2WBSA

Crystal structure of the zinc finger domain of klf4 bound to its target dna
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
87
structure length
87
Chain Sequence
b'TATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords KRUEPPEL-LIKE FACTOR 4
molecule tags Transcription/dna
source organism Mus musculus
publication title The Structure of the Klf4 DNA-Binding Domain Links to Self-Renewal and Macrophage Differentiation.
pubmed doi rcsb
total genus 25
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2009-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2wbsA00
2EJ4A 2EMHA 2YU8A 2LVHA 2EL5A 2YTPA 1LLMC 1X6FA 2MKDA 2EM9A 2EN1A 1X3CA 2EOXA 4R2PA 2EPRA 2JPAA 5KL2A 2E72A 2DLKA 2YU5A 2EMFA 2EMZA 2EOZA 1X5WA 1X6EA 2EPXA 1P47A 2ADRA 2EOOA 2EPCA 4R2SA 4IS1C 2CTDA 1A1LA 1G2FC 2BB8A 2WCC3 2EL4A 2EOEA 2EMYA 2YRKA 4F6MA 3M99B 2GLIA 1ZR9A 3EPKA 4R2DA 1MEYC 3EPLA 2MKNA 1NCSA 1YSAC 2YRHA 5KL3A 2EMIA 4R2QA 2LV2A 2EE8A 2EM7A 1B69A 1UN6B 2EM2A 1A1KA 4R2CA 2EN7A 2M9AA 2EL6A 1DGCA 2EMXA 2EMCA 2GHFA 2D9HA 1G2DC 5KL5A 2LO3A 2DLQA 2EN3A 2EOFA 1YUIA 2YTFA 2NABA 1ZU1A 4R2RA 2EN4A 4FK5C 1WJPA 2EOJA 2RPCA 2YRMA 1TF3A 2EM8A 2EMWA 2ELYA 2EMGA 2YSPA 4WSGA 1A1FA 1A1HA 1A1GA 2ENHA 2YTJA 3EPJA 2EMAA 2YTGA 2WBSA 2I13A 2ENCA 2EM0A 2EMKA 1KJKA 2DMIA 2EOIA 2EQ0A 2EORA 2YTEA 2WBTA 5KL7A 5KL6A 1ZAAC 2EPPA 1RMDA 4F2JC 1TN9A 2WBUA 2ENAA 2YTQA 2EQ1A 2R1FA 4GZNC 2LCEA 2JP9A 2EMBA 2EOSA 2EM6A 1A1IA 1BB8A 2EMLA 2EOQA 2CT1A 2EQ3A 4M9VC 2EOHA 2EPUA 2J7JA 2MDGA 2EN6A 2YTIA 1UBDC 3MHSC 1TF6A 2EM4A 2EN2A 2EM5A 2EP3A 2YSOA 2YTDA 2DRPA 2DGCA 1X6HA 2VRDA 3MHHC 2HGHA 2EPZA 1A1JA 2EPAA 4R2EA 1YUJA 1Z1BA 2EOYA 2YTNA 1BBOA 2RSIA 2A25A 2LT7A 2EM3A 2YTOA 1JK1A 2EN8A 1JK2A 1AAYA 5KL4A 2EOMA 3UK3C 2CSHA 4IJDA 1F2IG 3VHTB 4X9JA 4R2AA 4F6NA 2PRTA 3EPHA 2ELZA
chains in the Genus database with same CATH superfamily
