2WBSA

Crystal structure of the zinc finger domain of klf4 bound to its target dna
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
87
structure length
87
Chain Sequence
TATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords KRUEPPEL-LIKE FACTOR 4
publication title The Structure of the Klf4 DNA-Binding Domain Links to Self-Renewal and Macrophage Differentiation.
pubmed doi rcsb
source organism Mus musculus
total genus 25
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2009-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2wbsA00
2EOIA 1A1HA 2EL4A 2YTFA 2EPCA 2YRMA 1BBOA 2EMGA 1YUIA 2DMIA 2EMIA 1TN9A 2EQ3A 4M9VC 4R2AA 2YSOA 2EMXA 2EM9A 2YU5A 3EPLA 4R2CA 4GZNC 1A1FA 2EOHA 2EN3A 2JP9A 2EM4A 1AAYA 2YTPA 2EM3A 2EN4A 2MDGA 2VRDA 2E72A 4R2EA 2EN6A 2EOYA 2CTDA 3EPHA 1YSAC 2JPAA 2EOEA 2YRHA 2ENAA 2EMLA 2EPPA 1X6HA 2LT7A 4R2QA 1TF3A 4R2PA 2EMYA 1X6EA 2M9AA 2D9HA 1A1IA 2PRTA 5KL4A 2EN7A 1KJKA 1X5WA 2EM5A 2EPXA 2EMKA 2EE8A 2CSHA 5KL5A 2YTDA 4FK5C 1LLMC 1TF6A 2EM0A 2MKDA 2HGHA 2EPUA 2LCEA 2WBUA 2RSIA 1NCSA 2NABA 4R2RA 4IJDA 1JK2A 1ZU1A 2EOMA 1RMDA 1G2DC 1DGCA 2EM8A 2J7JA 1BB8A 2R1FA 2I13A 2YTQA 2EMFA 2CT1A 1Z1BA 1F2IG 2ADRA 2EP3A 4WSGA 2GLIA 1YUJA 3MHSC 2LVHA 2YTJA 2EL6A 5KL2A 3UK3C 2EQ1A 2WBSA 2LV2A 2EPZA 3VHTB 1ZR9A 2EMAA 4R2SA 2EN8A 2EN2A 2EOFA 1ZAAC 5KL6A 2GHFA 1A1JA 2EMCA 2MKNA 1X3CA 1X6FA 2EMHA 2LO3A 2YTEA 4R2DA 2EJ4A 2DLKA 2EM2A 2EL5A 4X9JA 1JK1A 1WJPA 2EQ0A 5KL7A 1UN6B 4F6MA 2YSPA 5KL3A 2ELZA 2EPRA 1G2FC 2EORA 2EOJA 2EMBA 2EMWA 2YTOA 2YTNA 1A1KA 2EMZA 2EM6A 1A1LA 2DRPA 3EPJA 2ELYA 3M99B 4F6NA 2A25A 2ENCA 2DGCA 2EOQA 1UBDC 2WBTA 2EM7A 2EOOA 2EOSA 4IS1C 3EPKA 2YU8A 2EOXA 2EPAA 1A1GA 2WCC3 2YTGA 2ENHA 2EN1A 2DLQA 2EOZA 4F2JC 2RPCA 2BB8A 1P47A 1MEYC 2YTIA 1B69A 2YRKA 3MHHC
chains in the Genus database with same CATH superfamily
