2WBSA

Crystal structure of the zinc finger domain of klf4 bound to its target dna
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
87
structure length
87
Chain Sequence
TATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords KRUEPPEL-LIKE FACTOR 4
publication title The Structure of the Klf4 DNA-Binding Domain Links to Self-Renewal and Macrophage Differentiation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 25
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2009-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2wbsA00
2EMBA 2EMYA 2EN6A 2EN3A 2EOZA 4R2PA 1LLMC 1A1IA 1JK2A 2ENCA 2LO3A 4R2DA 1F2IG 4M9VC 2YU5A 2LVHA 2EOEA 2EMKA 2EPUA 2YTDA 2EOIA 2BB8A 4R2QA 2EM2A 2YTFA 2JPAA 2YRHA 2EM7A 1B69A 2DLQA 2YRKA 2WBTA 1MEYC 3EPJA 3M99B 2EOFA 1X6FA 2A25A 2EM0A 2EOMA 1TF6A 2CT1A 2EE8A 1X6EA 1WJPA 1DGCA 2EPXA 2YTJA 2YTGA 2EL5A 4FK5C 2EN8A 2EOXA 1Z1BA 1G2FC 2HGHA 2I13A 2EOYA 2EMIA 2EOJA 5KL4A 2MKDA 1A1GA 2YTOA 1A1KA 1AAYA 5KL5A 2YTPA 2PRTA 2EN4A 1RMDA 2JP9A 2EMXA 2YSPA 2YTIA 2EPCA 1X6HA 4F6NA 2EN7A 4R2SA 5KL7A 2EPAA 4R2AA 2DLKA 5KL2A 4R2CA 1X3CA 1YUIA 2EPRA 2LCEA 1KJKA 2EOQA 2GLIA 4GZNC 2RPCA 2EMHA 2DMIA 2EMAA 1JK1A 2EL4A 1X5WA 3UK3C 1A1LA 2EMGA 2EM9A 2EP3A 2EQ1A 2EMWA 2ENAA 1ZAAC 2CTDA 1BBOA 2EPPA 5KL6A 1A1FA 2RSIA 2EJ4A 4IS1C 2ELZA 2YTEA 1TN9A 2EQ0A 1UN6B 2MKNA 2D9HA 2EL6A 4WSGA 2EOOA 2MDGA 2ELYA 2EM3A 4F2JC 2EMZA 1TF3A 2EN2A 3EPHA 4F6MA 2DGCA 2YRMA 3VHTB 2EM8A 2ENHA 4X9JA 1UBDC 3MHHC 5KL3A 2YTNA 2ADRA 4R2EA 1G2DC 2GHFA 3MHSC 2EOSA 2LV2A 2CSHA 1ZU1A 2EORA 2R1FA 2M9AA 2EM5A 2EN1A 2YTQA 2EM6A 2VRDA 4R2RA 1A1HA 1BB8A 2NABA 2WCC3 1ZR9A 2EPZA 2YU8A 2EMCA 2WBSA 2EM4A 2WBUA 2EMFA 2EMLA 1A1JA 1YSAC 2LT7A 1NCSA 1YUJA 2YSOA 3EPLA 2DRPA 2J7JA 4IJDA 2EOHA 1P47A 2EQ3A 2E72A 3EPKA
chains in the Genus database with same CATH superfamily
