1STUA

Double stranded rna binding domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
68
structure length
68
Chain Sequence
PISQVHEIGIKRNMTVHFKVLREEGPAHMKNFITACIVGSIVTEGEGNGKKVSKKRAAEKMLVELQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MATERNAL EFFECT PROTEIN STAUFEN
publication title NMR solution structure of a dsRNA binding domain from Drosophila staufen protein reveals homology to the N-terminal domain of ribosomal protein S5.
pubmed rcsb
source organism Drosophila melanogaster
molecule tags Double stranded rna binding domain
total genus 10
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1995-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1stuA00
4M2ZA 2LTRA 2UUAE 4B3RE 4JI3E 4DR6E 4JI4E 2KHXA 3VYXA 1N34E 1O0WA 4GKKE 2L33A 2JVAA 4LFCE 2LTSA 4JI8E 4DV4E 3ADGA 4X8WA 2B7VA 2RS6A 4DR5E 2DIXA 4YHHE 4LF9E 2NUFA 2YT4A 1N32E 1T4LB 4LF6E 2L3CA 1X49A 2JY9A 4JI0E 4DR7E 1J5EE 5BR8E 1X47A 1XNRE 5CFFE 5IWAE 3J7Yp 2RSMA 4DV0E 2LBSB 1YYKA 4LFBE 4DR4E 1HNZE 2N3HA 2NUGA 4LFAE 2RS7A 1YZ9A 1RQ0A 2UXCE 4DUYE 1HNXE 2UUCE 4GKJE 1X48A 4KHPE 2VQFE 4X66E 1PKPA 2UU9E 1QU6A 4AQYE 2E5LE 3ADLA 2RTXA 2L2MA 1YYOA 4WFTA 1IBKE 4M30A 4DV6E 1N36E 2L2NA 4DKKA 4X62E 4B3SE 1XMQE 1FKAE 1RC7A 1FJGE 2LJHA 2MDRA 2L2KB 3C4BA 3P1XA 3LLHA 1UHZA 2IHR1 1J26A 1DI2A 4JYAE 4LF8E 4B3TE 2CPNA 4NXME 1YYWA 2LUQA 3ADIA 4OOGC 1T4OA 2DB2A 2HHHE 4LF5E 3OTOE 1UILA 4YY3E 1GQEA 4DR2E 1STUA 4X64E 1I94E 4LF7E 5LMUE 2NUEA 4B3ME 2B7TA 1IBLE 4DR3E 4X65E 4DV2E 3ADJA 2LRSA 4JV5E 1WHQA 2ZM6E 1XNQE 1IBME 2UXBE 1HR0E 4DUZE 1XMOE 2EZ6A 1ZBTA 1N33E 2DMYA 4DV7E 3T1YE 2NA2A 4JI2E 2UXDE 1WHNA 4DV3E 5LMNE 4JI1E 4NXNE 4K0KE 1EKZA 4DR1E 2N3GA 4LF4E 3HTXA 2F4VE 2VQEE 4OX9E 4WYQB 3VYYA 4DV1E 1T4NA 3T1HE 3C4TA 2L3JA 2B3TB 4JI5E 1HNWE 4JI7E 4DV5E 2LUPB 2UUBE 4JI6E
chains in the Genus database with same CATH superfamily