2EOIA 4DV3E 3ADJA 2RSMA 2EMIA 4M9VC 2JWOA 4NXME 2LE2A 3DJWA 1UHZA 2YU5A 4B3TE 2K7IA 4LF7E 2EOHA 2EN3A 4RHBB 3IWDA 2IHR1 4RH8A 4F9AB 2YZTA 2YTPA 4GKKE 2JYAA 4DV6E 2YPNA 2FGGA 2Q8UA 2UUAE 3ADIA 2ENAA 5LMUE 2JOBA 2FTXB 3OMLA 2UXCE 2E5LE 2EPMX 4BC7A 1SR9A 2EN7A 2EM5A 5A6JA 4P78A 4BCAA 2CSHA 4JI1E 4KZSA 4P7DA 2UU9E 2B7TA 1ZBTA 2NABA 4TUIA 5IT9C 2EM8A 1QNTA 4BBYA 3DF6A 2R1FA 2I13A 2NUEA 2UUCE 2YT4A 4L8NA 4X65E 2CT1A 3C6MA 2L92A 2G7HA 4WX9A 4DMIA 1RC7A 2ADRA 4WSGA 2GLIA 3MHSC 3ADGA 3LLHA 5KL2A 2EQ1A 3VHTB 1HNZE 5LL6R 2EMAA 1QU6A 2EN2A 2EOFA 1BBGA 1ZAAC 3KZZA 2MKNA 2EMCA 1X3CA 1N36E 2LUPB 2LJHA 3BIDA 2LO3A 4DR7E 2YTEA 4NZVA 5AE1A 2L33A 2EJ4A 1PJSA 5A2QC 1HNWE 4WYQB 3H09A 1T4NA 2V83A 5KL3A 2ELZA 2EORA 3JU0A 3MSWA 1A1KA 2EMZA 3JAMC 2DRPA 2DIXA 4I8OA 4F6NA 3VK6A 4JI2E 2B3TB 5DNYA 4AQYE 4M30A 3EPKA 2YU8A 1J26A 2EOXA 1STUA 5AE3A 2YTGA 3J80C 2EOZA 3OTOE 4GEQB 2RPCA 4OOGC 2DB2A 2YTIA 2YRKA 3MHHC 4DR6E 5T6JA 4LTYA 4LF4E 2R76A 2VQFE 2EMGA 1BBOA 2ODRC 2DMIA 1TN9A 2EQ3A 2L3CA 2YSOA 3BGHA 2KONA 1EH6A 2VE7C 1RQ0A 3RMPA 3EPLA 1FKAE 2F8BA 4R2CA 4DR2E 1N34E 1A1FA 2MC6A 4JI5E 2JP9A 2EM4A 2V86A 1AAYA 4DUYE 4JI0E 2EOYA 4WXCA 2E1MA 2UXDE 2CTDA 4Q28A 2NUGA 4JI4E 4BHBA 4DV2E 2CPNA 3IWCA 4R2QA 5AASA 1TF3A 1WXRA 2EMYA 3BBGA 2M9AA 2D9HA 4LF5E 4L5NC 2PRTA 4X62E 1X5WA 2EMKA 2EE8A 4HEIA 2HGHA 2EPUA 2L3JA 5F3WA 4M0VA 4DV5E 1PKPA 4WXDA 4IJDA 4R2RA 1RMDA 1YYKA 2V8QB 4LF9E 5AC5A 3IWBA 4YY3E 1DQ3A 2HHHE 4ZYDA 4LFAE 4BMJA 2LV2A 2EPZA 2ODRD 4R2SA 4DR4E 1N33E 5ADZA 4F54A 3VYXA 1X6FA 4F9CB 2F4VE 5IXMB 1EH7A 4R2DA 5CFFE 1MGTA 2DLKA 2EM2A 2H36X 4X9JA 3J7Yp 2M1SA 2NUFA 3QG5C 5IV8B 4LF6E 4F6MA 2L2MA 4BS9A 1PJTA 2V88A 2LUQA 1WHNA 3C6KA 3TQMA 1G2FC 2L2KB 2EMWA 2YTOA 4WPYA 3M99B 2LMZA 2A25A 2DGCA 1UBDC 4M2ZA 2WBTA 2EOOA 2EOSA 4IS1C 3HXLA 1T38A 2EPAA 2JOXA 1GZ6A 2WCC3 4LFBE 3J81C 3JTZA 4DKKA 4JI8E 5BR8E 1A1HA 2EL4A 2YRMA 4WSPA 4DR5E 3FIGA 3F6GA 4KHPE 2DSYA 3T1YE 1SFEA 1HNXE 1IBLE 4O4KA 2L6MA 5FLXC 4J8ZA 1IQOA 2EWLA 2EM9A 4GZNC 1YFHA 2EM3A 2EN4A 4JV5E 2NA2A 1XNRE 4R2EA 2EN6A 4B3ME 1T39A 2JXPA 4NHRA 4DV0E 2EMLA 1N32E 2EPPA 4O43A 1EH8A 5LMNE 4JI7E 1X6HA 1N3GA 3THNA 3ZOQB 4K0KE 1X6EA 2L8TA 