3LMLA 2EMBA 1X47A 3IWCA 4ZYGA 2N3GA 1WXRA 1A1IA 4M9VC 4X62E 1N36E 2YTDA 4GEQB 4DV1E 2YTFA 2DLQA 4O4KA 1EH7A 3EPJA 2NUFA 2EOFA 2EM0A 4X65E 1TF6A 4LF4E 2EE8A 1X6EA 3F6HA 4DR1E 2UXDE 2EPOA 4M30A 2EL5A 4NXNE 4LFCE 2K7IA 3LLHA 5TSEA 5KL4A 2UUBE 5AE1A 2KHXA 4X64E 1ZBQA 2HC5A 1RMDA 1UILA 2JP9A 2YSPA 4HTGA 1T38A 2L2NA 2EN7A 2MDRA 2UXBE 4L8NA 1N3GA 4M2ZA 5A2QC 2EOQA 1STUA 2L3CA 1YZ9A 4LF5E 1GQEA 1X5WA 4DR2E 2JR1A 2EM9A 5BR8E 2LRSA 4MLQA 2EWLA 3HXLA 5LLQA 4JI7E 2EQ0A 1UN6B 2MKNA 2D9HA 5A6BD 2MDGA 1WHQA 5F3WA 3EPHA 2L3JA 2JXPA 4ZYHA 1UBDC 4NHRA 4R2EA 3K6QA 1G2DC 3QG5C 2RTXA 4DV0E 3BBGA 2B9DA 4OOGC 2R1FA 2EM5A 4K0KE 4DMIA 1A1HA 2EM6A 2B7VA 2M1SA 1BB8A 2NABA 2JOBA 2FTXB 2WBSA 4JI8E 3ECRA 1YSAC 2LT7A 1NCSA 3OTOE 2DRPA 1N32E 2RS6A 4Q35B 3ADGA 3JAMC 2LBSB 2EN6A 2EN3A 2EOZA 4R03A 4R2PA 2UU9E 4R2DA 1F2IG 1MGTA 1N34E 2EZ6A 2EMKA 2DIXA 2DMYA 1NEIA 2EOIA 4R2QA 4BHCA 2JPAA 2YRHA 2L6MA 2KOUA 1MEYC 3M99B 2CPNA 1X49A 4TUIA 1WJPA 4LFAE 1DGCA 2YTJA 2YTGA 2LMZA 1Z1BA 2I13A 2LJHA 2E5LE 4O43A 3BIDA 2EMIA 4BCAA 2EOJA 1L4SA 1A1GA 4JI4E 2VQFE 2YTOA 1PKPA 1A1KA 2UUCE 4HEIA 2YTPA 5A6JA 2PRTA 2JWOA 4F54A 2YTIA 3P1XA 5DNYA 3RMPA 1X6HA 2DLKA 4B3TE 1BBGA 4LF6E 4B3RE 2YWQA 4F9BB 5A6AA 2LCEA 1YUIA 2GLIA 2DMIA 4NZVA 2YPNA 4WXDA 4DV5E 1SR9A 2FV4B 2EJ4A 4IS1C 2RSMA 1DI2A 2YTEA 1TN9A 2UXCE 4J8ZA 3BF2A 3J7Yp 3C6KA 2EMZA 4RHBB 4F2JC 1WHNA 5A6BA 2DGCA 1HNWE 3HQ1A 2G7HA 2ENHA 2DSYA 3J81C 2FGGA 2L2MA 1IBKE 4P7DA 3AV0A 3HPSA 2BBGA 2LUQA 2GHFA 4AQYE 3MHSC 2EOSA 5CFFE 2CSHA 4GKJE 2K4VA 5AE2A 1XNRE 4R2RA 2ODRD 1GTKA 2WCC3 2EMCA 5FLXC 3F6GA 1IBME 2MC6A 2F8BA 1A1JA 4YY3E 1HNZE 1WRJA 1YUJA 4KHPE 2YSOA 2LTRA 3EPKA 4WYQB 2JVAA 3VYYA 2L2KB 2LUPB 3T1HE 3ADLA 2H36X 2EMYA 4JI2E 3JU0A 2ENCA 5IXMB 1HNXE 2R76A 2YU5A 4KWYA 4YHHE 3VYXA 2V85A 2EOEA 4JI6E 1KYQA 4ZYEA 1FKAE 4BC9A 1PDAA 2RS7A 2EM2A 2IHR1 1N33E 1T4LB 1B69A 2YRKA 2N3HA 2YT4A 3VK6A 1X6FA 2E1MA 4DV4E 2EPLX 2LE2A 5LMNE 2CT1A 2M4IA 1X48A 1J26A 2EPXA 4FK5C 2HGHA 5IWAE 5ADZA 2EOYA 2ODRC 2YZTA 2V87A 2MC5A 4WSPA 1AH5A 4L5NC 4OX9E 1AAYA 3J7AG 4O5GA 2EN4A 1PJSA 2EMXA 3IWDA 4LF9E 3C4BA 2EPCA 5IT9C 1XNQE 1RQ0A 3HPZA 5KL7A 5AASA 5KL2A 3ADJA 4R2CA 2JYAA 1X3CA 