAAC 3DJWA 2WBSA 2NUFA 1A1KA 1WJPA 2L8TA 2H36X 5TSEA 4B3SE 2RS7A 3MHHC 1ZBTA 5KL6A 2EMXA 2EM8A 2B3TB 5IV8B 3OTOE 1YUJA 2EOSA 1PJSA 2YRKA 2KONA 2EOFA 2YTOA 1YYKA 2EQ0A 2EM4A 4BBYA 3VYXA 4DV1E 4LF7E 2DSYA 1EH8A 1TF3A 2EPNA 1J5EE 5ADZA 2LBSB 2CSHA 2V8QB 1T4LB 2M4IA 4MLVA 4MLQA 4M9VC 2LMZA 3C6MA 2EM6A 4JI3E 2V85A 2DMIA 4DV0E 1N34E 2EN8A 2EWLA 1EH7A 1TN9A 1A1FA 2LVHA 4GEQB 2EPKX 1QU6A 3ECRA 4JI1E 2N8XA 3HPZA 2LE2A 4HTGA 2YSPA 1BBOA 1UILA 2EM3A 1N3GA 2ADRA 1X6EA 2DLQA 2EN3A 4R2CA 1X47A 1ZR9A 5KL2A 1YUIA 4JI8E 2B7TA 4GZNC 2EN6A 2N3GA 3T1HE 1UHZA 4L5NC 3BBGA 2YTGA 4LF9E 5LL6R 1B69A 2EMZA 2YTJA 3HXLA 3J81C 2L3JA 4N4RB 4I8OA 2GPIA 3DF6A 1PJQA 5AC4A 2YTQA 2M7QA 4R2PA 1GTKA 1A1HA 1G2FC 2EM9A 2EOMA 5IWAE 3H09A 1AH5A 2BB8A 2ZM6E 1SFEA 2FV4B 1X6FA 2MDGA 3LMLA 1LLMC 2E1MA 4KHPE 3K6QA 2YTEA 2LTSA 2YZTA 2NABA 2VRDA 2EMGA 4JI7E 2BBGA 2EMYA 2WCC3 5AC5A 2YU8A 4KZSA 5BR8E 2V88A 4DR4E 4ZYDA 2DRPA 3IWDA 2M9AA 2L2KB 1A1GA 2YTIA 3BGHA 2JP9A 2EPRA 3VHTB 2N3HA 4IJDA 2EOIA 2EPOA 3JU0A 1XMOE 3IWBA 2EPPA 1IQOA 2A25A 1T39A 4R2RA 4NXNE 3EPKA 5T6JA 1YZ9A 1GZ6A 3OMLA 1EKZA 2RTXA 4HEIA 3C4TA 2CPNA 2EJ4A 4O24A 3J7Yp 1N36E 5IXMB 1PDAA 3P1XA 1MGTA 2DB2A 1XNRE 3JTZA 4R2SA 2EOZA 2EMBA 2NUGA 2EL4A 1N33E 2CTDA 1X48A 3TQMA 5A6JA 2V89A 4Q35B 5LLQA 2V83A 1IBLE 4JI4E 2VF1A 4NZVA 4NXME 1A1LA 4WXDA 1ZU1A 4O4KA 4ZYHA 2YTDA 4X66E 2EMLA 1X6HA 4R03A 2WBUA 5A6KA 4DV4E 3RMPA 2K7IA 4LU9A 4R2EA 1EH6A 5IT9C 2LCEA 5F3WA 5AE2A 5LMNE 2EOYA 2UUCE 1IQSA 2HC5A 2EPXA 1KJKA 2J7JA 4ZYGA 1DI2A 4F9AB 3BF2A 4BHCA 5A69A 3L00A 1STUA 2DGCA 2V86A 1O0WA 4DR5E 4JV5E 2EOXA 2L92A 1T4NA 4BS9A 2MKDA 4X9JA 2UXBE 4F2JC 3EQ1A 4WFTA 1L4SA 3ADLA 3F6GA 5A6AA 3VK6A 1FKAE 2RS6A 3LLHA 2JR1A 2EPLX 3J80C 2EN7A 2L2NA 1RMDA 2DMYA 4X8WA 4NHRA 2JY9A 4DV3E 2LV2A 5AE1A 5FLXC 1Z1BA 2K4VA 2EOEA
chains in the Genus database with same CATH topology