3T1HE 4DV1E 1KJKA 4LU9A 2EPXA 3LMLA 2HJJA 5KL5A 4LF8E 3HPZA 2WBUA 1XMQE 2HC5A 4X8WA 4GKJE 4TUGA 1G2DC 2EOMA 4DR3E 2I9IA 4KWYA 2EMFA 1WHQA 1YYOA 5IWAE 2DMYA 1X47A 1Z1BA 1F2IG 4X66E 1GQEA 2EP3A 4JI3E 2LVHA 2YTJA 3BF2A 4LFCE 3UK3C 2WBSA 4NXNE 4YHHE 2EN8A 3KWRA 1XMOE 3ADLA 1XNQE 4O5GA 2GHFA 3THOB 5AC4A 1I94E 2K4VA 3C4BA 1DI2A 4X64E 2EPOA 2EL5A 2JY9A 2M7QA 1JK1A 1WRJA 1UN6B 1UILA 4B3RE 2YSPA 2N8XA 4WFTA 2KHXA 4MLQA 3HPSA 2EMBA 2JR1A 2M4IA 3EPJA 2KOUA 3F6HA 1IMUA 2EM7A 4ZYHA 2EPNA 3VYYA 1GTKA 1A1GA 4R8OA 2DLQA 1PJQA 4F2JC 3AUZA 4F9BB 1P47A 1MEYC 5A6BD 4B3SE 2N3HA 1ZBQA 4N4RB 2VQEE 2YTFA 2EPCA 3C4TA 1YUIA 1EKZA 4R2AA 2GPIA 2EMXA 1AH5A 1PDAA 2EPKX 4MLVA 2N3GA 4DR1E 1J5EE 2MDGA 2VRDA 2E72A 2LJUA 3EPHA 1YSAC 2JPAA 2EOEA 1T4LB 2LBSB 3J7AG 2YRHA 1HR0E 3EQ1A 2UUBE 5TSEA 2LT7A 1FJGE 1T4OA 2MDRA 4R2PA 2B7VA 2RQLA 1X49A 4JI6E 2VF1A 1A1IA 5KL4A 2LTSA 2WZOA 1LLMC 2YTDA 4FK5C 5LLQA 1TF6A 2EM0A 2MKDA 4HTGA 2LCEA 5A6KA 4ZYEA 1IBKE 1IBME 2RSIA 1NCSA 4O24A 1JK2A 1ZU1A 5A69A 2MC5A 2RS7A 2J7JA 4DUZE 4DV7E 1DGCA 1BB8A 2YTQA 2V85A 3ECRA 4OX9E 2V87A 1NEIA 4R03A 2UXBE 2LTRA 2YWQA 3AV0A 1YUJA 2JVAA 2EL6A 1YPNA 3K6QA 1ZR9A 2EPLX 2RTXA 2ZM6E 3HQ1A 4BC9A 5A6BA 5KL6A 5A6AA 1A1JA 2FV4B 3L00A 2EMHA 1YYWA 4ZYGA 4DV4E 2EZ6A 1IQSA 2L2NA 2RS6A 3P1XA 1WJPA 2EQ0A 5KL7A 2B9DA 2LRSA 1O0WA 4BHCA 1L4SA 2EPRA 2EOJA 2YTNA 2EM6A 1A1LA 2ELYA 2ENCA 2EOQA 1X48A 5AE2A 1YZ9A 2BBGA 2EN1A 2ENHA 3KZYA 3HTXA 1KYQA 4JYAE 2BB8A 1B69A 2V89A 4Q35B
chains in the Genus database with same CATH topology
2EOIA 1A1HA 2EL4A 2YTFA 2EPCA 2YRMA 1BBOA 2EMGA 1YUIA 2DMIA 2EMIA 1TN9A 2EQ3A 4M9VC 4R2AA 2YSOA 2EMXA 2EM9A 2YU5A 3EPLA 4R2CA 4GZNC 1A1FA 2EOHA 2EN3A 2JP9A 2EM4A 1AAYA 2YTPA 2EM3A 2EN4A 2MDGA 2VRDA 2E72A 4R2EA 2EN6A 2EOYA 2CTDA 3EPHA 1YSAC 2JPAA 2EOEA 2YRHA 2ENAA 2EMLA 2EPPA 1X6HA 2LT7A 4R2QA 1TF3A 4R2PA 2EMYA 1X6EA 2M9AA 2D9HA 1A1IA 2PRTA 5KL4A 2EN7A 1KJKA 1X5WA 2EM5A 2EPXA 2EMKA 2EE8A 2CSHA 5KL5A 2YTDA 4FK5C 1LLMC 1TF6A 2EM0A 2MKDA 2HGHA 2EPUA 2LCEA 2WBUA 