4JI1E 1KJKA 5LMUE 4GZNC 2RPCA 3TQMA 1YYOA 2EMAA 3ADIA 4ZYDA 1JK1A 2EMGA 2EQ1A 1O0WA 3L00A 1BBOA 2EPPA 1A1FA 3J80C 1IQSA 2B7TA 1YYKA 4I8OA 2EL6A 4WSGA 2EOOA 3THNA 3BGHA 2ELYA 1YYWA 5AC5A 3KWRA 4BBYA 4DR3E 2N8XA 4M0VA 4DR7E 4B3ME 1PJQA 2YRMA 3VHTB 2EM8A 4X9JA 2YTNA 2F4VE 2Q8UA 1EKZA 2HHHE 2B3TB 2LV2A 1HR0E 4DKKA 5AC4A 1ZU1A 2L33A 2EORA 2NUGA 4BHBA 4X66E 4F9CB 1XMQE 2YU8A 2EPMX 1J5EE 2GPIA 2EM4A 1ZBTA 2WBUA 2EMFA 2EMLA 2JOXA 4BS9A 3IWBA 2ZM6E 1FJGE 1SFEA 3EPLA 4O24A 2J7JA 4IJDA 2EOHA 4BMJA 1P47A 3EQ1A 2E72A 5IV8B 1EH8A 2V86A 1DQ3A 1LLMC 3DJWA 1UHZA 1JK2A 2LO3A 4DV3E 3FIGA 2LVHA 2EPUA 2EPKX 2BB8A 2WZOA 4B3SE 2L92A 2EM7A 4LF8E 2UUAE 2WBTA 4RH8A 4DV7E 1T4NA 1YFHA 4NXME 2A25A 2EOMA 4DV2E 1IQOA 1EH6A 4JI5E 3HTXA 2EN8A 2EOXA 2JY9A 3T1YE 4WFTA 1G2FC 3MSWA 2LTSA 3JTZA 4WXCA 1RC7A 3AUZA 2NUEA 2MKDA 2VE7C 4GKKE 5KL5A 4LTYA 4DUYE 5AE3A 2LJUA 2M7QA 2V89A 2HJJA 4F6NA 4R2SA 4R2AA 2EPAA 4LF7E 2EPRA 2L8TA 2EMHA 1XMOE 4X8WA 3THOB 2EL4A 4KZSA 4BC7A 3UK3C 1A1LA 4DR6E 2NA2A 2EP3A 4JYAE 2EMWA 2ENAA 1ZAAC 2V83A 2CTDA 4WX9A 2VQEE 2EPNA 2I9IA 3DF6A 4LU9A 2RSIA 5KL6A 4MLVA 2ELZA 1T4OA 5T6JA 1I94E 4JV5E 3C6MA 4N4RB 2EM3A 1TF3A 3KZZA 1QNTA 2EN2A 2VF1A 4F6MA 3OMLA 1IMUA 4LFBE 3MHHC 4F9AB 5KL3A 2ADRA 5A69A 2KONA 1IBLE 4Q28A 5A6KA 4P78A 2RQLA 5LL6R 2M9AA 2EN1A 4DV6E 1T39A 2YTQA 2VRDA 4DR4E 3H09A 4TUGA 1PJTA 1ZR9A 2EPZA 2V88A 4JI3E 3KZYA 1QU6A 3ZOQB 4WPYA 4JI0E 2V8QB 2DB2A 4DR5E 3C4TA 2EQ3A 1GZ6A 4R8OA 4DUZE 1YPNA
chains in the Genus database with same CATH topology
2EMBA 2EMYA 2EN6A 2EN3A 2EOZA 4R2PA 1LLMC 1A1IA 1JK2A 2ENCA 2LO3A 4R2DA 1F2IG 4M9VC 2YU5A 2LVHA 2EOEA 2EMKA 2EPUA 2YTDA 2EOIA 2BB8A 4R2QA 2EM2A 2YTFA 2JPAA 2YRHA 2EM7A 1B69A 2DLQA 2YRKA 2WBTA 1MEYC 3EPJA 3M99B 2EOFA 1X6FA 2A25A 2EM0A 2EOMA 1TF6A 2CT1A 2EE8A 1X6EA 1WJPA 1DGCA 2EPXA 2YTJA 2YTGA 2EL5A 4FK5C 2EN8A 2EOXA 1Z1BA 1G2FC 2HGHA 2I13A 2EOYA 2EMIA 2EOJA 5KL4A 2MKDA 1A1GA 2YTOA 1A1KA 1AAYA 5KL5A 2YTPA 2PRTA 2EN4A 1RMDA 2JP9A 2EMXA 2YSPA 2YTIA 2EPCA 1X6HA 