2WBSA

Crystal structure of the zinc finger domain of klf4 bound to its target dna
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
87
structure length
87
Chain Sequence
TATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords KRUEPPEL-LIKE FACTOR 4
publication title The Structure of the Klf4 DNA-Binding Domain Links to Self-Renewal and Macrophage Differentiation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 25
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2009-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2wbsA00
4M9VC 2EOMA 2YTDA 2YRKA 1YSAC 2YTPA 4R2RA 1A1JA 2YSPA 2EM4A 5KL5A 2YRMA 1B69A 2EN6A 2EN1A 2YTEA 2I13A 4X9JA 2EMZA 2JPAA 3EPHA 3M99B 2WCC3 1G2DC 2EOHA 2EMKA 1UBDC 2YSOA 2WBUA 1YUJA 3UK3C 2EMYA 2EPZA 1JK2A 2PRTA 1A1FA 2EN8A 1KJKA 4GZNC 2EMIA 1X6FA 1F2IG 2EPRA 1X6HA 1X3CA 4WSGA 2EMCA 2EOFA 2YTFA 2EQ3A 1A1LA 2EOSA 2YTQA 4R2EA 2RPCA 1X6EA 4R2DA 1ZAAC 4F6MA 2EOQA 2YTJA 1X5WA 4F6NA 2MDGA 2D9HA 1MEYC 1NCSA 2LVHA 2GLIA 1AAYA 2MKNA 2HGHA 2M9AA 2EM2A 1LLMC 1TF3A 1BB8A 2J7JA 3MHSC 2JP9A 2ADRA 2EQ0A 3EPJA 1Z1BA 2YTGA 4R2CA 4IS1C 2DRPA 2EN3A 2EMBA 2YTOA 2EM8A 2LT7A 1TF6A 1UN6B 2DLQA 2VRDA 2EJ4A 2EPAA 2EL6A 5KL7A 1JK1A 2EP3A 2EMHA 2RSIA 1YUIA 2YTIA 3MHHC 1TN9A 2EE8A 2EN7A 2EOXA 3EPKA 2EOEA 2EOIA 1ZR9A 3VHTB 2ELYA 5KL6A 2EPCA 4R2AA 2A25A 1P47A 2EOJA 4R2PA 1BBOA 2EM9A 2EORA 2DGCA 3EPLA 4F2JC 2CSHA 4R2SA 1A1HA 2EM3A 2EQ1A 2WBSA 1WJPA 5KL3A 2EN4A 5KL4A 1DGCA 2CTDA 1ZU1A 2ENCA 2ENAA 2YU8A 4IJDA 2E72A 2EOYA 2WBTA 1A1IA 1RMDA 5KL2A 2EM5A 1A1KA 2LO3A 2CT1A 2DMIA 2LCEA 2LV2A 2ELZA 2YTNA 2EMLA 2R1FA 2EMAA 2YU5A 1G2FC 2ENHA 2BB8A 2EM0A 2EMWA 2EM6A 2EPPA 2EMFA 2EN2A 2EPXA 4R2QA 2EM7A 2EOZA 2EL4A 2GHFA 2DLKA 2YRHA 2MKDA 2EPUA 4FK5C 1A1GA 2NABA 2EMXA 2EOOA 2EL5A 2EMGA
chains in the Genus database with same CATH superfamily