4DV4E 2LVHA 2EL5A 4B3SE 4WX9A 2MKDA 4LF4E 3OTOE 5AC5A 1WHQA 4M2ZA 1EH6A 5KL2A 2E72A 1X47A 2L2NA 1X6EA 4HTGA 2MDRA 3VYYA 1UILA 2EPCA 4R2SA 2WCC3 4NZVA 3IWCA 1IQOA 2ODRD 2YRKA 1T4OA 1ZR9A 2LUQA 1NCSA 2EWLA 4X62E 4TUIA 2L3JA 2YRHA 3KZZA 4P78A 2EM7A 2RTXA 1B69A 3K6QA 2EM2A 2DMYA 3EQ1A 2LTRA 4X66E 1A1KA 1GZ6A 3ECRA 2JXPA 4OX9E 2EL6A 4P7DA 1T39A 1J26A 1QU6A 2DLQA 2EN3A 2EOFA 1FJGE 4LFBE 2L8TA 2EPLX 1PJQA 1QNTA 4O43A 2NUFA 2FGGA 3J80C 2ODRC 4DV7E 2RPCA 2G7HA 4BC9A 2JY9A 1TF3A 2EM8A 2EPMX 1T38A 2WZOA 4NHRA 2CPNA 4KHPE 5A6BA 1A1FA 1A1HA 1X49A 3TQMA 3QG5C 3EPJA 3THNA 4KZSA 2V86A 2KONA 5IXMB 3J7Yp 1ZBQA 2DMIA 4BBYA 2NUEA 5KL7A 5KL6A 4X65E 4GZNC 4DR1E 2EMBA 2N8XA 4J8ZA 2EPNA 1N3GA 1BB8A 3VK6A 4M9VC 4LU9A 4ZYEA 2EPUA 3MHSC 1TF6A 4F9AB 2EN2A 4YHHE 2HGHA 2UUCE 2KOUA 2F4VE 1ZBTA 4X8WA 2K4VA 2EM3A 2YTOA 4NXME 2VQEE 4L5NC 1GTKA 2EN8A 2LJHA 4N4RB 1YFHA 5KL4A 1N34E 2LJUA 3VHTB 5LMNE 2E1MA 2HC5A 2MC6A 3EPHA 2ELZA 1T4LB 4DR3E 2V85A 2YU8A 4F9CB 2YTPA 2N3GA 4DV0E 4DKKA 2EM9A 2EN1A 1J5EE 1X3CA 4DR2E 4LF9E 4BC7A 4R2PA 4WXCA 2EPRA 2DLKA 2JR1A 2YWQA 3BF2A 4WYQB 3HQ1A 2L33A 1X5WA 2EPXA 2L2MA 1GQEA 2RS7A 2ADRA 2EOOA 1G2FC 3JTZA 4IS1C 2CTDA 2VF1A 5IWAE 2BB8A 2EOEA 2EMYA 1L4SA 4X64E 4AQYE 2LE2A 3EPKA 4R2DA 2VQFE 2UU9E 2RSMA 2M1SA 1MEYC 5AE1A 4DUZE 2EMIA 2HJJA 1WXRA 2EE8A 5A2QC 1I94E 1FKAE 4JV5E 4BMJA 4ZYGA 2EN7A 2UXDE 4M30A 2EMXA 1G2DC 3ADJA 1YUIA 2YTFA 1PKPA 4FK5C 3T1HE 4GKKE 4MLVA 3HPSA 2JOXA 3LLHA 4Q28A 5FLXC 2YRMA 4F54A 2EMGA 5IT9C 4B3TE 2FTXB 2I9IA 3T1YE 1A1GA 4DV2E 4DV6E 2YTGA 2B7VA 2V87A 4JYAE 1PJTA 4I8OA 5AE2A 2I13A 1PDAA 2EM0A 4KWYA 4WPYA 2EORA 2EPPA 1RMDA 2EPKX 2JP9A 2L6MA 5F3WA 2EM6A 1A1IA 3JAMC 2EMLA 2EOQA 2RS6A 2MDGA 2EN6A 2EPOA 1UBDC 2EM4A 1STUA 2EP3A 2YSOA 3ZOQB 1X6HA 1EH8A 2EPZA 4R2EA 3HPZA 1Z1BA 1YZ9A 2A25A 2GPIA 1EKZA 2RQLA 5A69A 1SR9A 2EOMA 3UK3C 4LFCE 1F2IG 4R2AA 3KWRA 3F6HA 2EJ4A 4JI7E 4GKJE 1UHZA 1X6FA 1N36E 2B7TA 1YYWA 1PJSA 2M4IA 2KHXA 2H36X 5LMUE 4Q35B 2EMFA 4JI6E 2EMZA 2EOZA 4NXNE 1EH7A 2UXCE 1XNRE 2B3TB 4RH8A 4JI0E 1SFEA 1N32E 4YY3E 2EL4A 3M99B 2GLIA 3THOB 3ADLA 4JI3E 1DQ3A 2JWOA 4HEIA 3EPLA 3ADGA 2V88A 3F6GA 3BIDA 