2WBSA 2DLKA 2RSIA 2HGHA 1A1KA 1WJPA 2EMYA 2WCC3 1F2IG 2EE8A 2YU8A 1G2DC 3MHHC 2DRPA 2EMWA 1A1GA 2M9AA 2EPUA 2EPZA 2YTIA 2LO3A 2JP9A 2CT1A 2EPRA 2EMXA 5KL6A 2YTNA 3VHTB 2EM8A 4IJDA 2MKNA 2EOIA 2EM5A 2RPCA 1YUJA 2EOSA 2EPPA 5KL4A 2A25A 3UK3C 4R2RA 2YRKA 2EOFA 2YTOA 2EORA 2E72A 2EQ0A 3EPKA 2EM4A 1A1JA 2EM0A 2EPAA 1TF6A 3M99B 2EJ4A 2WBTA 1X5WA 1BB8A 2EQ1A 1P47A 1TF3A 4F6MA 2LT7A 2PRTA 2CSHA 2EN2A 2EM2A 1JK1A 4M9VC 4R2SA 2EM6A 2EOZA 2EMBA 2EMCA 2DMIA 1AAYA 2EL4A 1UN6B 2CTDA 2YTPA 2EN8A 2EMIA 2YRMA 1X3CA 1TN9A 1DGCA 1A1FA 2LVHA 2EOQA 1YSAC 2D9HA 2YSOA 1A1LA 1ZU1A 4R2DA 2YTDA 2EMLA 2YU5A 2YSPA 1X6HA 2EPCA 2WBUA 2I13A 1BBOA 2EM3A 2ADRA 1X6EA 2DLQA 2EMKA 2EN3A 2EN1A 2EOHA 4R2CA 5KL5A 1ZR9A 5KL2A 4F6NA 1MEYC 2GLIA 5KL7A 2EP3A 2EM7A 4R2EA 1YUIA 2LCEA 4GZNC 2EN6A 2EL6A 2ELYA 1JK2A 3EPJA 2YTGA 2EOYA 1B69A 2EMZA 2YTJA 1A1IA 2EPXA 2EMHA 4R2QA 2EMAA 1KJKA 2J7JA 2ENHA 2R1FA 2DGCA 2GHFA 2ELZA 1NCSA 2YRHA 2YTQA 5KL3A 4R2PA 1A1HA 1G2FC 2JPAA 2EM9A 2EOOA 2EOXA 2EOMA 4WSGA 2EQ3A 3EPHA 4R2AA 2MKDA 4X9JA 4F2JC 2BB8A 3EPLA 4FK5C 2YTFA 2ENAA 1UBDC 2EMFA 1X6FA 2MDGA 2EL5A 1LLMC 2EN7A 2EN4A 1RMDA 2YTEA 4IS1C 2EOJA 2ENCA 2NABA 2EMGA 2VRDA 3MHSC 2LV2A 1Z1BA 2EOEA 1ZAAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WBS A;  2DLK A;  2RSI A;  2HGH A;  1A1K A;  1WJP A;  2EMY A;  2WCC 3;  1F2I G;  2EE8 A;  2YU8 A;  1G2D C;  3MHH C;  2DRP A;  2EMW A;  1A1G A;  2M9A A;  2EPU A;  2EPZ A;  2YTI A;  2LO3 A;  2JP9 A;  2CT1 A;  2EPR A;  2EMX A;  5KL6 A;  2YTN A;  3VHT B;  2EM8 A;  4IJD A;  2MKN A;  2EOI A;  2EM5 A;  2RPC A;  1YUJ A;  2EOS A;  2EPP A;  5KL4 A;  2A25 A;  3UK3 C;  4R2R A;  2YRK A;  2EOF A;  2YTO A;  2EOR A;  2E72 A;  2EQ0 A;  3EPK A;  2EM4 A;  1A1J A;  2EM0 A;  2EPA A;  1TF6 A;  3M99 B;  2EJ4 A;  2WBT A;  1X5W A;  1BB8 A;  2EQ1 A;  1P47 A;  1TF3 A;  4F6M A;  2LT7 A;  2PRT A;  2CSH A;  2EN2 A;  2EM2 A;  1JK1 A;  4M9V C;  4R2S A;  2EM6 A;  2EOZ A;  2EMB A;  2EMC A;  2DMI A;  1AAY A;  2EL4 A;  1UN6 B;  2CTD A;  2YTP A;  2EN8 A;  2EMI A;  2YRM A;  1X3C A;  1TN9 A;  1DGC A;  1A1F A;  2LVH A;  2EOQ A;  1YSA C;  2D9H A;  2YSO A;  1A1L A;  1ZU1 A;  4R2D A;  2YTD A;  2EML A;  2YU5 A;  2YSP A;  1X6H A;  2EPC A;  2WBU A;  2I13 A;  1BBO A;  2EM3 A;  2ADR A;  1X6E