2FV4B 5FLXC 2YRKA 2YTPA 4R2RA 3MSWA 2EM4A 2KOUA 5AE2A 2F4VE 1PDAA 2EN6A 3K6QA 4WX9A 3THNA 2EMZA 3EPHA 2HJJA 3M99B 2LJHA 1YYOA 5F3WA 4TUGA 2WZOA 2EMKA 1HNZE 1WHQA 2G7HA 1YUJA 2N3HA 2DSYA 2EPZA 3KWRA 3QG5C 2EN8A 4DMIA 2EMIA 1X6FA 1F2IG 1X6HA 2EMCA 4R2EA 5ADZA 4F6MA 2N3GA 1X5WA 2D9HA 4F54A 3THOB 5A2QC 1MEYC 2LMZA 2LVHA 1EH7A 2MKNA 2HGHA 3BIDA 2M7QA 3OTOE 3OMLA 2JP9A 2ADRA 4LU9A 3EPJA 2B9DA 3EQ1A 2YTGA 2NUGA 2DRPA 1QNTA 4DV3E 5BR8E 2LT7A 1T4OA 3BGHA 4M0VA 5A6BA 4DR2E 4BHBA 5AC5A 2EL6A 2RSIA 1T38A 2E5LE 3ADIA 3EPKA 1YYKA 4JI1E 4BC7A 2R76A 2EOIA 1ZR9A 3JU0A 2ELYA 4R2AA 1SR9A 2V88A 3T1YE 4R2PA 2Q8UA 1PJSA 2EM9A 2EORA 2RQLA 1BBOA 4B3TE 2LE2A 4WXCA 2M1SA 4R2SA 5IT9C 2UU9E 1XMQE 1WJPA 1STUA 4HTGA 3ADGA 3KZYA 1WHNA 1J26A 1A1IA 1A1KA 2R1FA 3LLHA 2YU5A 4NZVA 4DR7E 1G2FC 2EM6A 2EMWA 3L00A 4R2QA 2EM7A 2EPLX 1EH6A 4P78A 4P7DA 4DKKA 1A1GA 1EKZA 1BBGA 2EOOA 3J7Yp 4N4RB 1XNRE 4F9CB 3F6GA 1YSAC 4LFCE 2MDRA 4KWYA 2L3CA 4ZYDA 2I13A 2FGGA 2N8XA 1G2DC 4L8NA 4KZSA 2EOHA 3ADJA 1XNQE 3AUZA 1N3GA 4F9AB 1JK2A 2ODRC 4R03A 1KJKA 5LLQA 4WSGA 2L2KB 3TQMA 2EOFA 4JI0E 2NUEA 2E1MA 4WYQB 1N34E 4MLVA 2JOXA 1ZAAC 2L2NA 4F6NA 2MDGA 2L2MA 4M2ZA 2B3TB 5AE1A 4MLQA 4NXNE 3ECRA 2L8TA 2VF1A 1ZBQA 3J7AG 2EM2A 3AV0A 5IXMB 1HNXE 2MC5A 5AC4A 1X47A 2V8QB 2NUFA 2EQ0A 3IWBA 4R2CA 2YWQA 2EMBA 2YTOA 2CPNA 1RQ0A 4NHRA 2K4VA 2EPKX 2EJ4A 5KL7A 1JK1A 4DUZE 4X62E 1YUIA 3MHHC 4LF9E 4BS9A 2EOXA 2VQEE 2JWOA 2LUPB 3J80C 3VHTB 2UXBE 2F8BA 4DV5E 1J5EE 4BCAA 4K0KE 5IV8B 5T6JA 3EPLA 2VE7C 2EWLA 2EQ1A 1DI2A 2I9IA 2WBSA 2EN4A 4JI3E 2UXCE 4DR4E 2CTDA 2ENCA 1HNWE 4IJDA 2EOYA 2WBTA 4GKJE 1N32E 5AASA 2EZ6A 4WPYA 5AE3A 3H09A 3DJWA 2YTNA 4GEQB 4DR6E 3ZOQB 4BHCA 4JYAE 2MKDA 5TSEA 1QU6A 2DMYA 1AH5A 2EMXA 2YSOA 1SFEA 2JVAA 2EOMA 2YT4A 2V85A 4L5NC 2YTDA 4JI6E 2YSPA 5KL5A 2JYAA 3KZZA 3VYXA 2EN1A 2DB2A 2JPAA 2HHHE 2V89A 2WCC3 2EMYA 4R8OA 4GZNC 3IWDA 2EPRA 4M30A 2YTFA 2EQ3A 2EOSA 2YTQA 1IMUA 4R2DA 5CFFE 2EOQA 2YTJA 1WRJA 4LF8E 4WFTA 4ZYHA 4I8OA 2VQFE 4O5GA 2ZM6E 4B3ME 1NCSA 4JV5E 3BBGA 2GLIA 2L6MA 4F9BB 4LFAE 3HQ1A 5A6KA 1LLMC 1TF3A 4JI5E 1BB8A 2J7JA 4O4KA 4LF7E 4DV7E 2L92A 1X48A 1YPNA 1GZ6A 1XMOE 1T4NA 4WSPA 1UN6B 3C4TA 