1O0WA 4DR6E 3IWDA 4GEQB 4LF6E 2JOBA 5A6KA 2FV4B 2N3HA 4RHBB 2M9AA 1YYKA 4BCAA 1DGCA 4LF7E 4ZYDA 2EMCA 4LF8E 3C4TA 2LO3A 3DF6A 2E5LE 2EZ6A 2NABA 1ZU1A 2EN4A 2UUAE 5A6AA 1RQ0A 2EOJA 2V8QB 2YZTA 3J7AG 3H09A 2EMWA 2ELYA 2YSPA 5AASA 1N33E 1IQSA 4R03A 4F9BB 2WBSA 4DV1E 4M0VA 2LMZA 2EQ0A 2EOIA 3FIGA 1KJKA 2YTEA 2WBTA 1TN9A 4DR7E 1IBLE 2YTQA 4MLQA 2R1FA 2LCEA 2EOSA 3RMPA 4DUYE 2CT1A 2EQ3A 5T6JA 4O4KA 5A6BD 3KZYA 3OMLA 1BBGA 1IBKE 2EM5A 3L00A 1HR0E 2DRPA 4JI8E 2VRDA 1A1JA 1YUJA 2YTNA 5DNYA 1JK1A 3J81C 5LLQA 2ZM6E 1JK2A 5LL6R 1AAYA 4L8NA 4IJDA 2R76A 2LTSA 2HHHE 3MSWA 2VE7C 4BS9A 3VYXA 3BBGA 4F6NA 2DSYA 2PRTA 4R8OA 2EMHA 4JI4E 4DV5E 1LLMC 5BR8E 4LFAE 4ZYHA 1IBME 2EOXA 3C6MA 4DR4E 1HNZE 2JPAA 4JI1E 2YU5A 1HNXE 4BHBA 2M7QA 1P47A 4O5GA 3AV0A 4TUGA 2V83A 2MC5A 1WHNA 1A1LA 4DMIA 2IHR1 2LRSA 2K7IA 2DB2A 4F6MA 2Q8UA 1RC7A 4O24A 3C6KA 4JI2E 2MKNA 1DI2A 1YSAC 5CFFE 5KL3A 4R2QA 2LV2A 3AUZA 1UN6B 4WFTA 4DR5E 2NA2A 4JI5E 3LMLA 4R2CA 2GHFA 2D9HA 5KL5A 2F8BA 1MGTA 2L3CA 4R2RA 1WJPA 4LTYA 1HNWE 2YT4A 5ADZA 5AC4A 3DJWA 2NUGA 5AE3A 2LUPB 4WXDA 2LBSB 4WSGA 4K0KE 2ENHA 2YTJA 3JU0A 2EMAA 2L2KB 4WSPA 3IWBA 2ENCA 4OOGC 3ADIA 2EMKA 3BGHA 1ZAAC 2JYAA 4F2JC 4LF5E 2WBUA 2ENAA 2V89A 5IV8B 1XNQE 2EQ1A 1WRJA 4DV3E 4BHCA 1YPNA 1XMOE 2UUBE 4B3RE 3HXLA 2BBGA 2JVAA 2B9DA 2EOHA 3C4BA 2J7JA 1KYQA 2YTIA 2UXBE 2YTDA 1AH5A 2DGCA 3MHHC 2EPAA 1NEIA 2EOYA 1BBOA 2RSIA 2LT7A 1IMUA 1T4NA 5TSEA 1XMQE 2DIXA 2YPNA 4B3ME 2CSHA 2L92A 1X48A 4X9JA 3HTXA 1YYOA 5A6JA 3P1XA
chains in the Genus database with same CATH topology
2EJ4A 2EMHA 2YU8A 2LVHA 2EL5A 2YTPA 1LLMC 1X6FA 2MKDA 2EM9A 2EN1A 1X3CA 2EOXA 4R2PA 2EPRA 2JPAA 5KL2A 2E72A 2DLKA 2YU5A 2EMFA 2EMZA 2EOZA 1X5WA 1X6EA 2EPXA 1P47A 2ADRA 2EOOA 2EPCA 4R2SA 4IS1C 2CTDA 1A1LA 1G2FC 2BB8A 2WCC3 2EL4A 2EOEA 2EMYA 2YRKA 4F6MA 3M99B 2GLIA 1ZR9A 3EPKA 4R2DA 1MEYC 3EPLA 2MKNA 1NCSA 1YSAC 2YRHA 5KL3A 2EMIA 4R2QA 2LV2A 2EE8A 2EM7A 1B69A 1UN6B 2EM2A 1A1KA 4R2CA 2EN7A 2M9AA 2EL6A 1DGCA 2EMXA 2EMCA 2GHFA 2D9HA 1G2DC 