4BHCA 4M2ZA 1AAYA 3VYXA 1O0WA 2EQ0A 4GZNC 2EJ4A 2EN1A 4WSGA 2CSHA 4BC7A 5AC5A 4DR5E 2DIXA 2NUFA 2EN2A 2YT4A 2YTQA 1YUIA 1UN6B 2EM0A 2L3CA 1A1JA 2JY9A 2M9AA 2LJUA 2MDGA 3EPHA 2PRTA 1J5EE 4WXCA 2VF1A 5CFFE 5IWAE 4ZYDA 1PJSA 2RSMA 2ELYA 1BB8A 1YYKA 3J81C 2N3HA 2LCEA 4MLQA 5A6JA 1A1IA 4F6MA 2KONA 2MKDA 4BHBA 4AQYE 2E5LE 4BS9A 3J80C 4Q28A 3AV0A 2JYAA 4KWYA 2EMWA 4DKKA 1X6EA 2EPCA 2YTGA 1FKAE 1A1HA 2EL4A 4F6NA 2MDRA 2L2KB 3P1XA 3C4BA 4F9AB 2YU5A 4B3TE 2CPNA 2EOEA 1T38A 1YYWA 5LL6R 2H36X 2L6MA 2EPRA 5A2QC 1UILA 2EMHA 2EPLX 1GQEA 4O4KA 4BMJA 3F6GA 2BB8A 3ECRA 4X64E 1A1FA 2YTIA 2V83A 3HXLA 1Z1BA 4B3ME 1WRJA 2J7JA 3L00A 3ADJA 4WPYA 2YU8A 4ZYEA 2EOOA 2HGHA 2WBTA 4WSPA 2F8BA 5KL2A 2V89A 2EZ6A 3EPJA 3T1YE 3HPZA 5KL4A 5LMNE 4JI1E 4K0KE 2KOUA 2ODRD 1EH7A 2EOMA 2E72A 3HTXA 3VYYA 5AE1A 5KL7A 1NCSA 2EMGA 2EOZA 2ADRA 4JI5E 3EPLA 3VHTB 2WCC3 2LUPB 4JI6E 5A6BA 2JP9A 4ZYGA 4R2CA 1ZBQA 2LT7A 4I8OA 2EN6A 2EMIA 4JI3E 2FV4B 4JI4E 2KHXA 3IWBA 1ZR9A 4L8NA 2CT1A 2JR1A 2RSIA 5DNYA 2G7HA 2L33A 2LTSA 4NHRA 4HEIA 4LF9E 2EM7A 2EOSA 4ZYHA 3JAMC 2ENCA 4O24A 3BIDA 2GHFA 4KZSA 3AUZA 4J8ZA 4O43A 4RHBB 2EPNA 2ODRC 2EM4A 1L4SA 2LO3A 2YTNA 2V87A 2I13A 3HQ1A 1HNZE 2NUGA 2UXCE 1RQ0A 2UUCE 4GKJE 1JK1A 4R03A 2EMLA 1X6FA 2EOXA 1DQ3A 2YSPA 4KHPE 2EOFA 2V8QB 4X66E 1QU6A 3JTZA 4O5GA 2EPAA 4BCAA 2DLQA 1YYOA 1EH8A 2RPCA 4DV6E 1N36E 2V88A 1KYQA 2VE7C 2EL5A 2EMKA 2LJHA 1A1KA 1P47A 2EPPA 1UHZA 1A1GA 3HPSA 2YTFA 2YZTA 4JYAE 1T4OA 4BBYA 4X9JA 2Q8UA 4LF5E 2EP3A 3H09A 3KWRA 4LTYA 4NZVA 1JK2A 5AC4A 2V86A 4DMIA 2EM8A 2B9DA 1IBLE 4DV2E 1XNQE 3K6QA 5F3WA 3EQ1A 2UXBE 2DSYA 1XMOE 1N33E 1ZBTA 1X3CA 2E1MA 2DMYA 2L8TA 2LE2A 2YTOA 2A25A 1RMDA 2D9HA 2FTXB 2YTDA 4R2PA 2F4VE 3C6KA 5KL6A 1SR9A 2L3JA 1TF6A 1BBOA 4JI7E 2JXPA 1X6HA 1EH6A 2LTRA 4F2JC 3EPKA 4B3RE 5IT9C 3THNA 1WXRA 4R2AA 1N34E 2EPZA 1IQSA 4GKKE 4N4RB 2N8XA 1X5WA 4JI8E 1TF3A 3ADGA 4F54A 2I9IA 4YHHE 3MHSC 2M1SA 2YTPA 4LF6E 5T6JA 4R2SA 2EN8A 1X47A 4HTGA 2YRKA 3C6MA 2ENHA 1PJTA 1WJPA 3J7Yp 4DV0E 1ZU1A 2EM9A 3VK6A 1N3GA 4LFBE 2HJJA 4LFAE 1KJKA 2JOBA 2LMZA 2K4VA 2EMXA 1HNXE 2EOYA 5IXMB 1ZAAC 2VQFE 1PKPA 2UU9E 2YRHA 2EE8A 2EMZA 2EN3A 2L2MA 5KL3A 1IBKE 3RMPA 2EPKX 2L2NA 5AE3A 3BBGA 3LMLA 1XMQE 2DMIA 3ZOQB 1RC7A 1SFEA 2EQ3A 5AASA 3F6HA 2EM2A 2IHR1 1J26A 4L5NC 4LF8E 4WX9A 2WBSA 2V85A 4M0VA 4NXME 3TQMA 3ADIA 2LUQA 1AH5A 2EQ1A 2NABA 4OOGC 3UK3C 2DB2A 2DRPA 1NEIA 2LV2A 2EMCA 3DF6A 3OTOE 1MEYC 4FK5C 2ENAA 5IV8B 1I94E 4LF7E 1TN9A 5LMUE 2WZOA 2EOQA 2NUEA 2JPAA 2DGCA 