2RSIA 1NCSA 2NABA 4R2RA 4IJDA 1JK2A 1ZU1A 2EOMA 1RMDA 1G2DC 1DGCA 2EM8A 2J7JA 1BB8A 2R1FA 2I13A 2YTQA 2EMFA 2CT1A 1Z1BA 1F2IG 2ADRA 2EP3A 4WSGA 2GLIA 1YUJA 3MHSC 2LVHA 2YTJA 2EL6A 5KL2A 3UK3C 2EQ1A 2WBSA 2LV2A 2EPZA 3VHTB 1ZR9A 2EMAA 4R2SA 2EN8A 2EN2A 2EOFA 1ZAAC 5KL6A 2GHFA 1A1JA 2EMCA 2MKNA 1X3CA 1X6FA 2EMHA 2LO3A 2YTEA 4R2DA 2EJ4A 2DLKA 2EM2A 2EL5A 4X9JA 1JK1A 1WJPA 2EQ0A 5KL7A 1UN6B 4F6MA 2YSPA 5KL3A 2ELZA 2EPRA 1G2FC 2EORA 2EOJA 2EMBA 2EMWA 2YTOA 2YTNA 1A1KA 2EMZA 2EM6A 1A1LA 2DRPA 3EPJA 2ELYA 3M99B 4F6NA 2A25A 2ENCA 2DGCA 2EOQA 1UBDC 2WBTA 2EM7A 2EOOA 2EOSA 4IS1C 3EPKA 2YU8A 2EOXA 2EPAA 1A1GA 2WCC3 2YTGA 2ENHA 2EN1A 2DLQA 2EOZA 4F2JC 2RPCA 2BB8A 1P47A 1MEYC 2YTIA 1B69A 2YRKA 3MHHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOI A;  1A1H A;  2EL4 A;  2YTF A;  2EPC A;  2YRM A;  1BBO A;  2EMG A;  1YUI A;  2DMI A;  2EMI A;  1TN9 A;  2EQ3 A;  4M9V C;  4R2A A;  2YSO A;  2EMX A;  2EM9 A;  2YU5 A;  3EPL A;  4R2C A;  4GZN C;  1A1F A;  2EOH A;  2EN3 A;  2JP9 A;  2EM4 A;  1AAY A;  2YTP A;  2EM3 A;  2EN4 A;  2MDG A;  2VRD A;  2E72 A;  4R2E A;  2EN6 A;  2EOY A;  2CTD A;  3EPH A;  1YSA C;  2JPA A;  2EOE A;  2YRH A;  2ENA A;  2EML A;  2EPP A;  1X6H A;  2LT7 A;  4R2Q A;  1TF3 A;  4R2P A;  2EMY A;  1X6E A;  2M9A A;  2D9H A;  1A1I A;  2PRT A;  5KL4 A;  2EN7 A;  1KJK A;  1X5W A;  2EM5 A;  2EPX A;  2EMK A;  2EE8 A;  2CSH A;  5KL5 A;  2YTD A;  4FK5 C;  1LLM C;  1TF6 A;  2EM0 A;  2MKD A;  2HGH A;  2EPU A;  2LCE A;  2WBU A;  2RSI A;  1NCS A;  2NAB A;  4R2R A;  4IJD A;  1JK2 A;  1ZU1 A;  2EOM A;  1RMD A;  1G2D C;  1DGC A;  2EM8 A;  2J7J A;  1BB8 A;  2R1F A;  2I13 A;  2YTQ A;  2EMF A;  2CT1 A;  1Z1B A;  1F2I G;  2ADR A;  2EP3 A;  4WSG A;  2GLI A;  1YUJ A;  3MHS C;  2LVH A;  2YTJ A;  2EL6 A;  5KL2 A;  3UK3 C;  2EQ1 A;  2WBS A;  2LV2 A;  2EPZ A;  3VHT B;  1ZR9 A;  2EMA A;  4R2S A;  2EN8 A;  2EN2 A;  2EOF A;  1ZAA C;  5KL6 A;  2GHF A;  1A1J A;  2EMC A;  2MKN A;  1X3C A;  1X6F A;  2EMH A;  2LO3 A;  2YTE