5KL5A 2LO3A 2DLQA 2EN3A 2EOFA 1YUIA 2YTFA 2NABA 1ZU1A 4R2RA 2EN4A 4FK5C 1WJPA 2EOJA 2RPCA 2YRMA 1TF3A 2EM8A 2EMWA 2ELYA 2EMGA 2YSPA 4WSGA 1A1FA 1A1HA 1A1GA 2ENHA 2YTJA 3EPJA 2EMAA 2YTGA 2WBSA 2I13A 2ENCA 2EM0A 2EMKA 1KJKA 2DMIA 2EOIA 2EQ0A 2EORA 2YTEA 2WBTA 5KL7A 5KL6A 1ZAAC 2EPPA 1RMDA 4F2JC 1TN9A 2WBUA 2ENAA 2YTQA 2EQ1A 2R1FA 4GZNC 2LCEA 2JP9A 2EMBA 2EOSA 2EM6A 1A1IA 1BB8A 2EMLA 2EOQA 2CT1A 2EQ3A 4M9VC 2EOHA 2EPUA 2J7JA 2MDGA 2EN6A 2YTIA 1UBDC 3MHSC 1TF6A 2EM4A 2EN2A 2EM5A 2EP3A 2YSOA 2YTDA 2DRPA 2DGCA 1X6HA 2VRDA 3MHHC 2HGHA 2EPZA 1A1JA 2EPAA 4R2EA 1YUJA 1Z1BA 2EOYA 2YTNA 1BBOA 2RSIA 2A25A 2LT7A 2EM3A 2YTOA 1JK1A 2EN8A 1JK2A 1AAYA 5KL4A 2EOMA 3UK3C 2CSHA 4IJDA 1F2IG 3VHTB 4X9JA 4R2AA 4F6NA 2PRTA 3EPHA 2ELZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJ4 A;  2EMH A;  2YU8 A;  2LVH A;  2EL5 A;  2YTP A;  1LLM C;  1X6F A;  2MKD A;  2EM9 A;  2EN1 A;  1X3C A;  2EOX A;  4R2P A;  2EPR A;  2JPA A;  5KL2 A;  2E72 A;  2DLK A;  2YU5 A;  2EMF A;  2EMZ A;  2EOZ A;  1X5W A;  1X6E A;  2EPX A;  1P47 A;  2ADR A;  2EOO A;  2EPC A;  4R2S A;  4IS1 C;  2CTD A;  1A1L A;  1G2F C;  2BB8 A;  2WCC 3;  2EL4 A;  2EOE A;  2EMY A;  2YRK A;  4F6M A;  3M99 B;  2GLI A;  1ZR9 A;  3EPK A;  4R2D A;  1MEY C;  3EPL A;  2MKN A;  1NCS A;  1YSA C;  2YRH A;  5KL3 A;  2EMI A;  4R2Q A;  2LV2 A;  2EE8 A;  2EM7 A;  1B69 A;  1UN6 B;  2EM2 A;  1A1K A;  4R2C A;  2EN7 A;  2M9A A;  2EL6 A;  1DGC A;  2EMX A;  2EMC A;  2GHF A;  2D9H A;  1G2D C;  5KL5 A;  2LO3 A;  2DLQ A;  2EN3 A;  2EOF A;  1YUI A;  2YTF A;  2NAB A;  1ZU1 A;  4R2R A;  2EN4 A;  4FK5 C;  1WJP A;  2EOJ A;  2RPC A;  2YRM A;  1TF3 A;  2EM8 A;  2EMW A;  2ELY A;  2EMG A;  2YSP A;  4WSG A;  1A1F A;  1A1H A;  1A1G A;  2ENH A;  2YTJ A;  3EPJ A;  2EMA A;  2YTG A;  2WBS A;  2I13 A;  2ENC A;  2EM0 A;  2EMK A;  1KJK A;  2DMI A;  2EOI A;  2EQ0 A;  2EOR A;  2YTE A;  2WBT A;  5KL7 A;  5KL6 A;  1ZAA C;  2EPP A;  1RMD A;  4F2J C;  1TN9 A;  2WBU A;  2ENA A;  2YTQ A;  2EQ1 A;  2R1F A;  4GZN