3HPSA 4WXDA 1RC7A 1PJTA 2EP3A 3HPZA 2EMHA 2LRSA 1X49A 1TN9A 4LF4E 3ADLA 1FJGE 2EOEA 2YPNA 2V83A 5KL6A 2EPCA 4ZYGA 4DV2E 2A25A 4GKKE 1PJQA 2JXPA 3J81C 2UXDE 4DR5E 1MGTA 2DGCA 3JTZA 3LMLA 3JAMC 1A1HA 2H36X 4AQYE 5KL3A 2V87A 1DGCA 2EPMX 3DF6A 4DV1E 2E72A 4DUYE 1RMDA 5KL2A 2EM5A 2CT1A 2LCEA 2LBSB 2LV2A 2ELZA 2EMAA 4JI4E 2ENHA 2BB8A 2EM0A 2KONA 3T1HE 2EL4A 2FTXB 2GHFA 2EPUA 4OOGC 3C6MA 1UHZA 3P1XA 2IHR1 1PKPA 2EMGA 2M4IA 1YYWA 4DV0E 1IBKE 4M9VC 4KHPE 5A6BD 4DV6E 1A1JA 5LL6R 1IBME 1T39A 1YFHA 2YRMA 1B69A 2DIXA 4Q28A 2B7VA 2LJUA 2YTEA 4X9JA 3VK6A 2YZTA 2LTRA 1O0WA 5LMUE 4X65E 4B3RE 1UBDC 4JI8E 1FKAE 2WBUA 3UK3C 4BC9A 2KHXA 2L3JA 2PRTA 1A1FA 4X66E 1X3CA 3IWCA 4JI2E 1A1LA 3HTXA 3RMPA 2RPCA 1X6EA 1T4LB 4YHHE 2RTXA 1WXRA 1IQSA 4LF6E 4DV4E 5IWAE 4HEIA 5A6JA 1AAYA 2HC5A 4RH8A 2M9AA 4ZYEA 5DNYA 1L4SA 4TUIA 3MHSC 4LF5E 4YY3E 1Z1BA 2MC6A 4IS1C 2RSMA 2EN3A 2RS7A 2EM8A 1IQOA 1TF6A 4B3SE 1N36E 4OX9E 2V86A 2L33A 3C4BA 2DLQA 2VRDA 2BBGA 4JI7E 2EPAA 2LUQA 1GTKA 4J8ZA 2YTIA 2EE8A 2EN7A 2ODRD 3FIGA 2B7TA 1ZBTA 4BBYA 3HXLA 2LTSA 4O43A 1KYQA 3VYYA 2UUAE 1YZ9A 4LFBE 4X8WA 1P47A 2EOJA 4LTYA 4RHBB 1DQ3A 2EPOA 3F6HA 2GPIA 4Q35B 2NA2A 4F2JC 2CSHA 1N33E 4X64E 2EM3A 5KL4A 1ZU1A 2ENAA 2YU8A 1IBLE 2EPNA 1HR0E 5A6AA 2LO3A 2K7IA 2DMIA 1GQEA 2JR1A 4O24A 4DR1E 2JY9A 5A69A 2EMLA 4NXME 2EPPA 3C6KA 2UUCE 2EMFA 2EN2A 1UILA 2EPXA 2RS6A 3BF2A 4DR3E 1EH8A 2EOZA 1NEIA 2DLKA 2YRHA 4BMJA 4FK5C 5LMNE 2NABA 2UUBE 2EL5A 2JOBA 1I94E
chains in the Genus database with same CATH topology
4M9VC 2EOMA 2YTDA 2YRKA 1YSAC 2YTPA 4R2RA 1A1JA 2YSPA 2EM4A 5KL5A 2YRMA 1B69A 2EN6A 2EN1A 2YTEA 2I13A 4X9JA 2EMZA 2JPAA 3EPHA 3M99B 2WCC3 1G2DC 2EOHA 2EMKA 1UBDC 2YSOA 2WBUA 1YUJA 3UK3C 2EMYA 2EPZA 1JK2A 2PRTA 1A1FA 2EN8A 1KJKA 4GZNC 2EMIA 1X6FA 1F2IG 2EPRA 1X6HA 1X3CA 4WSGA 2EMCA 2EOFA 2YTFA 2EQ3A 1A1LA 2EOSA 2YTQA 4R2EA 2RPCA 1X6EA 4R2DA 1ZAAC 4F6MA 2EOQA 2YTJA 1X5WA 4F6NA 2MDGA 2D9HA 1MEYC 1NCSA 2LVHA 2GLIA 1AAYA 2MKNA 2HGHA 2M9AA 2EM2A 1LLMC 1TF3A 1BB8A 2J7JA 3MHSC 2JP9A 2ADRA 2EQ0A 3EPJA 1Z1BA 2YTGA 4R2CA 4IS1C 2DRPA 2EN3A 2EMBA 2YTOA 2EM8A 2LT7A 1TF6A 1UN6B 2DLQA 2VRDA 2EJ4A 2EPAA 2EL6A 5KL7A 1JK1A 2EP3A 2EMHA 2RSIA 1YUIA 2YTIA 3MHHC 1TN9A 2EE8A 2EN7A 2EOXA 3EPKA 2EOEA 2EOIA 1ZR9A 3VHTB 2ELYA 5KL6A 2EPCA 4R2AA 2A25A 1P47A 2EOJA 4R2PA 1BBOA 2EM9A 2EORA 2DGCA 3EPLA 4F2JC 2CSHA 4R2SA 1A1HA 2EM3A 2EQ1A 2WBSA 1WJPA 5KL3A 2EN4A 5KL4A 1DGCA 2CTDA 1ZU1A 2ENCA 2ENAA 2YU8A 4IJDA 2E72A 2EOYA 2WBTA 1A1IA 1RMDA 5KL2A 2EM5A 1A1KA 2LO3A 2CT1A 2DMIA 2LCEA 2LV2A 2ELZA 2YTNA 2EMLA 2R1FA 2EMAA 2YU5A 1G2FC 2ENHA 2BB8A 2EM0A 2EMWA 2EM6A 2EPPA 2EMFA 2EN2A 2EPXA 4R2QA 2EM7A 2EOZA 2EL4A 2GHFA 2DLKA 2YRHA 2MKDA 2EPUA 4FK5C 1A1GA 2NABA 2EMXA 2EOOA 2EL5A 2EMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M9V C;  2EOM A;  2YTD A;  2YRK A;  1YSA C;  2YTP A;  4R2R A;  1A1J A;  2YSP A;  2EM4 A;  5KL5 A;  2YRM A;  1B69 A;  2EN6 A;  2EN1 A;  2YTE A;  2I13 A;  4X9J A;  2EMZ A;  2JPA A;  3EPH A;  3M99 B;  2WCC 3;  1G2D C;  2EOH A;  2EMK A;  1UBD C;  2YSO A;  2WBU A;  1YUJ A;  3UK3 C;  2EMY A;  2EPZ A;  1JK2 A;  2PRT A;  1A1F A;  2EN8 A;  1KJK A;  4GZN C;  2EMI A;  1X6F A;  1F2I G;  2EPR A;  1X6H A;  1X3C A;  4WSG A;  2EMC A;  2EOF A;  2YTF A;  2EQ3 A;  1A1L A;  2EOS A;  2YTQ A;  4R2E A;  2RPC A;  1X6E A;  4R2D A;  1ZAA C;  4F6M A;  2EOQ A;  2YTJ A;  1X5W A;  4F6N A;  2MDG A;  2D9H A;  1MEY C;  1NCS A;  2LVH A;  2GLI A;  1AAY A;  2MKN A;  2HGH A;  2M9A A;  2EM2 A;  1LLM C;  1TF3 A;  1BB8 A;  2J7J A;  3MHS C;  2JP9 A;  2ADR A;  2EQ0 A;  3EPJ A;  1Z1B A;  2YTG A;  4R2C A;  4IS1 C;  2DRP A;  2EN3 A;  2EMB A;  2YTO A;  2EM8 A;  2LT7 A;  1TF6 A;  1UN6 B;  2DLQ A;  2VRD A;  2EJ4 A;  2EPA A;  2EL6 A;  5KL7 A;  1JK1 A;  2EP3 A;  2EMH A;  2RSI A;  1YUI A;  2YTI A;  3MHH C;  1TN9 A;  2EE8 A;  2EN7 A;  2EOX A;  3EPK A;  2EOE A;  2EOI A;  1ZR9 A;  3VHT B;  2ELY A;  5KL6 A;  2EPC A;  4R2A A;  2A25 A;  1P47 A;  2EOJ A;  4R2P A;  1BBO A;  2EM9 A;  2EOR A;  2DGC A;  3EPL A;  4F2J