A;  4R2D A;  2EJ4 A;  2DLK A;  2EM2 A;  2EL5 A;  4X9J A;  1JK1 A;  1WJP A;  2EQ0 A;  5KL7 A;  1UN6 B;  4F6M A;  2YSP A;  5KL3 A;  2ELZ A;  2EPR A;  1G2F C;  2EOR A;  2EOJ A;  2EMB A;  2EMW A;  2YTO A;  2YTN A;  1A1K A;  2EMZ A;  2EM6 A;  1A1L A;  2DRP A;  3EPJ A;  2ELY A;  3M99 B;  4F6N A;  2A25 A;  2ENC A;  2DGC A;  2EOQ A;  1UBD C;  2WBT A;  2EM7 A;  2EOO A;  2EOS A;  4IS1 C;  3EPK A;  2YU8 A;  2EOX A;  2EPA A;  1A1G A;  2WCC 3;  2YTG A;  2ENH A;  2EN1 A;  2DLQ A;  2EOZ A;  4F2J C;  2RPC A;  2BB8 A;  1P47 A;  1MEY C;  2YTI A;  1B69 A;  2YRK A;  3MHH C; 
#chains in the Genus database with same CATH topology
 2EOI A;  4DV3 E;  3ADJ A;  2RSM A;  2EMI A;  4M9V C;  2JWO A;  4NXM E;  2LE2 A;  3DJW A;  1UHZ A;  2YU5 A;  4B3T E;  2K7I A;  4LF7 E;  2EOH A;  2EN3 A;  4RHB B;  3IWD A;  2IHR 1;  4RH8 A;  4F9A B;  2YZT A;  2YTP A;  4GKK E;  2JYA A;  4DV6 E;  2YPN A;  2FGG A;  2Q8U A;  2UUA E;  3ADI A;  2ENA A;  5LMU E;  2JOB A;  2FTX B;  3OML A;  2UXC E;  2E5L E;  2EPM X;  4BC7 A;  1SR9 A;  2EN7 A;  2EM5 A;  5A6J A;  4P78 A;  4BCA A;  2CSH A;  4JI1 E;  4KZS A;  4P7D A;  2UU9 E;  2B7T A;  1ZBT A;  2NAB A;  4TUI A;  5IT9 C;  2EM8 A;  1QNT A;  4BBY A;  3DF6 A;  2R1F A;  2I13 A;  2NUE A;  2UUC E;  2YT4 A;  4L8N A;  4X65 E;  2CT1 A;  3C6M A;  2L92 A;  2G7H A;  4WX9 A;  4DMI A;  1RC7 A;  2ADR A;  4WSG A;  2GLI A;  3MHS C;  3ADG A;  3LLH A;  5KL2 A;  2EQ1 A;  3VHT B;  1HNZ E;  5LL6 R;  2EMA A;  1QU6 A;  2EN2 A;  2EOF A;  1BBG A;  1ZAA C;  3KZZ A;  2MKN A;  2EMC A;  1X3C A;  1N36 E;  2LUP B;  2LJH A;  3BID A;  2LO3 A;  4DR7 E;  2YTE A;  4NZV A;  5AE1 A;  2L33 A;  2EJ4 A;  1PJS A;  5A2Q C;  1HNW E;  4WYQ B;  3H09 A;  1T4N A;  2V83 A;  5KL3 A;  2ELZ A;  2EOR A;  3JU0 A;  3MSW A;  1A1K A;  2EMZ A;  3JAM C;  2DRP A;  2DIX A;  4I8O A;  4F6N A;  3VK6 A;  4JI2 E;  2B3T B;  5DNY A;  4AQY E;  4M30 A;  3EPK A;  2YU8 A;  1J26 A;  2EOX A;  1STU A;  5AE3 A;  2YTG A;  3J80 C;  2EOZ A;  3OTO E;  4GEQ B;  2RPC A;  4OOG