4F6NA 2EN7A 4R2SA 5KL7A 2EPAA 4R2AA 2DLKA 5KL2A 4R2CA 1X3CA 1YUIA 2EPRA 2LCEA 1KJKA 2EOQA 2GLIA 4GZNC 2RPCA 2EMHA 2DMIA 2EMAA 1JK1A 2EL4A 1X5WA 3UK3C 1A1LA 2EMGA 2EM9A 2EP3A 2EQ1A 2EMWA 2ENAA 1ZAAC 2CTDA 1BBOA 2EPPA 5KL6A 1A1FA 2RSIA 2EJ4A 4IS1C 2ELZA 2YTEA 1TN9A 2EQ0A 1UN6B 2MKNA 2D9HA 2EL6A 4WSGA 2EOOA 2MDGA 2ELYA 2EM3A 4F2JC 2EMZA 1TF3A 2EN2A 3EPHA 4F6MA 2DGCA 2YRMA 3VHTB 2EM8A 2ENHA 4X9JA 1UBDC 3MHHC 5KL3A 2YTNA 2ADRA 4R2EA 1G2DC 2GHFA 3MHSC 2EOSA 2LV2A 2CSHA 1ZU1A 2EORA 2R1FA 2M9AA 2EM5A 2EN1A 2YTQA 2EM6A 2VRDA 4R2RA 1A1HA 1BB8A 2NABA 2WCC3 1ZR9A 2EPZA 2YU8A 2EMCA 2WBSA 2EM4A 2WBUA 2EMFA 2EMLA 1A1JA 1YSAC 2LT7A 1NCSA 1YUJA 2YSOA 3EPLA 2DRPA 2J7JA 4IJDA 2EOHA 1P47A 2EQ3A 2E72A 3EPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMB A;  2EMY A;  2EN6 A;  2EN3 A;  2EOZ A;  4R2P A;  1LLM C;  1A1I A;  1JK2 A;  2ENC A;  2LO3 A;  4R2D A;  1F2I G;  4M9V C;  2YU5 A;  2LVH A;  2EOE A;  2EMK A;  2EPU A;  2YTD A;  2EOI A;  2BB8 A;  4R2Q A;  2EM2 A;  2YTF A;  2JPA A;  2YRH A;  2EM7 A;  1B69 A;  2DLQ A;  2YRK A;  2WBT A;  1MEY C;  3EPJ A;  3M99 B;  2EOF A;  1X6F A;  2A25 A;  2EM0 A;  2EOM A;  1TF6 A;  2CT1 A;  2EE8 A;  1X6E A;  1WJP A;  1DGC A;  2EPX A;  2YTJ A;  2YTG A;  2EL5 A;  4FK5 C;  2EN8 A;  2EOX A;  1Z1B A;  1G2F C;  2HGH A;  2I13 A;  2EOY A;  2EMI A;  2EOJ A;  5KL4 A;  2MKD A;  1A1G A;  2YTO A;  1A1K A;  1AAY A;  5KL5 A;  2YTP A;  2PRT A;  2EN4 A;  1RMD A;  2JP9 A;  2EMX A;  2YSP A;  2YTI A;  2EPC A;  1X6H A;  4F6N A;  2EN7 A;  4R2S A;  5KL7 A;  2EPA A;  4R2A A;  2DLK A;  5KL2 A;  4R2C A;  1X3C A;  1YUI A;  2EPR A;  2LCE A;  1KJK A;  2EOQ A;  2GLI A;  4GZN C;  2RPC A;  2EMH A;  2DMI A;  2EMA A;  1JK1 A;  2EL4 A;  1X5W A;  3UK3 C;  1A1L A;  2EMG A;  2EM9 A;  2EP3 A;  2EQ1 A;  2EMW A;  2ENA A;  1ZAA C;  2CTD A;  1BBO A;  2EPP A;  5KL6 A;  1A1F A;  2RSI A;  2EJ4 A;  4IS1 C;  2ELZ A;  2YTE A;  1TN9 A;  2EQ0 A;  1UN6 B;  2MKN A;  2D9H A;  2EL6 A;  4WSG A;  2EOO A;  2MDG A;  2ELY A;  2EM3 