C;  2CSH A;  4R2S A;  1A1H A;  2EM3 A;  2EQ1 A;  2WBS A;  1WJP A;  5KL3 A;  2EN4 A;  5KL4 A;  1DGC A;  2CTD A;  1ZU1 A;  2ENC A;  2ENA A;  2YU8 A;  4IJD A;  2E72 A;  2EOY A;  2WBT A;  1A1I A;  1RMD A;  5KL2 A;  2EM5 A;  1A1K A;  2LO3 A;  2CT1 A;  2DMI A;  2LCE A;  2LV2 A;  2ELZ A;  2YTN A;  2EML A;  2R1F A;  2EMA A;  2YU5 A;  1G2F C;  2ENH A;  2BB8 A;  2EM0 A;  2EMW A;  2EM6 A;  2EPP A;  2EMF A;  2EN2 A;  2EPX A;  4R2Q A;  2EM7 A;  2EOZ A;  2EL4 A;  2GHF A;  2DLK A;  2YRH A;  2MKD A;  2EPU A;  4FK5 C;  1A1G A;  2NAB A;  2EMX A;  2EOO A;  2EL5 A;  2EMG A; 
#chains in the Genus database with same CATH topology
 2FV4 B;  5FLX C;  2YRK A;  2YTP A;  4R2R A;  3MSW A;  2EM4 A;  2KOU A;  5AE2 A;  2F4V E;  1PDA A;  2EN6 A;  3K6Q A;  4WX9 A;  3THN A;  2EMZ A;  3EPH A;  2HJJ A;  3M99 B;  2LJH A;  1YYO A;  5F3W A;  4TUG A;  2WZO A;  2EMK A;  1HNZ E;  1WHQ A;  2G7H A;  1YUJ A;  2N3H A;  2DSY A;  2EPZ A;  3KWR A;  3QG5 C;  2EN8 A;  4DMI A;  2EMI A;  1X6F A;  1F2I G;  1X6H A;  2EMC A;  4R2E A;  5ADZ A;  4F6M A;  2N3G A;  1X5W A;  2D9H A;  4F54 A;  3THO B;  5A2Q C;  1MEY C;  2LMZ A;  2LVH A;  1EH7 A;  2MKN A;  2HGH A;  3BID A;  2M7Q A;  3OTO E;  3OML A;  2JP9 A;  2ADR A;  4LU9 A;  3EPJ A;  2B9D A;  3EQ1 A;  2YTG A;  2NUG A;  2DRP A;  1QNT A;  4DV3 E;  5BR8 E;  2LT7 A;  1T4O A;  3BGH A;  4M0V A;  5A6B A;  4DR2 E;  4BHB A;  5AC5 A;  2EL6 A;  2RSI A;  1T38 A;  2E5L E;  3ADI A;  3EPK A;  1YYK A;  4JI1 E;  4BC7 A;  2R76 A;  2EOI A;  1ZR9 A;  3JU0 A;  2ELY A;  4R2A A;  1SR9 A;  2V88 A;  3T1Y E;  4R2P A;  2Q8U A;  1PJS A;  2EM9 A;  2EOR A;  2RQL A;  1BBO A;  4B3T E;  2LE2 A;  4WXC A;  2M1S A;  4R2S A;  5IT9 C;  2UU9 E;  1XMQ E;  1WJP A;  1STU A;  4HTG A;  3ADG A;  3KZY A;  1WHN A;  1J26 A;  1A1I A;  1A1K A;  2R1F A;  3LLH A;  2YU5 A;  4NZV A;  4DR7 E;  1G2F C;  2EM6 A;  2EMW A;  3L00 A;  4R2Q A;  2EM7 A;  2EPL X;  1EH6 A;  4P78 A;  4P7D A;  4DKK A;  1A1G A;  1EKZ A;  1BBG A;  2EOO A;  3J7Y p;  4N4R B;  1XNR