C;  2DB2 A;  2YTI A;  2YRK A;  3MHH C;  4DR6 E;  5T6J A;  4LTY A;  4LF4 E;  2R76 A;  2VQF E;  2EMG A;  1BBO A;  2ODR C;  2DMI A;  1TN9 A;  2EQ3 A;  2L3C A;  2YSO A;  3BGH A;  2KON A;  1EH6 A;  2VE7 C;  1RQ0 A;  3RMP A;  3EPL A;  1FKA E;  2F8B A;  4R2C A;  4DR2 E;  1N34 E;  1A1F A;  2MC6 A;  4JI5 E;  2JP9 A;  2EM4 A;  2V86 A;  1AAY A;  4DUY E;  4JI0 E;  2EOY A;  4WXC A;  2E1M A;  2UXD E;  2CTD A;  4Q28 A;  2NUG A;  4JI4 E;  4BHB A;  4DV2 E;  2CPN A;  3IWC A;  4R2Q A;  5AAS A;  1TF3 A;  1WXR A;  2EMY A;  3BBG A;  2M9A A;  2D9H A;  4LF5 E;  4L5N C;  2PRT A;  4X62 E;  1X5W A;  2EMK A;  2EE8 A;  4HEI A;  2HGH A;  2EPU A;  2L3J A;  5F3W A;  4M0V A;  4DV5 E;  1PKP A;  4WXD A;  4IJD A;  4R2R A;  1RMD A;  1YYK A;  2V8Q B;  4LF9 E;  5AC5 A;  3IWB A;  4YY3 E;  1DQ3 A;  2HHH E;  4ZYD A;  4LFA E;  4BMJ A;  2LV2 A;  2EPZ A;  2ODR D;  4R2S A;  4DR4 E;  1N33 E;  5ADZ A;  4F54 A;  3VYX A;  1X6F A;  4F9C B;  2F4V E;  5IXM B;  1EH7 A;  4R2D A;  5CFF E;  1MGT A;  2DLK A;  2EM2 A;  2H36 X;  4X9J A;  3J7Y p;  2M1S A;  2NUF A;  3QG5 C;  5IV8 B;  4LF6 E;  4F6M A;  2L2M A;  4BS9 A;  1PJT A;  2V88 A;  2LUQ A;  1WHN A;  3C6K A;  3TQM A;  1G2F C;  2L2K B;  2EMW A;  2YTO A;  4WPY A;  3M99 B;  2LMZ A;  2A25 A;  2DGC A;  1UBD C;  4M2Z A;  2WBT A;  2EOO A;  2EOS A;  4IS1 C;  3HXL A;  1T38 A;  2EPA A;  2JOX A;  1GZ6 A;  2WCC 3;  4LFB E;  3J81 C;  3JTZ A;  4DKK A;  4JI8 E;  5BR8 E;  1A1H A;  2EL4 A;  2YRM A;  4WSP A;  4DR5 E;  3FIG A;  3F6G A;  4KHP E;  2DSY A;  3T1Y E;  1SFE A;  1HNX E;  1IBL E;  4O4K A;  2L6M A;  5FLX C;  4J8Z A;  1IQO A;  2EWL A;  2EM9 A;  4GZN C;  1YFH A;  2EM3 A;  2EN4 A;  4JV5 E;  2NA2 A;  1XNR E;  4R2E A;  2EN6 A;  4B3M E;  1T39 A;  2JXP A;  4NHR A;  4DV0 E;  2EML A;  1N32 E;  2EPP A;  4O43 A;  1EH8 A;  5LMN E;  4JI7 E;  1X6H A;  1N3G A;  3THN A;  3ZOQ B;  4K0K E;  1X6E A;  2L8T A;  3T1H E;  4DV1 E;  1KJK A;  4LU9 A;  2EPX A;  3LML A;  2HJJ A;  5KL5 A;  4LF8 E;  3HPZ A;  2WBU A;  1XMQ E;  2HC5 A;  