A;  4F2J C;  2EMZ A;  1TF3 A;  2EN2 A;  3EPH A;  4F6M A;  2DGC A;  2YRM A;  3VHT B;  2EM8 A;  2ENH A;  4X9J A;  1UBD C;  3MHH C;  5KL3 A;  2YTN A;  2ADR A;  4R2E A;  1G2D C;  2GHF A;  3MHS C;  2EOS A;  2LV2 A;  2CSH A;  1ZU1 A;  2EOR A;  2R1F A;  2M9A A;  2EM5 A;  2EN1 A;  2YTQ A;  2EM6 A;  2VRD A;  4R2R A;  1A1H A;  1BB8 A;  2NAB A;  2WCC 3;  1ZR9 A;  2EPZ A;  2YU8 A;  2EMC A;  2WBS A;  2EM4 A;  2WBU A;  2EMF A;  2EML A;  1A1J A;  1YSA C;  2LT7 A;  1NCS A;  1YUJ A;  2YSO A;  3EPL A;  2DRP A;  2J7J A;  4IJD A;  2EOH A;  1P47 A;  2EQ3 A;  2E72 A;  3EPK A; 
#chains in the Genus database with same CATH topology
 3LML A;  2EMB A;  1X47 A;  3IWC A;  4ZYG A;  2N3G A;  1WXR A;  1A1I A;  4M9V C;  4X62 E;  1N36 E;  2YTD A;  4GEQ B;  4DV1 E;  2YTF A;  2DLQ A;  4O4K A;  1EH7 A;  3EPJ A;  2NUF A;  2EOF A;  2EM0 A;  4X65 E;  1TF6 A;  4LF4 E;  2EE8 A;  1X6E A;  3F6H A;  4DR1 E;  2UXD E;  2EPO A;  4M30 A;  2EL5 A;  4NXN E;  4LFC E;  2K7I A;  3LLH A;  5TSE A;  5KL4 A;  2UUB E;  5AE1 A;  2KHX A;  4X64 E;  1ZBQ A;  2HC5 A;  1RMD A;  1UIL A;  2JP9 A;  2YSP A;  4HTG A;  1T38 A;  2L2N A;  2EN7 A;  2MDR A;  2UXB E;  4L8N A;  1N3G A;  4M2Z A;  5A2Q C;  2EOQ A;  1STU A;  2L3C A;  1YZ9 A;  4LF5 E;  1GQE A;  1X5W A;  4DR2 E;  2JR1 A;  2EM9 A;  5BR8 E;  2LRS A;  4MLQ A;  2EWL A;  3HXL A;  5LLQ A;  4JI7 E;  2EQ0 A;  1UN6 B;  2MKN A;  2D9H A;  5A6B D;  2MDG A;  1WHQ A;  5F3W A;  3EPH A;  2L3J A;  2JXP A;  4ZYH A;  1UBD C;  4NHR A;  4R2E A;  3K6Q A;  1G2D C;  3QG5 C;  2RTX A;  4DV0 E;  3BBG A;  2B9D A;  4OOG C;  2R1F A;  2EM5 A;  4K0K E;  4DMI A;  1A1H A;  2EM6 A;  2B7V A;  2M1S A;  1BB8 A;  2NAB A;  2JOB A;  2FTX B;  2WBS A;  4JI8 E;  3ECR A;  1YSA C;  2LT7 A;  1NCS A;  3OTO E;  2DRP A;  1N32 E;  2RS6 A;  4Q35 B;  3ADG A;  3JAM C;  2LBS B;  2EN6 A;  2EN3 A;  2EOZ A;  4R03 A;  4R2P A;  2UU9 E;  4R2D A;  1F2I G;  1MGT A;  1N34 E;  2EZ6 A;  2EMK A;  2DIX A;  2DMY A;  1NEI A;  2EOI A;  4R2Q A;  4BHC A;  2JPA A;  2YRH A;  