A;  2DLQ A;  2EMK A;  2EN3 A;  2EN1 A;  2EOH A;  4R2C A;  5KL5 A;  1ZR9 A;  5KL2 A;  4F6N A;  1MEY C;  2GLI A;  5KL7 A;  2EP3 A;  2EM7 A;  4R2E A;  1YUI A;  2LCE A;  4GZN C;  2EN6 A;  2EL6 A;  2ELY A;  1JK2 A;  3EPJ A;  2YTG A;  2EOY A;  1B69 A;  2EMZ A;  2YTJ A;  1A1I A;  2EPX A;  2EMH A;  4R2Q A;  2EMA A;  1KJK A;  2J7J A;  2ENH A;  2R1F A;  2DGC A;  2GHF A;  2ELZ A;  1NCS A;  2YRH A;  2YTQ A;  5KL3 A;  4R2P A;  1A1H A;  1G2F C;  2JPA A;  2EM9 A;  2EOO A;  2EOX A;  2EOM A;  4WSG A;  2EQ3 A;  3EPH A;  4R2A A;  2MKD A;  4X9J A;  4F2J C;  2BB8 A;  3EPL A;  4FK5 C;  2YTF A;  2ENA A;  1UBD C;  2EMF A;  1X6F A;  2MDG A;  2EL5 A;  1LLM C;  2EN7 A;  2EN4 A;  1RMD A;  2YTE A;  4IS1 C;  2EOJ A;  2ENC A;  2NAB A;  2EMG A;  2VRD A;  3MHS C;  2LV2 A;  1Z1B A;  2EOE A;  1ZAA C; 
#chains in the Genus database with same CATH topology
 2RSI A;  1F2I G;  2EE8 A;  1RQ0 A;  1NEI A;  3C4B A;  3IWC A;  1G2D C;  3KWR A;  2EMW A;  2EPU A;  2EPZ A;  1BBG A;  4GKJ E;  2UXC E;  2YTN A;  1GQE A;  4LF4 E;  3THN A;  1I94 E;  2NA2 A;  5KL4 A;  2JXP A;  2VE7 C;  3KZZ A;  1FJG E;  1XNQ E;  4P78 A;  2EOR A;  4BMJ A;  2JOX A;  1YYW A;  1A1J A;  1IBM E;  2EM0 A;  2EPA A;  3BID A;  3M99 B;  2WBT A;  4GKK E;  2YT4 A;  1P47 A;  3ZOQ B;  4YY3 E;  2VQF E;  4F6M A;  2LT7 A;  2R76 A;  3AUZ A;  2EN2 A;  1WRJ A;  2EM2 A;  2L33 A;  4JI0 E;  3ADI A;  1HNW E;  4WSP A;  2EMC A;  1AAY A;  1UN6 B;  4DR2 E;  2MC5 A;  2YRM A;  1X3C A;  4M30 A;  4LFC E;  4YHH E;  2EOQ A;  1YSA C;  1YFH A;  2D9H A;  1YYO A;  1X49 A;  2V87 A;  2Q8U A;  2FGG A;  4RH8 A;  3J7A G;  2EPC A;  5A6B D;  4Q28 A;  2GLI A;  5KL7 A;  2EP3 A;  2B9D A;  1JK2 A;  3T1Y E;  2EL6 A;  4WPY A;  5DNY A;  4WYQ B;  1A1I A;  1WXR A;  2I9I A;  2EMH A;  4LF8 E;  2L2M A;  1T38 A;  1QNT A;  4BC7 A;  2F4V E;  2R1F A;  2EPM X;  2YRH A;  2JPA A;  2KHX A;  3C6K A;  2EOO A;  4X64 E;  2HJJ A;  4M0V A;  2WZO A;  3F6H A;  3ADG A;  4R2A A;  1IBK E;  4BC9 A;  1N32 E;  3HTX A;  2YTF A;  4DUZ E;  1WHQ A;  2L6M A;  1UBD C;  2RQL A;  4JI6 E;  2EL5 A;  