5A6BD 4X65E 4R2QA 2JOXA 4IJDA 2LRSA 1WHQA 1G2FC 2ZM6E 2EM5A 2BBGA 3IWCA 1HR0E 2RQLA 4DUZE 4BC9A 4DV7E 4JI2E 1YPNA 2NA2A 2UXDE 1WHNA 2EOHA 2YTEA 3QG5C 4DR1E 1G2DC 4LF4E 4R2RA 3KZYA 2EMAA 2VQEE 4DV1E 1T4NA 3C4TA 2EL6A 3BF2A 2B3TB 2LVHA 4DV5E 2M4IA 2YWQA 4F9CB 4Q35B 2UUAE 2EMYA 2EWLA 1LLMC 5A6AA 4DR6E 1GZ6A 5LLQA 4R8OA 5TSEA 4P7DA 5A69A 4WXDA 2MC6A 2JVAA 4LFCE 2EN7A 4DV4E 4TUIA 4X8WA 1MGTA 2B7VA 2MC5A 2YSOA 2RS6A 2YRMA 2EOIA 1N32E 1T4LB 1QNTA 1X49A 4IS1C 3DJWA 4JI0E 3KZZA 4DR7E 3OMLA 5BR8E 1XNRE 2EN4A 2EORA 2EPOA 2YTJA 1IMUA 2LBSB 4DR4E 4R2EA 2RS7A 1YZ9A 5A6KA 4DUYE 2EPMX 5AE2A 1YFHA 2MKNA 1X48A 4M9VC 2EM6A 2GLIA 4P78A 1DGCA 4TUGA 3ADLA 2RTXA 2EMFA 4WFTA 2EPUA 3IWDA 3JU0A 2R76A 4GEQB 4M30A 2R1FA 2HC5A 2GPIA 1IQOA 4X62E 4B3SE 4MLVA 1FJGE 2EM3A 3LLHA 1DI2A 2WBUA 2FGGA 2EOJA 2EPXA 2HHHE 2M7QA 4YY3E 4RH8A 1GTKA 2K7IA 4DR2E 1STUA 3M99B 2CTDA 5ADZA 1T39A 3MSWA 2EMBA 2B7TA 2YPNA 3THOB 4DR3E 2L92A 1A1LA 4JV5E 4LU9A 1PJQA 1YSAC 1IBME 2JWOA 1BBGA 5KL5A 1YUJA 4DV3E 4NXNE 3FIGA 1EKZA 1B69A 2N3GA 5FLXC 4F9BB 2ELZA 1UBDC 4R2DA 2VRDA 4OX9E 4WYQB 3T1HE 1HNWE 1PDAA 1F2IG 3MHHC 2UUBE 3BGHA 3J7AG 2DLKA
chains in the Genus database with same CATH topology
4F9CB 4M2ZA 2LTRA 1ZBQA 2UUAE 4I8OA 2EWLA 4B3RE 4JI3E 2FV4B 4DR6E 1GZ6A 5IT9C 4JI4E 1WXRA 2KHXA 3VYXA 1N34E 1O0WA 4R8OA 3IWBA 4L8NA 2JR1A 4P7DA 4GKKE 5DNYA 2MC6A 2G7HA 2JVAA 2L33A 4LFCE 2LTSA 4JI8E 4DV4E 4TUIA 3ADGA 4X8WA 4BC7A 2B7VA 2MC5A 4F54A 2RS6A 4DR5E 2DIXA 4YHHE 4LF9E 2NUFA 2M1SA 2YT4A 3JAMC 1N32E 1T4LB 4LF6E 2L3CA 1X49A 2JY9A 3DJWA 5T6JA 4JI0E 4KZSA 3AUZA 4DR7E 3OMLA 4J8ZA 1J5EE 5BR8E 1X47A 1XNRE 5CFFE 2VF1A 2ODRC 5IWAE 3J7Yp 2RSMA 4DV0E 2LBSB 3VK6A 2V87A 1YYKA 3J81C 3HQ1A 1HNZE 4DR4E 4LFBE 2N3HA 2NUGA 4LFAE 2RS7A 1YZ9A 1RQ0A 2JOBA 2K4VA 2LMZA 4DUYE 1HNXE 5AE2A 2UUCE 4GKJE 4R03A 1X48A 2KONA 4KHPE 1DQ3A 2VQFE 2V8QB 4P78A 4X66E 1PKPA 2UU9E 1QU6A 4AQYE 3JTZA 2E5LE 4BCAA 4BS9A 3J80C 4TUGA 4Q28A 3ADLA 2RTXA 2L2MA 1YYOA 4WFTA 1IBKE 3RMPA 3AV0A 3IWDA 3JU0A 4GEQB 4M30A 4DV6E 1N36E 2L2NA 2V88A 4DKKA 5AE3A 2VE7C 3LMLA 4X62E 4B3SE 1XMQE 1FKAE 3ZOQB 1RC7A 2LJHA 1FJGE 2MDRA 5AASA 3C4BA 3F6HA 3P1XA 3LLHA 4F9AB 1UHZA 2IHR1 3HPSA 