2L6M A;  2KOU A;  1MEY C;  3M99 B;  2CPN A;  1X49 A;  4TUI A;  1WJP A;  4LFA E;  1DGC A;  2YTJ A;  2YTG A;  2LMZ A;  1Z1B A;  2I13 A;  2LJH A;  2E5L E;  4O43 A;  3BID A;  2EMI A;  4BCA A;  2EOJ A;  1L4S A;  1A1G A;  4JI4 E;  2VQF E;  2YTO A;  1PKP A;  1A1K A;  2UUC E;  4HEI A;  2YTP A;  5A6J A;  2PRT A;  2JWO A;  4F54 A;  2YTI A;  3P1X A;  5DNY A;  3RMP A;  1X6H A;  2DLK A;  4B3T E;  1BBG A;  4LF6 E;  4B3R E;  2YWQ A;  4F9B B;  5A6A A;  2LCE A;  1YUI A;  2GLI A;  2DMI A;  4NZV A;  2YPN A;  4WXD A;  4DV5 E;  1SR9 A;  2FV4 B;  2EJ4 A;  4IS1 C;  2RSM A;  1DI2 A;  2YTE A;  1TN9 A;  2UXC E;  4J8Z A;  3BF2 A;  3J7Y p;  3C6K A;  2EMZ A;  4RHB B;  4F2J C;  1WHN A;  5A6B A;  2DGC A;  1HNW E;  3HQ1 A;  2G7H A;  2ENH A;  2DSY A;  3J81 C;  2FGG A;  2L2M A;  1IBK E;  4P7D A;  3AV0 A;  3HPS A;  2BBG A;  2LUQ A;  2GHF A;  4AQY E;  3MHS C;  2EOS A;  5CFF E;  2CSH A;  4GKJ E;  2K4V A;  5AE2 A;  1XNR E;  4R2R A;  2ODR D;  1GTK A;  2WCC 3;  2EMC A;  5FLX C;  3F6G A;  1IBM E;  2MC6 A;  2F8B A;  1A1J A;  4YY3 E;  1HNZ E;  1WRJ A;  1YUJ A;  4KHP E;  2YSO A;  2LTR A;  3EPK A;  4WYQ B;  2JVA A;  3VYY A;  2L2K B;  2LUP B;  3T1H E;  3ADL A;  2H36 X;  2EMY A;  4JI2 E;  3JU0 A;  2ENC A;  5IXM B;  1HNX E;  2R76 A;  2YU5 A;  4KWY A;  4YHH E;  3VYX A;  2V85 A;  2EOE A;  4JI6 E;  1KYQ A;  4ZYE A;  1FKA E;  4BC9 A;  1PDA A;  2RS7 A;  2EM2 A;  2IHR 1;  1N33 E;  1T4L B;  1B69 A;  2YRK A;  2N3H A;  2YT4 A;  3VK6 A;  1X6F A;  2E1M A;  4DV4 E;  2EPL X;  2LE2 A;  5LMN E;  2CT1 A;  2M4I A;  1X48 A;  1J26 A;  2EPX A;  4FK5 C;  2HGH A;  5IWA E;  5ADZ A;  2EOY A;  2ODR C;  2YZT A;  2V87 A;  2MC5 A;  4WSP A;  1AH5 A;  4L5N C;  4OX9 E;  1AAY A;  3J7A G;  4O5G A;  2EN4 A;  1PJS A;  2EMX A;  3IWD A;  4LF9 E;  3C4B A;  2EPC A;  5IT9 C;  1XNQ E;  1RQ0 A;  3HPZ A;  5KL7 A;  5AAS A;  5KL2 A;  3ADJ A;  4R2C A;  2JYA A;  1X3C A;  4JI1 E;  1KJK A;  5LMU E;  4GZN C;  2RPC A;  3TQM A;  1YYO A;  2EMA A;  3ADI A;  4ZYD A;  1JK1 A;  2EMG A;  