C;  2LCE A;  2JP9 A;  2EMB A;  2EOS A;  2EM6 A;  1A1I A;  1BB8 A;  2EML A;  2EOQ A;  2CT1 A;  2EQ3 A;  4M9V C;  2EOH A;  2EPU A;  2J7J A;  2MDG A;  2EN6 A;  2YTI A;  1UBD C;  3MHS C;  1TF6 A;  2EM4 A;  2EN2 A;  2EM5 A;  2EP3 A;  2YSO A;  2YTD A;  2DRP A;  2DGC A;  1X6H A;  2VRD A;  3MHH C;  2HGH A;  2EPZ A;  1A1J A;  2EPA A;  4R2E A;  1YUJ A;  1Z1B A;  2EOY A;  2YTN A;  1BBO A;  2RSI A;  2A25 A;  2LT7 A;  2EM3 A;  2YTO A;  1JK1 A;  2EN8 A;  1JK2 A;  1AAY A;  5KL4 A;  2EOM A;  3UK3 C;  2CSH A;  4IJD A;  1F2I G;  3VHT B;  4X9J A;  4R2A A;  4F6N A;  2PRT A;  3EPH A;  2ELZ A; 
#chains in the Genus database with same CATH topology
 4DV4 E;  2LVH A;  2EL5 A;  4B3S E;  4WX9 A;  2MKD A;  4LF4 E;  3OTO E;  5AC5 A;  1WHQ A;  4M2Z A;  1EH6 A;  5KL2 A;  2E72 A;  1X47 A;  2L2N A;  1X6E A;  4HTG A;  2MDR A;  3VYY A;  1UIL A;  2EPC A;  4R2S A;  2WCC 3;  4NZV A;  3IWC A;  1IQO A;  2ODR D;  2YRK A;  1T4O A;  1ZR9 A;  2LUQ A;  1NCS A;  2EWL A;  4X62 E;  4TUI A;  2L3J A;  2YRH A;  3KZZ A;  4P78 A;  2EM7 A;  2RTX A;  1B69 A;  3K6Q A;  2EM2 A;  2DMY A;  3EQ1 A;  2LTR A;  4X66 E;  1A1K A;  1GZ6 A;  3ECR A;  2JXP A;  4OX9 E;  2EL6 A;  4P7D A;  1T39 A;  1J26 A;  1QU6 A;  2DLQ A;  2EN3 A;  2EOF A;  1FJG E;  4LFB E;  2L8T A;  2EPL X;  1PJQ A;  1QNT A;  4O43 A;  2NUF A;  2FGG A;  3J80 C;  2ODR C;  4DV7 E;  2RPC A;  2G7H A;  4BC9 A;  2JY9 A;  1TF3 A;  2EM8 A;  2EPM X;  1T38 A;  2WZO A;  4NHR A;  2CPN A;  4KHP E;  5A6B A;  1A1F A;  1A1H A;  1X49 A;  3TQM A;  3QG5 C;  3EPJ A;  3THN A;  4KZS A;  2V86 A;  2KON A;  5IXM B;  3J7Y p;  1ZBQ A;  2DMI A;  4BBY A;  2NUE A;  5KL7 A;  5KL6 A;  4X65 E;  4GZN C;  4DR1 E;  2EMB A;  2N8X A;  4J8Z A;  2EPN A;  1N3G A;  1BB8 A;  3VK6 A;  4M9V C;  4LU9 A;  4ZYE A;  2EPU A;  3MHS C;  1TF6 A;  4F9A B;  2EN2 A;  4YHH E;  2HGH A;  2UUC E;  2KOU A;  2F4V E;  1ZBT A;  4X8W A;  2K4V A;  2EM3 A;  2YTO A;  4NXM E;  2VQE E;  4L5N C;  1GTK A;  2EN8 A;  2LJH A;  4N4R B;  1YFH A;  5KL4 A;  1N34 E;  