2JOB A;  4L8N A;  2EN4 A;  2MDR A;  5A2Q C;  3THO B;  2EOJ A;  2LRS A;  3VYY A;  2KOU A;  3MHS C;  4WXC A;  5AE3 A;  2IHR 1;  2EMF A;  5LMU E;  1T4O A;  2DLK A;  4DV2 E;  2HGH A;  4BCA A;  4DR6 E;  4LFB E;  4DV7 E;  4BHB A;  2FTX B;  4TUG A;  4JYA E;  3HQ1 A;  2JYA A;  2LO3 A;  1KYQ A;  2CT1 A;  4RHB B;  4DR7 E;  3FIG A;  4WX9 A;  4AQY E;  1HNZ E;  2EM5 A;  2MKN A;  2RPC A;  3UK3 C;  5A6B A;  2B7V A;  4X65 E;  2MC6 A;  2E72 A;  4J8Z A;  1HNX E;  3AV0 A;  1TF6 A;  4JI2 E;  3ADJ A;  3MSW A;  3QG5 C;  1X5W A;  4B3R E;  1BB8 A;  2EQ1 A;  2E5L E;  1ZBQ A;  1IMU A;  2PRT A;  4F54 A;  4OOG C;  3HPS A;  4JI5 E;  2LUP B;  1JK1 A;  2UU9 E;  4F9C B;  2YWQ A;  4DR1 E;  2HHH E;  1HR0 E;  2M1S A;  2YTP A;  3KZY A;  4M2Z A;  2EMI A;  1XMQ E;  1DGC A;  4TUI A;  2YSO A;  4DV6 E;  2F8B A;  4R2D A;  2YU5 A;  2EZ6 A;  2I13 A;  4LF6 E;  4DMI A;  4X62 E;  2EMK A;  2YPN A;  2EN1 A;  2EOH A;  5KL5 A;  4B3M E;  1MEY C;  4F6N A;  1RC7 A;  2G7H A;  4DKK A;  2EM7 A;  2NUE A;  2JVA A;  3JAM C;  1DQ3 A;  2UUB E;  1YPN A;  2ELY A;  1WHN A;  2LJU A;  3EPJ A;  4O43 A;  2LTR A;  2LUQ A;  4R2Q A;  2EMA A;  4R8O A;  2RSM A;  2ENH A;  1J26 A;  5AAS A;  2GHF A;  2ELZ A;  1NCS A;  5KL3 A;  4WSG A;  2EQ3 A;  3EPH A;  4LFA E;  2DIX A;  2UUA E;  1PJT A;  3EPL A;  4FK5 C;  2ODR D;  2LJH A;  2ENA A;  4KWY A;  4B3T E;  2L3C A;  4LF5 E;  2JWO A;  2VQE E;  4OX9 E;  5CFF E;  4IS1 C;  2UXD E;  4DR3 E;  4P7D A;  2ODR C;  4F9B B;  4O5G A;  1PKP A;  2ENC A;  4LTY A;  4K0K E;  1SR9 A;  4ZYE A;  4DV5 E;  4DUY E;  1ZAA C;  3DJW A;  2WBS A;  2NUF A;  1A1K A;  1WJP A;  2L8T A;  2H36 X;  5TSE A;  4B3S E;  2RS7 A;  3MHH C;  1ZBT A;  5KL6 A;  2EMX A;  2EM8 A;  2B3T B;  5IV8 B;  3OTO E;  1YUJ A;  2EOS A;  1PJS A;  2YRK A;  2KON A;  2EOF A;  2YTO A;  1YYK A;  2EQ0 A;  2EM4 A;  4BBY A;  3VYX A;  4DV1 E;  4LF7 E;  2DSY A;  1EH8 A;  1TF3 A;  2EPN A;  1J5E E;  5ADZ A;  2LBS B;  2CSH A;  2V8Q B;  1T4L B;  2M4I A;  4MLV A;  4MLQ A;  4M9V C;  2LMZ A;  3C6M A;  2EM6 A;  4JI3 E;  2V85 A;  2DMI A;  4DV0 E;  