2L2KB 4L5NC 1DI2A 1J26A 2YZTA 4JYAE 4LF8E 2FGGA 2V85A 4M0VA 2CPNA 4B3TE 4NXME 2LUQA 1YYWA 3ADIA 5LL6R 4OOGC 1T4OA 2DB2A 2HHHE 4BBYA 2H36X 2L6MA 5A2QC 2M7QA 4LF5E 3OTOE 3DF6A 1UILA 4YY3E 1GQEA 4BMJA 3F6GA 3H09A 3KWRA 1STUA 4LTYA 4DR2E 4X64E 1I94E 4LF7E 5ADZA 2V83A 3HXLA 5LMUE 2WZOA 2NUEA 2V86A 4DMIA 3MSWA 4B3ME 2B7TA 2B9DA 1IBLE 4DR3E 4X65E 4DV2E 2JOXA 2L92A 3ADJA 2LRSA 4WPYA 1WHQA 4LU9A 2ZM6E 1XNQE 4JV5E 3K6QA 3IWCA 1IBME 5F3WA 4WSPA 2UXBE 2F8BA 2DSYA 2JWOA 4DUZE 1XMOE 2V89A 1HR0E 1ZBTA 4BC9A 2EZ6A 1N33E 2E1MA 2DMYA 4DV7E 2L8TA 2NA2A 2LE2A 3HPZA 1WHNA 3T1YE 4JI2E 4DV3E 2UXDE 5LMNE 4JI1E 4NXNE 4K0KE 2KOUA 2ODRD 2FTXB 3FIGA 2N3GA 5FLXC 4F9BB 4DR1E 1EKZA 4LF4E 3HTXA 2F4VE 2VQEE 4OX9E 4WYQB 3VYYA 4DV1E 5AE1A 1SR9A 1T4NA 3T1HE 3C4TA 2UXCE 2L3JA 2B3TB 4JI5E 1HNWE 4JI7E 4DV5E 2LUPB 2UUBE 4JI6E 3J7AG 2M4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M2Z A;  2LTR A;  2UUA E;  4B3R E;  4JI3 E;  4DR6 E;  4JI4 E;  2KHX A;  3VYX A;  1N34 E;  1O0W A;  4GKK E;  2L33 A;  2JVA A;  4LFC E;  2LTS A;  4JI8 E;  4DV4 E;  3ADG A;  4X8W A;  2B7V A;  2RS6 A;  4DR5 E;  2DIX A;  4YHH E;  4LF9 E;  2NUF A;  2YT4 A;  1N32 E;  1T4L B;  4LF6 E;  2L3C A;  1X49 A;  2JY9 A;  4JI0 E;  4DR7 E;  1J5E E;  5BR8 E;  1X47 A;  1XNR E;  5CFF E;  5IWA E;  3J7Y p;  2RSM A;  4DV0 E;  2LBS B;  1YYK A;  4LFB E;  4DR4 E;  1HNZ E;  2N3H A;  2NUG A;  4LFA E;  2RS7 A;  1YZ9 A;  1RQ0 A;  2UXC E;  4DUY E;  1HNX E;  2UUC E;  4GKJ E;  1X48 A;  4KHP E;  2VQF E;  4X66 E;  1PKP A;  2UU9 E;  1QU6 A;  4AQY E;  2E5L E;  3ADL A;  2RTX A;  2L2M A;  1YYO A;  4WFT A;  1IBK E;  4M30 A;  4DV6 E;  1N36 E;  2L2N A;  4DKK A;  4X62 E;  4B3S E;  1XMQ E;  1FKA E;  1RC7 A;  1FJG E;  2LJH A;  2MDR A;  2L2K B;  3C4B A;  3P1X A;  3LLH A;  1UHZ A;  2IHR 1;  1J26 A;  1DI2 A;  4JYA E;  4LF8 E;  4B3T E;  2CPN A;  4NXM E;  1YYW A;  2LUQ A;  3ADI A;  4OOG C;  1T4O A;  2DB2 A;  2HHH E;  4LF5 E;  3OTO E;  1UIL A;  4YY3 E;  1GQE A;  4DR2 E;  1STU A;  4X64 E;  1I94 E;  4LF7 E;  5LMU E;  2NUE A;  4B3M E;  2B7T A;  1IBL E;  4DR3 E;  4X65 E;  4DV2 E;  3ADJ A;  2LRS A;  4JV5 E;  1WHQ A;  2ZM6 E;  1XNQ E;  1IBM E;  2UXB E;  1HR0 E;  4DUZ E;  1XMO E;  2EZ6 A;  1ZBT A;  1N33 E;  2DMY A;  4DV7 E;  3T1Y E;  2NA2 A;  4JI2 E;  2UXD E;  1WHN A;  4DV3 E;  5LMN E;  4JI1 E;  4NXN E;  4K0K E;  1EKZ A;  4DR1 E;  2N3G A;  4LF4 E;  3HTX A;  2F4V E;  2VQE E;  4OX9 E;  4WYQ B;  3VYY A;  4DV1 E;  1T4N A;  3T1H E;  3C4T A;  2L3J A;  2B3T B;  4JI5 E;  1HNW E;  4JI7 E;  4DV5 E;  2LUP B;  2UUB E;  4JI6 E; 
#chains in the Genus database with same CATH topology
 4BHC A;  4M2Z A;  1AAY A;  3VYX A;  1O0W A;  2EQ0 A;  4GZN C;  2EJ4 A;  2EN1 A;  4WSG A;  2CSH A;  4BC7 A;  5AC5 A;  4DR5 E;  2DIX A;  2NUF A;  2EN2 A;  2YT4 A;  2YTQ A;  1YUI A;  1UN6 B;  2EM0 A;  2L3C A;  1A1J A;  2JY9 A;  2M9A A;  2LJU A;  2MDG A;  3EPH A;  2PRT A;  1J5E E;  4WXC A;  2VF1 A;  5CFF E;  5IWA E;  4ZYD A;  1PJS A;  2RSM A;  2ELY A;  1BB8 A;  1YYK A;  3J81 C;  2N3H A;  2LCE A;  4MLQ A;  5A6J A;  1A1I A;  4F6M A;  2KON A;  2MKD A;  4BHB A;  4AQY E;  2E5L E;  4BS9 A;  3J80 C;  4Q28 A;  3AV0 A;  2JYA A;  4KWY A;  2EMW A;  4DKK A;  1X6E A;  2EPC A;  2YTG A;  1FKA E;  1A1H A;  2EL4 A;  4F6N A;  2MDR A;  2L2K B;  3P1X A;  3C4B A;  4F9A B;  2YU5 A;  4B3T E;  2CPN A;  2EOE A;  1T38 A;  1YYW A;  5LL6 R;  2H36 X;  2L6M A;  2EPR A;  5A2Q C;  1UIL A;  2EMH A;  2EPL X;  1GQE A;  4O4K A;  4BMJ A;  3F6G A;  2BB8 A;  3ECR A;  4X64 E;  1A1F A;  2YTI A;  2V83 A;  3HXL A;  1Z1B A;  4B3M E;  1WRJ A;  2J7J A;  3L00 A;  3ADJ A;  4WPY A;  2YU8 A;  4ZYE A;  2EOO A;  2HGH A;  2WBT A;  4WSP A;  2F8B A;  5KL2 A;  2V89 A;  2EZ6 A;  3EPJ A;  3T1Y E;  3HPZ A;  5KL4 A;  5LMN E;  4JI1 E;  4K0K E;  2KOU A;  2ODR D;  1EH7 A;  2EOM A;  2E72 A;  3HTX A;  3VYY A;  5AE1 A;  5KL7 A;  1NCS A;  2EMG A;  2EOZ A;  2ADR A;  4JI5 E;  3EPL A;  3VHT B;  2WCC 3;  2LUP B;  4JI6 E;  5A6B A;  2JP9 A;  4ZYG A;  4R2C A;  1ZBQ A;  2LT7 A;  4I8O A;  2EN6 A;  2EMI A;  4JI3 E;  2FV4 B;  4JI4 E;  2KHX A;  3IWB A;  1ZR9 A;  4L8N A;  2CT1 A;  2JR1 A;  2RSI A;  5DNY A;  2G7H A;  2L33 A;  2LTS A;  4NHR A;  4HEI A;  4LF9 E;  2EM7 A;  2EOS A;  4ZYH A;  3JAM C;  2ENC A;  4O24 A;  3BID A;  2GHF A;  4KZS A;  3AUZ A;  4J8Z A;  4O43 A;  4RHB B;  2EPN A;  2ODR C;  2EM4 A;  1L4S A;  2LO3 A;  2YTN A;  2V87 