2LJU A;  3VHT B;  5LMN E;  2E1M A;  2HC5 A;  2MC6 A;  3EPH A;  2ELZ A;  1T4L B;  4DR3 E;  2V85 A;  2YU8 A;  4F9C B;  2YTP A;  2N3G A;  4DV0 E;  4DKK A;  2EM9 A;  2EN1 A;  1J5E E;  1X3C A;  4DR2 E;  4LF9 E;  4BC7 A;  4R2P A;  4WXC A;  2EPR A;  2DLK A;  2JR1 A;  2YWQ A;  3BF2 A;  4WYQ B;  3HQ1 A;  2L33 A;  1X5W A;  2EPX A;  2L2M A;  1GQE A;  2RS7 A;  2ADR A;  2EOO A;  1G2F C;  3JTZ A;  4IS1 C;  2CTD A;  2VF1 A;  5IWA E;  2BB8 A;  2EOE A;  2EMY A;  1L4S A;  4X64 E;  4AQY E;  2LE2 A;  3EPK A;  4R2D A;  2VQF E;  2UU9 E;  2RSM A;  2M1S A;  1MEY C;  5AE1 A;  4DUZ E;  2EMI A;  2HJJ A;  1WXR A;  2EE8 A;  5A2Q C;  1I94 E;  1FKA E;  4JV5 E;  4BMJ A;  4ZYG A;  2EN7 A;  2UXD E;  4M30 A;  2EMX A;  1G2D C;  3ADJ A;  1YUI A;  2YTF A;  1PKP A;  4FK5 C;  3T1H E;  4GKK E;  4MLV A;  3HPS A;  2JOX A;  3LLH A;  4Q28 A;  5FLX C;  2YRM A;  4F54 A;  2EMG A;  5IT9 C;  4B3T E;  2FTX B;  2I9I A;  3T1Y E;  1A1G A;  4DV2 E;  4DV6 E;  2YTG A;  2B7V A;  2V87 A;  4JYA E;  1PJT A;  4I8O A;  5AE2 A;  2I13 A;  1PDA A;  2EM0 A;  4KWY A;  4WPY A;  2EOR A;  2EPP A;  1RMD A;  2EPK X;  2JP9 A;  2L6M A;  5F3W A;  2EM6 A;  1A1I A;  3JAM C;  2EML A;  2EOQ A;  2RS6 A;  2MDG A;  2EN6 A;  2EPO A;  1UBD C;  2EM4 A;  1STU A;  2EP3 A;  2YSO A;  3ZOQ B;  1X6H A;  1EH8 A;  2EPZ A;  4R2E A;  3HPZ A;  1Z1B A;  1YZ9 A;  2A25 A;  2GPI A;  1EKZ A;  2RQL A;  5A69 A;  1SR9 A;  2EOM A;  3UK3 C;  4LFC E;  1F2I G;  4R2A A;  3KWR A;  3F6H A;  2EJ4 A;  4JI7 E;  4GKJ E;  1UHZ A;  1X6F A;  1N36 E;  2B7T A;  1YYW A;  1PJS A;  2M4I A;  2KHX A;  2H36 X;  5LMU E;  4Q35 B;  2EMF A;  4JI6 E;  2EMZ A;  2EOZ A;  4NXN E;  1EH7 A;  2UXC E;  1XNR E;  2B3T B;  4RH8 A;  4JI0 E;  1SFE A;  1N32 E;  4YY3 E;  2EL4 A;  3M99 B;  2GLI A;  3THO B;  3ADL A;  4JI3 E;  1DQ3 A;  2JWO A;  4HEI A;  3EPL A;  3ADG A;  2V88 A;  3F6G A;  3BID A;  1O0W A;  4DR6 E;  3IWD A;  4GEQ B;  4LF6 E;  2JOB A;  5A6K A;  2FV4 B;  2N3H A;  4RHB B;  2M9A A;  1YYK A;  4BCA A;  1DGC A;  4LF7 E;  4ZYD A;  