E;  4F9C B;  3F6G A;  1YSA C;  4LFC E;  2MDR A;  4KWY A;  2L3C A;  4ZYD A;  2I13 A;  2FGG A;  2N8X A;  1G2D C;  4L8N A;  4KZS A;  2EOH A;  3ADJ A;  1XNQ E;  3AUZ A;  1N3G A;  4F9A B;  1JK2 A;  2ODR C;  4R03 A;  1KJK A;  5LLQ A;  4WSG A;  2L2K B;  3TQM A;  2EOF A;  4JI0 E;  2NUE A;  2E1M A;  4WYQ B;  1N34 E;  4MLV A;  2JOX A;  1ZAA C;  2L2N A;  4F6N A;  2MDG A;  2L2M A;  4M2Z A;  2B3T B;  5AE1 A;  4MLQ A;  4NXN E;  3ECR A;  2L8T A;  2VF1 A;  1ZBQ A;  3J7A G;  2EM2 A;  3AV0 A;  5IXM B;  1HNX E;  2MC5 A;  5AC4 A;  1X47 A;  2V8Q B;  2NUF A;  2EQ0 A;  3IWB A;  4R2C A;  2YWQ A;  2EMB A;  2YTO A;  2CPN A;  1RQ0 A;  4NHR A;  2K4V A;  2EPK X;  2EJ4 A;  5KL7 A;  1JK1 A;  4DUZ E;  4X62 E;  1YUI A;  3MHH C;  4LF9 E;  4BS9 A;  2EOX A;  2VQE E;  2JWO A;  2LUP B;  3J80 C;  3VHT B;  2UXB E;  2F8B A;  4DV5 E;  1J5E E;  4BCA A;  4K0K E;  5IV8 B;  5T6J A;  3EPL A;  2VE7 C;  2EWL A;  2EQ1 A;  1DI2 A;  2I9I A;  2WBS A;  2EN4 A;  4JI3 E;  2UXC E;  4DR4 E;  2CTD A;  2ENC A;  1HNW E;  4IJD A;  2EOY A;  2WBT A;  4GKJ E;  1N32 E;  5AAS A;  2EZ6 A;  4WPY A;  5AE3 A;  3H09 A;  3DJW A;  2YTN A;  4GEQ B;  4DR6 E;  3ZOQ B;  4BHC A;  4JYA E;  2MKD A;  5TSE A;  1QU6 A;  2DMY A;  1AH5 A;  2EMX A;  2YSO A;  1SFE A;  2JVA A;  2EOM A;  2YT4 A;  2V85 A;  4L5N C;  2YTD A;  4JI6 E;  2YSP A;  5KL5 A;  2JYA A;  3KZZ A;  3VYX A;  2EN1 A;  2DB2 A;  2JPA A;  2HHH E;  2V89 A;  2WCC 3;  2EMY A;  4R8O A;  4GZN C;  3IWD A;  2EPR A;  4M30 A;  2YTF A;  2EQ3 A;  2EOS A;  2YTQ A;  1IMU A;  4R2D A;  5CFF E;  2EOQ A;  2YTJ A;  1WRJ A;  4LF8 E;  4WFT A;  4ZYH A;  4I8O A;  2VQF E;  4O5G A;  2ZM6 E;  4B3M E;  1NCS A;  4JV5 E;  3BBG A;  2GLI A;  2L6M A;  4F9B B;  4LFA E;  3HQ1 A;  5A6K A;  1LLM C;  1TF3 A;  4JI5 E;  1BB8 A;  2J7J A;  4O4K A;  4LF7 E;  4DV7 E;  2L92 A;  1X48 A;  1YPN A;  1GZ6 A;  1XMO E;  1T4N A;  4WSP A;  1UN6 B;  3C4T A;  3HPS A;  4WXD A;  1RC7 A;  1PJT A;  2EP3 A;  3HPZ A;  2EMH A;  2LRS A;  1X49 A;  1TN9 A;  4LF4 E;  3ADL A;  