2EQ1 A;  1O0W A;  3L00 A;  1BBO A;  2EPP A;  1A1F A;  3J80 C;  1IQS A;  2B7T A;  1YYK A;  4I8O A;  2EL6 A;  4WSG A;  2EOO A;  3THN A;  3BGH A;  2ELY A;  1YYW A;  5AC5 A;  3KWR A;  4BBY A;  4DR3 E;  2N8X A;  4M0V A;  4DR7 E;  4B3M E;  1PJQ A;  2YRM A;  3VHT B;  2EM8 A;  4X9J A;  2YTN A;  2F4V E;  2Q8U A;  1EKZ A;  2HHH E;  2B3T B;  2LV2 A;  1HR0 E;  4DKK A;  5AC4 A;  1ZU1 A;  2L33 A;  2EOR A;  2NUG A;  4BHB A;  4X66 E;  4F9C B;  1XMQ E;  2YU8 A;  2EPM X;  1J5E E;  2GPI A;  2EM4 A;  1ZBT A;  2WBU A;  2EMF A;  2EML A;  2JOX A;  4BS9 A;  3IWB A;  2ZM6 E;  1FJG E;  1SFE A;  3EPL A;  4O24 A;  2J7J A;  4IJD A;  2EOH A;  4BMJ A;  1P47 A;  3EQ1 A;  2E72 A;  5IV8 B;  1EH8 A;  2V86 A;  1DQ3 A;  1LLM C;  3DJW A;  1UHZ A;  1JK2 A;  2LO3 A;  4DV3 E;  3FIG A;  2LVH A;  2EPU A;  2EPK X;  2BB8 A;  2WZO A;  4B3S E;  2L92 A;  2EM7 A;  4LF8 E;  2UUA E;  2WBT A;  4RH8 A;  4DV7 E;  1T4N A;  1YFH A;  4NXM E;  2A25 A;  2EOM A;  4DV2 E;  1IQO A;  1EH6 A;  4JI5 E;  3HTX A;  2EN8 A;  2EOX A;  2JY9 A;  3T1Y E;  4WFT A;  1G2F C;  3MSW A;  2LTS A;  3JTZ A;  4WXC A;  1RC7 A;  3AUZ A;  2NUE A;  2MKD A;  2VE7 C;  4GKK E;  5KL5 A;  4LTY A;  4DUY E;  5AE3 A;  2LJU A;  2M7Q A;  2V89 A;  2HJJ A;  4F6N A;  4R2S A;  4R2A A;  2EPA A;  4LF7 E;  2EPR A;  2L8T A;  2EMH A;  1XMO E;  4X8W A;  3THO B;  2EL4 A;  4KZS A;  4BC7 A;  3UK3 C;  1A1L A;  4DR6 E;  2NA2 A;  2EP3 A;  4JYA E;  2EMW A;  2ENA A;  1ZAA C;  2V83 A;  2CTD A;  4WX9 A;  2VQE E;  2EPN A;  2I9I A;  3DF6 A;  4LU9 A;  2RSI A;  5KL6 A;  4MLV A;  2ELZ A;  1T4O A;  5T6J A;  1I94 E;  4JV5 E;  3C6M A;  4N4R B;  2EM3 A;  1TF3 A;  3KZZ A;  1QNT A;  2EN2 A;  2VF1 A;  4F6M A;  3OML A;  1IMU A;  4LFB E;  3MHH C;  4F9A B;  5KL3 A;  2ADR A;  5A69 A;  2KON A;  1IBL E;  4Q28 A;  5A6K A;  4P78 A;  2RQL A;  5LL6 R;  2M9A A;  2EN1 A;  4DV6 E;  1T39 A;  2YTQ A;  2VRD A;  4DR4 E;  3H09 A;  4TUG A;  1PJT A;  1ZR9 A;  2EPZ A;  2V88 A;  4JI3 E;  3KZY A;  1QU6 A;  3ZOQ B;  4WPY A;  4JI0 E;  2V8Q B;  2DB2 A;  4DR5 E;  3C4T A;  2EQ3 A;  1GZ6 A;  4R8O A;  4DUZ E;  1YPN A; 