2EMC A;  4LF8 E;  3C4T A;  2LO3 A;  3DF6 A;  2E5L E;  2EZ6 A;  2NAB A;  1ZU1 A;  2EN4 A;  2UUA E;  5A6A A;  1RQ0 A;  2EOJ A;  2V8Q B;  2YZT A;  3J7A G;  3H09 A;  2EMW A;  2ELY A;  2YSP A;  5AAS A;  1N33 E;  1IQS A;  4R03 A;  4F9B B;  2WBS A;  4DV1 E;  4M0V A;  2LMZ A;  2EQ0 A;  2EOI A;  3FIG A;  1KJK A;  2YTE A;  2WBT A;  1TN9 A;  4DR7 E;  1IBL E;  2YTQ A;  4MLQ A;  2R1F A;  2LCE A;  2EOS A;  3RMP A;  4DUY E;  2CT1 A;  2EQ3 A;  5T6J A;  4O4K A;  5A6B D;  3KZY A;  3OML A;  1BBG A;  1IBK E;  2EM5 A;  3L00 A;  1HR0 E;  2DRP A;  4JI8 E;  2VRD A;  1A1J A;  1YUJ A;  2YTN A;  5DNY A;  1JK1 A;  3J81 C;  5LLQ A;  2ZM6 E;  1JK2 A;  5LL6 R;  1AAY A;  4L8N A;  4IJD A;  2R76 A;  2LTS A;  2HHH E;  3MSW A;  2VE7 C;  4BS9 A;  3VYX A;  3BBG A;  4F6N A;  2DSY A;  2PRT A;  4R8O A;  2EMH A;  4JI4 E;  4DV5 E;  1LLM C;  5BR8 E;  4LFA E;  4ZYH A;  1IBM E;  2EOX A;  3C6M A;  4DR4 E;  1HNZ E;  2JPA A;  4JI1 E;  2YU5 A;  1HNX E;  4BHB A;  2M7Q A;  1P47 A;  4O5G A;  3AV0 A;  4TUG A;  2V83 A;  2MC5 A;  1WHN A;  1A1L A;  4DMI A;  2IHR 1;  2LRS A;  2K7I A;  2DB2 A;  4F6M A;  2Q8U A;  1RC7 A;  4O24 A;  3C6K A;  4JI2 E;  2MKN A;  1DI2 A;  1YSA C;  5CFF E;  5KL3 A;  4R2Q A;  2LV2 A;  3AUZ A;  1UN6 B;  4WFT A;  4DR5 E;  2NA2 A;  4JI5 E;  3LML A;  4R2C A;  2GHF A;  2D9H A;  5KL5 A;  2F8B A;  1MGT A;  2L3C A;  4R2R A;  1WJP A;  4LTY A;  1HNW E;  2YT4 A;  5ADZ A;  5AC4 A;  3DJW A;  2NUG A;  5AE3 A;  2LUP B;  4WXD A;  2LBS B;  4WSG A;  4K0K E;  2ENH A;  2YTJ A;  3JU0 A;  2EMA A;  2L2K B;  4WSP A;  3IWB A;  2ENC A;  4OOG C;  3ADI A;  2EMK A;  3BGH A;  1ZAA C;  2JYA A;  4F2J C;  4LF5 E;  2WBU A;  2ENA A;  2V89 A;  5IV8 B;  1XNQ E;  2EQ1 A;  1WRJ A;  4DV3 E;  4BHC A;  1YPN A;  1XMO E;  2UUB E;  4B3R E;  3HXL A;  2BBG A;  2JVA A;  2B9D A;  2EOH A;  3C4B A;  2J7J A;  1KYQ A;  2YTI A;  2UXB E;  2YTD A;  1AH5 A;  2DGC A;  3MHH C;  2EPA A;  1NEI A;  2EOY A;  1BBO A;  2RSI A;  2LT7 A;  1IMU A;  1T4N A;  5TSE A;  1XMQ E;  2DIX A;  2YPN A;  4B3M E;  2CSH A;  2L92 A;  1X48 A;  4X9J A;  3HTX A;  1YYO A;  5A6J A;  3P1X A; 