A;  2I13 A;  3HQ1 A;  1HNZ E;  2NUG A;  2UXC E;  1RQ0 A;  2UUC E;  4GKJ E;  1JK1 A;  4R03 A;  2EML A;  1X6F A;  2EOX A;  1DQ3 A;  2YSP A;  4KHP E;  2EOF A;  2V8Q B;  4X66 E;  1QU6 A;  3JTZ A;  4O5G A;  2EPA A;  4BCA A;  2DLQ A;  1YYO A;  1EH8 A;  2RPC A;  4DV6 E;  1N36 E;  2V88 A;  1KYQ A;  2VE7 C;  2EL5 A;  2EMK A;  2LJH A;  1A1K A;  1P47 A;  2EPP A;  1UHZ A;  1A1G A;  3HPS A;  2YTF A;  2YZT A;  4JYA E;  1T4O A;  4BBY A;  4X9J A;  2Q8U A;  4LF5 E;  2EP3 A;  3H09 A;  3KWR A;  4LTY A;  4NZV A;  1JK2 A;  5AC4 A;  2V86 A;  4DMI A;  2EM8 A;  2B9D A;  1IBL E;  4DV2 E;  1XNQ E;  3K6Q A;  5F3W A;  3EQ1 A;  2UXB E;  2DSY A;  1XMO E;  1N33 E;  1ZBT A;  1X3C A;  2E1M A;  2DMY A;  2L8T A;  2LE2 A;  2YTO A;  2A25 A;  1RMD A;  2D9H A;  2FTX B;  2YTD A;  4R2P A;  2F4V E;  3C6K A;  5KL6 A;  1SR9 A;  2L3J A;  1TF6 A;  1BBO A;  4JI7 E;  2JXP A;  1X6H A;  1EH6 A;  2LTR A;  4F2J C;  3EPK A;  4B3R E;  5IT9 C;  3THN A;  1WXR A;  4R2A A;  1N34 E;  2EPZ A;  1IQS A;  4GKK E;  4N4R B;  2N8X A;  1X5W A;  4JI8 E;  1TF3 A;  3ADG A;  4F54 A;  2I9I A;  4YHH E;  3MHS C;  2M1S A;  2YTP A;  4LF6 E;  5T6J A;  4R2S A;  2EN8 A;  1X47 A;  4HTG A;  2YRK A;  3C6M A;  2ENH A;  1PJT A;  1WJP A;  3J7Y p;  4DV0 E;  1ZU1 A;  2EM9 A;  3VK6 A;  1N3G A;  4LFB E;  2HJJ A;  4LFA E;  1KJK A;  2JOB A;  2LMZ A;  2K4V A;  2EMX A;  1HNX E;  2EOY A;  5IXM B;  1ZAA C;  2VQF E;  1PKP A;  2UU9 E;  2YRH A;  2EE8 A;  2EMZ A;  2EN3 A;  2L2M A;  5KL3 A;  1IBK E;  3RMP A;  2EPK X;  2L2N A;  5AE3 A;  3BBG A;  3LML A;  1XMQ E;  2DMI A;  3ZOQ B;  1RC7 A;  1SFE A;  2EQ3 A;  5AAS A;  3F6H A;  2EM2 A;  2IHR 1;  1J26 A;  4L5N C;  4LF8 E;  4WX9 A;  2WBS A;  2V85 A;  4M0V A;  4NXM E;  3TQM A;  3ADI A;  2LUQ A;  1AH5 A;  2EQ1 A;  2NAB A;  4OOG C;  3UK3 C;  2DB2 A;  2DRP A;  1NEI A;  2LV2 A;  2EMC A;  3DF6 A;  3OTO E;  1MEY C;  4FK5 C;  2ENA A;  5IV8 B;  1I94 E;  4LF7 E;  1TN9 A;  5LMU E;  2WZO A;  2EOQ A;  2NUE A;  2JPA A;  2DGC A;  5A6B D;  4X65 E;  4R2Q A;  2JOX A;  4IJD A;  2LRS A;  1WHQ A;  1G2F C;  2ZM6 E;  2EM5 A;  2BBG A;  3IWC A;  1HR0 E;  2RQL A;  4DUZ E;  4BC9 A;  4DV7 E;  4JI2 E;  1YPN A;  2NA2 A;  2UXD E;  1WHN