1N34 E;  2EN8 A;  2EWL A;  1EH7 A;  1TN9 A;  1A1F A;  2LVH A;  4GEQ B;  2EPK X;  1QU6 A;  3ECR A;  4JI1 E;  2N8X A;  3HPZ A;  2LE2 A;  4HTG A;  2YSP A;  1BBO A;  1UIL A;  2EM3 A;  1N3G A;  2ADR A;  1X6E A;  2DLQ A;  2EN3 A;  4R2C A;  1X47 A;  1ZR9 A;  5KL2 A;  1YUI A;  4JI8 E;  2B7T A;  4GZN C;  2EN6 A;  2N3G A;  3T1H E;  1UHZ A;  4L5N C;  3BBG A;  2YTG A;  4LF9 E;  5LL6 R;  1B69 A;  2EMZ A;  2YTJ A;  3HXL A;  3J81 C;  2L3J A;  4N4R B;  4I8O A;  2GPI A;  3DF6 A;  1PJQ A;  5AC4 A;  2YTQ A;  2M7Q A;  4R2P A;  1GTK A;  1A1H A;  1G2F C;  2EM9 A;  2EOM A;  5IWA E;  3H09 A;  1AH5 A;  2BB8 A;  2ZM6 E;  1SFE A;  2FV4 B;  1X6F A;  2MDG A;  3LML A;  1LLM C;  2E1M A;  4KHP E;  3K6Q A;  2YTE A;  2LTS A;  2YZT A;  2NAB A;  2VRD A;  2EMG A;  4JI7 E;  2BBG A;  2EMY A;  2WCC 3;  5AC5 A;  2YU8 A;  4KZS A;  5BR8 E;  2V88 A;  4DR4 E;  4ZYD A;  2DRP A;  3IWD A;  2M9A A;  2L2K B;  1A1G A;  2YTI A;  3BGH A;  2JP9 A;  2EPR A;  3VHT B;  2N3H A;  4IJD A;  2EOI A;  2EPO A;  3JU0 A;  1XMO E;  3IWB A;  2EPP A;  1IQO A;  2A25 A;  1T39 A;  4R2R A;  4NXN E;  3EPK A;  5T6J A;  1YZ9 A;  1GZ6 A;  3OML A;  1EKZ A;  2RTX A;  4HEI A;  3C4T A;  2CPN A;  2EJ4 A;  4O24 A;  3J7Y p;  1N36 E;  5IXM B;  1PDA A;  3P1X A;  1MGT A;  2DB2 A;  1XNR E;  3JTZ A;  4R2S A;  2EOZ A;  2EMB A;  2NUG A;  2EL4 A;  1N33 E;  2CTD A;  1X48 A;  3TQM A;  5A6J A;  2V89 A;  4Q35 B;  5LLQ A;  2V83 A;  1IBL E;  4JI4 E;  2VF1 A;  4NZV A;  4NXM E;  1A1L A;  4WXD A;  1ZU1 A;  4O4K A;  4ZYH A;  2YTD A;  4X66 E;  2EML A;  1X6H A;  4R03 A;  2WBU A;  5A6K A;  4DV4 E;  3RMP A;  2K7I A;  4LU9 A;  4R2E A;  1EH6 A;  5IT9 C;  2LCE A;  5F3W A;  5AE2 A;  5LMN E;  2EOY A;  2UUC E;  1IQS A;  2HC5 A;  2EPX A;  1KJK A;  2J7J A;  4ZYG A;  1DI2 A;  4F9A B;  3BF2 A;  4BHC A;  5A69 A;  3L00 A;  1STU A;  2DGC A;  2V86 A;  1O0W A;  4DR5 E;  4JV5 E;  2EOX A;  2L92 A;  1T4N A;  4BS9 A;  2MKD A;  4X9J A;  2UXB E;  4F2J C;  3EQ1 A;  4WFT A;  1L4S A;  3ADL A;  3F6G A;  5A6A A;  3VK6 A;  1FKA E;  2RS6 A;  3LLH A;  2JR1 A;  2EPL X;  3J80 C;  2EN7 A;  2L2N A;  1RMD A;  2DMY A;  4X8W A;  4NHR A;  2JY9 A;  4DV3 E;  2LV2 A;  5AE1 A;  5FLX C;  1Z1B A;  2K4V A;  2EOE A; 