1FJG E;  2EOE A;  2YPN A;  2V83 A;  5KL6 A;  2EPC A;  4ZYG A;  4DV2 E;  2A25 A;  4GKK E;  1PJQ A;  2JXP A;  3J81 C;  2UXD E;  4DR5 E;  1MGT A;  2DGC A;  3JTZ A;  3LML A;  3JAM C;  1A1H A;  2H36 X;  4AQY E;  5KL3 A;  2V87 A;  1DGC A;  2EPM X;  3DF6 A;  4DV1 E;  2E72 A;  4DUY E;  1RMD A;  5KL2 A;  2EM5 A;  2CT1 A;  2LCE A;  2LBS B;  2LV2 A;  2ELZ A;  2EMA A;  4JI4 E;  2ENH A;  2BB8 A;  2EM0 A;  2KON A;  3T1H E;  2EL4 A;  2FTX B;  2GHF A;  2EPU A;  4OOG C;  3C6M A;  1UHZ A;  3P1X A;  2IHR 1;  1PKP A;  2EMG A;  2M4I A;  1YYW A;  4DV0 E;  1IBK E;  4M9V C;  4KHP E;  5A6B D;  4DV6 E;  1A1J A;  5LL6 R;  1IBM E;  1T39 A;  1YFH A;  2YRM A;  1B69 A;  2DIX A;  4Q28 A;  2B7V A;  2LJU A;  2YTE A;  4X9J A;  3VK6 A;  2YZT A;  2LTR A;  1O0W A;  5LMU E;  4X65 E;  4B3R E;  1UBD C;  4JI8 E;  1FKA E;  2WBU A;  3UK3 C;  4BC9 A;  2KHX A;  2L3J A;  2PRT A;  1A1F A;  4X66 E;  1X3C A;  3IWC A;  4JI2 E;  1A1L A;  3HTX A;  3RMP A;  2RPC A;  1X6E A;  1T4L B;  4YHH E;  2RTX A;  1WXR A;  1IQS A;  4LF6 E;  4DV4 E;  5IWA E;  4HEI A;  5A6J A;  1AAY A;  2HC5 A;  4RH8 A;  2M9A A;  4ZYE A;  5DNY A;  1L4S A;  4TUI A;  3MHS C;  4LF5 E;  4YY3 E;  1Z1B A;  2MC6 A;  4IS1 C;  2RSM A;  2EN3 A;  2RS7 A;  2EM8 A;  1IQO A;  1TF6 A;  4B3S E;  1N36 E;  4OX9 E;  2V86 A;  2L33 A;  3C4B A;  2DLQ A;  2VRD A;  2BBG A;  4JI7 E;  2EPA A;  2LUQ A;  1GTK A;  4J8Z A;  2YTI A;  2EE8 A;  2EN7 A;  2ODR D;  3FIG A;  2B7T A;  1ZBT A;  4BBY A;  3HXL A;  2LTS A;  4O43 A;  1KYQ A;  3VYY A;  2UUA E;  1YZ9 A;  4LFB E;  4X8W A;  1P47 A;  2EOJ A;  4LTY A;  4RHB B;  1DQ3 A;  2EPO A;  3F6H A;  2GPI A;  4Q35 B;  2NA2 A;  4F2J C;  2CSH A;  1N33 E;  4X64 E;  2EM3 A;  5KL4 A;  1ZU1 A;  2ENA A;  2YU8 A;  1IBL E;  2EPN A;  1HR0 E;  5A6A A;  2LO3 A;  2K7I A;  2DMI A;  1GQE A;  2JR1 A;  4O24 A;  4DR1 E;  2JY9 A;  5A69 A;  2EML A;  4NXM E;  2EPP A;  3C6K A;  2UUC E;  2EMF A;  2EN2 A;  1UIL A;  2EPX A;  2RS6 A;  3BF2 A;  4DR3 E;  1EH8 A;  2EOZ A;  1NEI A;  2DLK A;  2YRH A;  4BMJ A;  4FK5 C;  5LMN E;  2NAB A;  2UUB E;  2EL5 A;  2JOB A;  1I94 E; 