A;  2EOH A;  2YTE A;  3QG5 C;  4DR1 E;  1G2D C;  4LF4 E;  4R2R A;  3KZY A;  2EMA A;  2VQE E;  4DV1 E;  1T4N A;  3C4T A;  2EL6 A;  3BF2 A;  2B3T B;  2LVH A;  4DV5 E;  2M4I A;  2YWQ A;  4F9C B;  4Q35 B;  2UUA E;  2EMY A;  2EWL A;  1LLM C;  5A6A A;  4DR6 E;  1GZ6 A;  5LLQ A;  4R8O A;  5TSE A;  4P7D A;  5A69 A;  4WXD A;  2MC6 A;  2JVA A;  4LFC E;  2EN7 A;  4DV4 E;  4TUI A;  4X8W A;  1MGT A;  2B7V A;  2MC5 A;  2YSO A;  2RS6 A;  2YRM A;  2EOI A;  1N32 E;  1T4L B;  1QNT A;  1X49 A;  4IS1 C;  3DJW A;  4JI0 E;  3KZZ A;  4DR7 E;  3OML A;  5BR8 E;  1XNR E;  2EN4 A;  2EOR A;  2EPO A;  2YTJ A;  1IMU A;  2LBS B;  4DR4 E;  4R2E A;  2RS7 A;  1YZ9 A;  5A6K A;  4DUY E;  2EPM X;  5AE2 A;  1YFH A;  2MKN A;  1X48 A;  4M9V C;  2EM6 A;  2GLI A;  4P78 A;  1DGC A;  4TUG A;  3ADL A;  2RTX A;  2EMF A;  4WFT A;  2EPU A;  3IWD A;  3JU0 A;  2R76 A;  4GEQ B;  4M30 A;  2R1F A;  2HC5 A;  2GPI A;  1IQO A;  4X62 E;  4B3S E;  4MLV A;  1FJG E;  2EM3 A;  3LLH A;  1DI2 A;  2WBU A;  2FGG A;  2EOJ A;  2EPX A;  2HHH E;  2M7Q A;  4YY3 E;  4RH8 A;  1GTK A;  2K7I A;  4DR2 E;  1STU A;  3M99 B;  2CTD A;  5ADZ A;  1T39 A;  3MSW A;  2EMB A;  2B7T A;  2YPN A;  3THO B;  4DR3 E;  2L92 A;  1A1L A;  4JV5 E;  4LU9 A;  1PJQ A;  1YSA C;  1IBM E;  2JWO A;  1BBG A;  5KL5 A;  1YUJ A;  4DV3 E;  4NXN E;  3FIG A;  1EKZ A;  1B69 A;  2N3G A;  5FLX C;  4F9B B;  2ELZ A;  1UBD C;  4R2D A;  2VRD A;  4OX9 E;  4WYQ B;  3T1H E;  1HNW E;  1PDA A;  1F2I G;  3MHH C;  2UUB E;  3BGH A;  3J7A G;  2DLK A; 
#chains in the Genus database with same CATH homology
 4F9C B;  4M2Z A;  2LTR A;  1ZBQ A;  2UUA E;  4I8O A;  2EWL A;  4B3R E;  4JI3 E;  2FV4 B;  4DR6 E;  1GZ6 A;  5IT9 C;  4JI4 E;  1WXR A;  2KHX A;  3VYX A;  1N34 E;  1O0W A;  4R8O A;  3IWB A;  4L8N A;  2JR1 A;  4P7D A;  4GKK E;  5DNY A;  2MC6 A;  2G7H A;  2JVA A;  2L33 A;  4LFC E;  2LTS A;  4JI8 E;  4DV4 E;  4TUI A;  3ADG A;  4X8W A;  4BC7 A;  2B7V A;  2MC5 A;  4F54 A;  2RS6 A;  4DR5 E;  2DIX A;  4YHH E;  4LF9 E;  2NUF A;  2M1S A;  2YT4 A;  3JAM C;  1N32 E;  1T4L B;  4LF6 E;  2L3C A;  1X49 A;  2JY9 A;  3DJW A;  5T6J A;  4JI0 E;  4KZS A;  3AUZ A;  4DR7 E;  3OML A;  4J8Z A;  1J5E