#chains in the Genus database with same CATH homology
 2WBS A;  2DLK A;  2RSI A;  2HGH A;  1A1K A;  1WJP A;  2EMY A;  2WCC 3;  1F2I G;  2EE8 A;  2YU8 A;  1G2D C;  3MHH C;  2DRP A;  2EMW A;  1A1G A;  2M9A A;  2EPU A;  2EPZ A;  2YTI A;  2LO3 A;  2JP9 A;  2CT1 A;  2EPR A;  2EMX A;  5KL6 A;  2YTN A;  3VHT B;  2EM8 A;  4IJD A;  2MKN A;  2EOI A;  2EM5 A;  2RPC A;  1YUJ A;  2EOS A;  2EPP A;  5KL4 A;  2A25 A;  3UK3 C;  4R2R A;  2YRK A;  2EOF A;  2YTO A;  2EOR A;  2E72 A;  2EQ0 A;  3EPK A;  2EM4 A;  1A1J A;  2EM0 A;  2EPA A;  1TF6 A;  3M99 B;  2EJ4 A;  2WBT A;  1X5W A;  1BB8 A;  2EQ1 A;  1P47 A;  1TF3 A;  4F6M A;  2LT7 A;  2PRT A;  2CSH A;  2EN2 A;  2EM2 A;  1JK1 A;  4M9V C;  4R2S A;  2EM6 A;  2EOZ A;  2EMB A;  2EMC A;  2DMI A;  1AAY A;  2EL4 A;  1UN6 B;  2CTD A;  2YTP A;  2EN8 A;  2EMI A;  2YRM A;  1X3C A;  1TN9 A;  1DGC A;  1A1F A;  2LVH A;  2EOQ A;  1YSA C;  2D9H A;  2YSO A;  1A1L A;  1ZU1 A;  4R2D A;  2YTD A;  2EML A;  2YU5 A;  2YSP A;  1X6H A;  2EPC A;  2WBU A;  2I13 A;  1BBO A;  2EM3 A;  2ADR A;  1X6E A;  2DLQ A;  2EMK A;  2EN3 A;  2EN1 A;  2EOH A;  4R2C A;  5KL5 A;  1ZR9 A;  5KL2 A;  4F6N A;  1MEY C;  2GLI A;  5KL7 A;  2EP3 A;  2EM7 A;  4R2E A;  1YUI A;  2LCE A;  4GZN C;  2EN6 A;  2EL6 A;  2ELY A;  1JK2 A;  3EPJ A;  2YTG A;  2EOY A;  1B69 A;  2EMZ A;  2YTJ A;  1A1I A;  2EPX A;  2EMH A;  4R2Q A;  2EMA A;  1KJK A;  2J7J A;  2ENH A;  2R1F A;  2DGC A;  2GHF A;  2ELZ A;  1NCS A;  2YRH A;  2YTQ A;  5KL3 A;  4R2P A;  1A1H A;  1G2F C;  2JPA A;  2EM9 A;  2EOO A;  2EOX A;  2EOM A;  4WSG A;  2EQ3 A;  3EPH A;  4R2A A;  2MKD A;  4X9J A;  4F2J C;  2BB8 A;  3EPL A;  4FK5 C;  2YTF A;  2ENA A;  1UBD C;  2EMF A;  1X6F A;  2MDG A;  2EL5 A;  1LLM C;  2EN7 A;  2EN4 A;  1RMD A;  2YTE A;  4IS1 C;  2EOJ A;  2ENC A;  2NAB A;  2EMG A;  2VRD A;  3MHS C;  2LV2 A;  1Z1B A;  2EOE A;  1ZAA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...