#chains in the Genus database with same CATH homology
 2EJ4 A;  2EMH A;  2YU8 A;  2LVH A;  2EL5 A;  2YTP A;  1LLM C;  1X6F A;  2MKD A;  2EM9 A;  2EN1 A;  1X3C A;  2EOX A;  4R2P A;  2EPR A;  2JPA A;  5KL2 A;  2E72 A;  2DLK A;  2YU5 A;  2EMF A;  2EMZ A;  2EOZ A;  1X5W A;  1X6E A;  2EPX A;  1P47 A;  2ADR A;  2EOO A;  2EPC A;  4R2S A;  4IS1 C;  2CTD A;  1A1L A;  1G2F C;  2BB8 A;  2WCC 3;  2EL4 A;  2EOE A;  2EMY A;  2YRK A;  4F6M A;  3M99 B;  2GLI A;  1ZR9 A;  3EPK A;  4R2D A;  1MEY C;  3EPL A;  2MKN A;  1NCS A;  1YSA C;  2YRH A;  5KL3 A;  2EMI A;  4R2Q A;  2LV2 A;  2EE8 A;  2EM7 A;  1B69 A;  1UN6 B;  2EM2 A;  1A1K A;  4R2C A;  2EN7 A;  2M9A A;  2EL6 A;  1DGC A;  2EMX A;  2EMC A;  2GHF A;  2D9H A;  1G2D C;  5KL5 A;  2LO3 A;  2DLQ A;  2EN3 A;  2EOF A;  1YUI A;  2YTF A;  2NAB A;  1ZU1 A;  4R2R A;  2EN4 A;  4FK5 C;  1WJP A;  2EOJ A;  2RPC A;  2YRM A;  1TF3 A;  2EM8 A;  2EMW A;  2ELY A;  2EMG A;  2YSP A;  4WSG A;  1A1F A;  1A1H A;  1A1G A;  2ENH A;  2YTJ A;  3EPJ A;  2EMA A;  2YTG A;  2WBS A;  2I13 A;  2ENC A;  2EM0 A;  2EMK A;  1KJK A;  2DMI A;  2EOI A;  2EQ0 A;  2EOR A;  2YTE A;  2WBT A;  5KL7 A;  5KL6 A;  1ZAA C;  2EPP A;  1RMD A;  4F2J C;  1TN9 A;  2WBU A;  2ENA A;  2YTQ A;  2EQ1 A;  2R1F A;  4GZN C;  2LCE A;  2JP9 A;  2EMB A;  2EOS A;  2EM6 A;  1A1I A;  1BB8 A;  2EML A;  2EOQ A;  2CT1 A;  2EQ3 A;  4M9V C;  2EOH A;  2EPU A;  2J7J A;  2MDG A;  2EN6 A;  2YTI A;  1UBD C;  3MHS C;  1TF6 A;  2EM4 A;  2EN2 A;  2EM5 A;  2EP3 A;  2YSO A;  2YTD A;  2DRP A;  2DGC A;  1X6H A;  2VRD A;  3MHH C;  2HGH A;  2EPZ A;  1A1J A;  2EPA A;  4R2E A;  1YUJ A;  1Z1B A;  2EOY A;  2YTN A;  1BBO A;  2RSI A;  2A25 A;  2LT7 A;  2EM3 A;  2YTO A;  1JK1 A;  2EN8 A;  1JK2 A;  1AAY A;  5KL4 A;  2EOM A;  3UK3 C;  2CSH A;  4IJD A;  1F2I G;  3VHT B;  4X9J A;  4R2A A;  4F6N A;  2PRT A;  3EPH A;  2ELZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...