#chains in the Genus database with same CATH homology
 2EMB A;  2EMY A;  2EN6 A;  2EN3 A;  2EOZ A;  4R2P A;  1LLM C;  1A1I A;  1JK2 A;  2ENC A;  2LO3 A;  4R2D A;  1F2I G;  4M9V C;  2YU5 A;  2LVH A;  2EOE A;  2EMK A;  2EPU A;  2YTD A;  2EOI A;  2BB8 A;  4R2Q A;  2EM2 A;  2YTF A;  2JPA A;  2YRH A;  2EM7 A;  1B69 A;  2DLQ A;  2YRK A;  2WBT A;  1MEY C;  3EPJ A;  3M99 B;  2EOF A;  1X6F A;  2A25 A;  2EM0 A;  2EOM A;  1TF6 A;  2CT1 A;  2EE8 A;  1X6E A;  1WJP A;  1DGC A;  2EPX A;  2YTJ A;  2YTG A;  2EL5 A;  4FK5 C;  2EN8 A;  2EOX A;  1Z1B A;  1G2F C;  2HGH A;  2I13 A;  2EOY A;  2EMI A;  2EOJ A;  5KL4 A;  2MKD A;  1A1G A;  2YTO A;  1A1K A;  1AAY A;  5KL5 A;  2YTP A;  2PRT A;  2EN4 A;  1RMD A;  2JP9 A;  2EMX A;  2YSP A;  2YTI A;  2EPC A;  1X6H A;  4F6N A;  2EN7 A;  4R2S A;  5KL7 A;  2EPA A;  4R2A A;  2DLK A;  5KL2 A;  4R2C A;  1X3C A;  1YUI A;  2EPR A;  2LCE A;  1KJK A;  2EOQ A;  2GLI A;  4GZN C;  2RPC A;  2EMH A;  2DMI A;  2EMA A;  1JK1 A;  2EL4 A;  1X5W A;  3UK3 C;  1A1L A;  2EMG A;  2EM9 A;  2EP3 A;  2EQ1 A;  2EMW A;  2ENA A;  1ZAA C;  2CTD A;  1BBO A;  2EPP A;  5KL6 A;  1A1F A;  2RSI A;  2EJ4 A;  4IS1 C;  2ELZ A;  2YTE A;  1TN9 A;  2EQ0 A;  1UN6 B;  2MKN A;  2D9H A;  2EL6 A;  4WSG A;  2EOO A;  2MDG A;  2ELY A;  2EM3 A;  4F2J C;  2EMZ A;  1TF3 A;  2EN2 A;  3EPH A;  4F6M A;  2DGC A;  2YRM A;  3VHT B;  2EM8 A;  2ENH A;  4X9J A;  1UBD C;  3MHH C;  5KL3 A;  2YTN A;  2ADR A;  4R2E A;  1G2D C;  2GHF A;  3MHS C;  2EOS A;  2LV2 A;  2CSH A;  1ZU1 A;  2EOR A;  2R1F A;  2M9A A;  2EM5 A;  2EN1 A;  2YTQ A;  2EM6 A;  2VRD A;  4R2R A;  1A1H A;  1BB8 A;  2NAB A;  2WCC 3;  1ZR9 A;  2EPZ A;  2YU8 A;  2EMC A;  2WBS A;  2EM4 A;  2WBU A;  2EMF A;  2EML A;  1A1J A;  1YSA C;  2LT7 A;  1NCS A;  1YUJ A;  2YSO A;  3EPL A;  2DRP A;  2J7J A;  4IJD A;  2EOH A;  1P47 A;  2EQ3 A;  2E72 A;  3EPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...