#chains in the Genus database with same CATH homology
 4M9V C;  2EOM A;  2YTD A;  2YRK A;  1YSA C;  2YTP A;  4R2R A;  1A1J A;  2YSP A;  2EM4 A;  5KL5 A;  2YRM A;  1B69 A;  2EN6 A;  2EN1 A;  2YTE A;  2I13 A;  4X9J A;  2EMZ A;  2JPA A;  3EPH A;  3M99 B;  2WCC 3;  1G2D C;  2EOH A;  2EMK A;  1UBD C;  2YSO A;  2WBU A;  1YUJ A;  3UK3 C;  2EMY A;  2EPZ A;  1JK2 A;  2PRT A;  1A1F A;  2EN8 A;  1KJK A;  4GZN C;  2EMI A;  1X6F A;  1F2I G;  2EPR A;  1X6H A;  1X3C A;  4WSG A;  2EMC A;  2EOF A;  2YTF A;  2EQ3 A;  1A1L A;  2EOS A;  2YTQ A;  4R2E A;  2RPC A;  1X6E A;  4R2D A;  1ZAA C;  4F6M A;  2EOQ A;  2YTJ A;  1X5W A;  4F6N A;  2MDG A;  2D9H A;  1MEY C;  1NCS A;  2LVH A;  2GLI A;  1AAY A;  2MKN A;  2HGH A;  2M9A A;  2EM2 A;  1LLM C;  1TF3 A;  1BB8 A;  2J7J A;  3MHS C;  2JP9 A;  2ADR A;  2EQ0 A;  3EPJ A;  1Z1B A;  2YTG A;  4R2C A;  4IS1 C;  2DRP A;  2EN3 A;  2EMB A;  2YTO A;  2EM8 A;  2LT7 A;  1TF6 A;  1UN6 B;  2DLQ A;  2VRD A;  2EJ4 A;  2EPA A;  2EL6 A;  5KL7 A;  1JK1 A;  2EP3 A;  2EMH A;  2RSI A;  1YUI A;  2YTI A;  3MHH C;  1TN9 A;  2EE8 A;  2EN7 A;  2EOX A;  3EPK A;  2EOE A;  2EOI A;  1ZR9 A;  3VHT B;  2ELY A;  5KL6 A;  2EPC A;  4R2A A;  2A25 A;  1P47 A;  2EOJ A;  4R2P A;  1BBO A;  2EM9 A;  2EOR A;  2DGC A;  3EPL A;  4F2J C;  2CSH A;  4R2S A;  1A1H A;  2EM3 A;  2EQ1 A;  2WBS A;  1WJP A;  5KL3 A;  2EN4 A;  5KL4 A;  1DGC A;  2CTD A;  1ZU1 A;  2ENC A;  2ENA A;  2YU8 A;  4IJD A;  2E72 A;  2EOY A;  2WBT A;  1A1I A;  1RMD A;  5KL2 A;  2EM5 A;  1A1K A;  2LO3 A;  2CT1 A;  2DMI A;  2LCE A;  2LV2 A;  2ELZ A;  2YTN A;  2EML A;  2R1F A;  2EMA A;  2YU5 A;  1G2F C;  2ENH A;  2BB8 A;  2EM0 A;  2EMW A;  2EM6 A;  2EPP A;  2EMF A;  2EN2 A;  2EPX A;  4R2Q A;  2EM7 A;  2EOZ A;  2EL4 A;  2GHF A;  2DLK A;  2YRH A;  2MKD A;  2EPU A;  4FK5 C;  1A1G A;  2NAB A;  2EMX A;  2EOO A;  2EL5 A;  2EMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...