4X8W A;  4GKJ E;  4TUG A;  1G2D C;  2EOM A;  4DR3 E;  2I9I A;  4KWY A;  2EMF A;  1WHQ A;  1YYO A;  5IWA E;  2DMY A;  1X47 A;  1Z1B A;  1F2I G;  4X66 E;  1GQE A;  2EP3 A;  4JI3 E;  2LVH A;  2YTJ A;  3BF2 A;  4LFC E;  3UK3 C;  2WBS A;  4NXN E;  4YHH E;  2EN8 A;  3KWR A;  1XMO E;  3ADL A;  1XNQ E;  4O5G A;  2GHF A;  3THO B;  5AC4 A;  1I94 E;  2K4V A;  3C4B A;  1DI2 A;  4X64 E;  2EPO A;  2EL5 A;  2JY9 A;  2M7Q A;  1JK1 A;  1WRJ A;  1UN6 B;  1UIL A;  4B3R E;  2YSP A;  2N8X A;  4WFT A;  2KHX A;  4MLQ A;  3HPS A;  2EMB A;  2JR1 A;  2M4I A;  3EPJ A;  2KOU A;  3F6H A;  1IMU A;  2EM7 A;  4ZYH A;  2EPN A;  3VYY A;  1GTK A;  1A1G A;  4R8O A;  2DLQ A;  1PJQ A;  4F2J C;  3AUZ A;  4F9B B;  1P47 A;  1MEY C;  5A6B D;  4B3S E;  2N3H A;  1ZBQ A;  4N4R B;  2VQE E;  2YTF A;  2EPC A;  3C4T A;  1YUI A;  1EKZ A;  4R2A A;  2GPI A;  2EMX A;  1AH5 A;  1PDA A;  2EPK X;  4MLV A;  2N3G A;  4DR1 E;  1J5E E;  2MDG A;  2VRD A;  2E72 A;  2LJU A;  3EPH A;  1YSA C;  2JPA A;  2EOE A;  1T4L B;  2LBS B;  3J7A G;  2YRH A;  1HR0 E;  3EQ1 A;  2UUB E;  5TSE A;  2LT7 A;  1FJG E;  1T4O A;  2MDR A;  4R2P A;  2B7V A;  2RQL A;  1X49 A;  4JI6 E;  2VF1 A;  1A1I A;  5KL4 A;  2LTS A;  2WZO A;  1LLM C;  2YTD A;  4FK5 C;  5LLQ A;  1TF6 A;  2EM0 A;  2MKD A;  4HTG A;  2LCE A;  5A6K A;  4ZYE A;  1IBK E;  1IBM E;  2RSI A;  1NCS A;  4O24 A;  1JK2 A;  1ZU1 A;  5A69 A;  2MC5 A;  2RS7 A;  2J7J A;  4DUZ E;  4DV7 E;  1DGC A;  1BB8 A;  2YTQ A;  2V85 A;  3ECR A;  4OX9 E;  2V87 A;  1NEI A;  4R03 A;  2UXB E;  2LTR A;  2YWQ A;  3AV0 A;  1YUJ A;  2JVA A;  2EL6 A;  1YPN A;  3K6Q A;  1ZR9 A;  2EPL X;  2RTX A;  2ZM6 E;  3HQ1 A;  4BC9 A;  5A6B A;  5KL6 A;  5A6A A;  1A1J A;  2FV4 B;  3L00 A;  2EMH A;  1YYW A;  4ZYG A;  4DV4 E;  2EZ6 A;  1IQS A;  2L2N A;  2RS6 A;  3P1X A;  1WJP A;  2EQ0 A;  5KL7 A;  2B9D A;  2LRS A;  1O0W A;  4BHC A;  1L4S A;  2EPR A;  2EOJ A;  2YTN A;  2EM6 A;  1A1L A;  2ELY A;  2ENC A;  2EOQ A;  1X48 A;  5AE2 A;  1YZ9 A;  2BBG A;  2EN1 A;  2ENH A;  3KZY A;  3HTX A;  1KYQ A;  4JYA E;  2BB8 A;  1B69 A;  2V89 A;  4Q35 B; 