E;  5BR8 E;  1X47 A;  1XNR E;  5CFF E;  2VF1 A;  2ODR C;  5IWA E;  3J7Y p;  2RSM A;  4DV0 E;  2LBS B;  3VK6 A;  2V87 A;  1YYK A;  3J81 C;  3HQ1 A;  1HNZ E;  4DR4 E;  4LFB E;  2N3H A;  2NUG A;  4LFA E;  2RS7 A;  1YZ9 A;  1RQ0 A;  2JOB A;  2K4V A;  2LMZ A;  4DUY E;  1HNX E;  5AE2 A;  2UUC E;  4GKJ E;  4R03 A;  1X48 A;  2KON A;  4KHP E;  1DQ3 A;  2VQF E;  2V8Q B;  4P78 A;  4X66 E;  1PKP A;  2UU9 E;  1QU6 A;  4AQY E;  3JTZ A;  2E5L E;  4BCA A;  4BS9 A;  3J80 C;  4TUG A;  4Q28 A;  3ADL A;  2RTX A;  2L2M A;  1YYO A;  4WFT A;  1IBK E;  3RMP A;  3AV0 A;  3IWD A;  3JU0 A;  4GEQ B;  4M30 A;  4DV6 E;  1N36 E;  2L2N A;  2V88 A;  4DKK A;  5AE3 A;  2VE7 C;  3LML A;  4X62 E;  4B3S E;  1XMQ E;  1FKA E;  3ZOQ B;  1RC7 A;  2LJH A;  1FJG E;  2MDR A;  5AAS A;  3C4B A;  3F6H A;  3P1X A;  3LLH A;  4F9A B;  1UHZ A;  2IHR 1;  3HPS A;  2L2K B;  4L5N C;  1DI2 A;  1J26 A;  2YZT A;  4JYA E;  4LF8 E;  2FGG A;  2V85 A;  4M0V A;  2CPN A;  4B3T E;  4NXM E;  2LUQ A;  1YYW A;  3ADI A;  5LL6 R;  4OOG C;  1T4O A;  2DB2 A;  2HHH E;  4BBY A;  2H36 X;  2L6M A;  5A2Q C;  2M7Q A;  4LF5 E;  3OTO E;  3DF6 A;  1UIL A;  4YY3 E;  1GQE A;  4BMJ A;  3F6G A;  3H09 A;  3KWR A;  1STU A;  4LTY A;  4DR2 E;  4X64 E;  1I94 E;  4LF7 E;  5ADZ A;  2V83 A;  3HXL A;  5LMU E;  2WZO A;  2NUE A;  2V86 A;  4DMI A;  3MSW A;  4B3M E;  2B7T A;  2B9D A;  1IBL E;  4DR3 E;  4X65 E;  4DV2 E;  2JOX A;  2L92 A;  3ADJ A;  2LRS A;  4WPY A;  1WHQ A;  4LU9 A;  2ZM6 E;  1XNQ E;  4JV5 E;  3K6Q A;  3IWC A;  1IBM E;  5F3W A;  4WSP A;  2UXB E;  2F8B A;  2DSY A;  2JWO A;  4DUZ E;  1XMO E;  2V89 A;  1HR0 E;  1ZBT A;  4BC9 A;  2EZ6 A;  1N33 E;  2E1M A;  2DMY A;  4DV7 E;  2L8T A;  2NA2 A;  2LE2 A;  3HPZ A;  1WHN A;  3T1Y E;  4JI2 E;  4DV3 E;  2UXD E;  5LMN E;  4JI1 E;  4NXN E;  4K0K E;  2KOU A;  2ODR D;  2FTX B;  3FIG A;  2N3G A;  5FLX C;  4F9B B;  4DR1 E;  1EKZ A;  4LF4 E;  3HTX A;  2F4V E;  2VQE E;  4OX9 E;  4WYQ B;  3VYY A;  4DV1 E;  5AE1 A;  1SR9 A;  1T4N A;  3T1H E;  3C4T A;  2UXC E;  2L3J A;  2B3T B;  4JI5 E;  1HNW E;  4JI7 E;  4DV5 E;  2LUP B;  2UUB E;  4JI6 E;  3J7A G;  2M4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...