#chains in the Genus database with same CATH homology
 2EOI A;  1A1H A;  2EL4 A;  2YTF A;  2EPC A;  2YRM A;  1BBO A;  2EMG A;  1YUI A;  2DMI A;  2EMI A;  1TN9 A;  2EQ3 A;  4M9V C;  4R2A A;  2YSO A;  2EMX A;  2EM9 A;  2YU5 A;  3EPL A;  4R2C A;  4GZN C;  1A1F A;  2EOH A;  2EN3 A;  2JP9 A;  2EM4 A;  1AAY A;  2YTP A;  2EM3 A;  2EN4 A;  2MDG A;  2VRD A;  2E72 A;  4R2E A;  2EN6 A;  2EOY A;  2CTD A;  3EPH A;  1YSA C;  2JPA A;  2EOE A;  2YRH A;  2ENA A;  2EML A;  2EPP A;  1X6H A;  2LT7 A;  4R2Q A;  1TF3 A;  4R2P A;  2EMY A;  1X6E A;  2M9A A;  2D9H A;  1A1I A;  2PRT A;  5KL4 A;  2EN7 A;  1KJK A;  1X5W A;  2EM5 A;  2EPX A;  2EMK A;  2EE8 A;  2CSH A;  5KL5 A;  2YTD A;  4FK5 C;  1LLM C;  1TF6 A;  2EM0 A;  2MKD A;  2HGH A;  2EPU A;  2LCE A;  2WBU A;  2RSI A;  1NCS A;  2NAB A;  4R2R A;  4IJD A;  1JK2 A;  1ZU1 A;  2EOM A;  1RMD A;  1G2D C;  1DGC A;  2EM8 A;  2J7J A;  1BB8 A;  2R1F A;  2I13 A;  2YTQ A;  2EMF A;  2CT1 A;  1Z1B A;  1F2I G;  2ADR A;  2EP3 A;  4WSG A;  2GLI A;  1YUJ A;  3MHS C;  2LVH A;  2YTJ A;  2EL6 A;  5KL2 A;  3UK3 C;  2EQ1 A;  2WBS A;  2LV2 A;  2EPZ A;  3VHT B;  1ZR9 A;  2EMA A;  4R2S A;  2EN8 A;  2EN2 A;  2EOF A;  1ZAA C;  5KL6 A;  2GHF A;  1A1J A;  2EMC A;  2MKN A;  1X3C A;  1X6F A;  2EMH A;  2LO3 A;  2YTE A;  4R2D A;  2EJ4 A;  2DLK A;  2EM2 A;  2EL5 A;  4X9J A;  1JK1 A;  1WJP A;  2EQ0 A;  5KL7 A;  1UN6 B;  4F6M A;  2YSP A;  5KL3 A;  2ELZ A;  2EPR A;  1G2F C;  2EOR A;  2EOJ A;  2EMB A;  2EMW A;  2YTO A;  2YTN A;  1A1K A;  2EMZ A;  2EM6 A;  1A1L A;  2DRP A;  3EPJ A;  2ELY A;  3M99 B;  4F6N A;  2A25 A;  2ENC A;  2DGC A;  2EOQ A;  1UBD C;  2WBT A;  2EM7 A;  2EOO A;  2EOS A;  4IS1 C;  3EPK A;  2YU8 A;  2EOX A;  2EPA A;  1A1G A;  2WCC 3;  2YTG A;  2ENH A;  2EN1 A;  2DLQ A;  2EOZ A;  4F2J C;  2RPC A;  2BB8 A;  1P47 A;  1MEY C;  2YTI A;  1B69 A;  2YRK A;  3MHH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...