1STUA

Double stranded rna binding domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
68
structure length
68
Chain Sequence
PISQVHEIGIKRNMTVHFKVLREEGPAHMKNFITACIVGSIVTEGEGNGKKVSKKRAAEKMLVELQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structure of a dsRNA binding domain from Drosophila staufen protein reveals homology to the N-terminal domain of ribosomal protein S5.
pubmed rcsb
source organism Drosophila melanogaster
molecule tags Double stranded rna binding domain
molecule keywords MATERNAL EFFECT PROTEIN STAUFEN
total genus 10
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1995-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1stuA00
4OOGC 2JVAA 4DV3E 4JI8E 4LFAE 3T1HE 1T4OA 2UUAE 4K0KE 2B7VA 5CFFE 2RSMA 2VQFE 2LBSB 3LLHA 1N34E 4GKKE 1GQEA 4LF4E 1RQ0A 4JI1E 4DR1E 2UXDE 4DR7E 4DKKA 1HNWE 3HTXA 2RS6A 4JI5E 1N32E 4YHHE 1WHQA 2B3TB 4DR2E 1YYKA 2DB2A 3C4BA 1N36E 1ZBTA 2UUCE 4DV7E 1UILA 4M2ZA 1HNZE 3P1XA 1UHZA 4DV0E 4JI3E 3ADLA 5LMUE 1FKAE 4B3ME 1XNRE 2F4VE 1N33E 2LJHA 1RC7A 2LTRA 4X65E 4DV6E 4DV5E 2ZM6E 3C4TA 2LTSA 5LMNE 2HHHE 1YYWA 2UXBE 2B7TA 4NXNE 4DR3E 4DUYE 1STUA 2IHR1 4X8WA 4DR5E 2LRSA 1YZ9A 4JI7E 2NUFA 4B3RE 2EZ6A 2N3HA 4LF9E 2N3GA 4X64E 4JI6E 4B3SE 1XNQE 1WHNA 2RS7A 4JI4E 1FJGE 4DV4E 3VYYA 2DMYA 4DV1E 4DR4E 2L2KB 3ADIA 4LFCE 1IBKE 4KHPE 2KHXA 4OX9E 2UUBE 5IWAE 2RTXA 4JI0E 4JYAE 2LUPB 4LF5E 2L2MA 1PKPA 5BR8E 4LF7E 2JY9A 2E5LE 2MDRA 1T4LB 2UXCE 4AQYE 1HR0E 4LFBE 3J7Yp 1XMOE 1J26A 2UU9E 4B3TE 2L2NA 4WFTA 1YYOA 1EKZA 1X48A 1I94E 4DV2E 3T1YE 3ADJA 2L33A 4X62E 1J5EE 4NXME 2CPNA 1HNXE 3OTOE 3VYXA 4LF8E 4JV5E 1X49A 2L3JA 2NA2A 1IBLE 1XMQE 4DUZE 2NUEA 4M30A 4X66E 1O0WA 4GKJE 2L3CA 2NUGA 1DI2A 4YY3E 3ADGA 4WYQB 2YT4A 4JI2E 2VQEE 1QU6A 4LF6E 2LUQA 1X47A 1T4NA 4DR6E 1IBME 2DIXA
chains in the Genus database with same CATH superfamily
2JVAA 2EP3A 4LFAE 2EPAA 2B7VA 2EM4A 3MHHC 2VQFE 2LBSB 3LLHA 1N34E 2EM3A 1GQEA 2DRPA 4R2DA 1UN6B 1JK1A 3LMLA 1N32E 4YHHE 2EMLA 4DR2E 1YYKA 2DB2A 2YTNA 1X6EA 4J8ZA 1PJQA 2EPOA 1RMDA 2JR1A 4F2JC 2YTOA 3DF6A 2WBSA 5KL2A 2EOXA 2LCEA 3ADLA 2H36X 2EN1A 2YSOA 1FKAE 2JP9A 2F4VE 2ELZA 2EOEA 4P78A 5A6BA 2EN2A 2L92A 2ZM6E 2YTQA 4P7DA 2JYAA 4WSPA 2L8TA 2IHR1 3J7AG 2JPAA 2EQ1A 2EMHA 2B9DA 2EZ6A 2WZOA 2N3HA 2J7JA 5FLXC 4JI6E 4GEQB 4B3SE 3KZYA 2V86A 2RS7A 1EH6A 1FJGE 1DGCA 2DMYA 2K4VA 3JAMC 5A6KA 1X5WA 2V88A 4DV1E 4R2PA 2EPZA 2BBGA 4KHPE 4F9CB 2UUBE 2CSHA 4GZNC 2EMXA 3TQMA 2EMGA 4LF7E 2EOMA 1A1JA 2RPCA 4NHRA 1HR0E 2EMZA 2EN6A 5AASA 2JXPA 5T6JA 3C6MA 3FIGA 3EQ1A 1EKZA 1I94E 4DV2E 1WJPA 3EPHA 1G2DC 2YTPA 2EOJA 1A1IA 1AH5A 2L6MA 2I9IA 3EPJA 4WSGA 2EMKA 4R03A 3H09A 2L3CA 2NUGA 4BCAA 4WYQB 1JK2A 4JI2E 4RH8A 4LF6E 3M99B 2LUQA 1X47A 3ZOQB 4DR6E 2VF1A 2DIXA 5A2QC 3F6GA 2UUAE 1PDAA 2EOZA 5TSEA 3MHSC 4R2RA 4GKKE 1LLMC 5A6BD 5IV8B 4LF4E 4BMJA 2KOUA 1KYQA 3F6HA 4DR1E 5AE2A 4WXCA 2EOHA 2EORA 4DKKA 3HTXA 3EPKA 2B3TB 3DJWA 1N3GA 1N36E 1A1GA 3UK3C 4R2AA 2UUCE 1UILA 4M2ZA 2GHFA 3P1XA 1SR9A 4DV0E 4FK5C 1X6HA 1MGTA 1Z1BA 4O24A 1RC7A 4Q35B 2PRTA 2YTIA 4R2CA 2EM9A 1X6FA 4O5GA 2EWLA 1TN9A 2YPNA 2YRHA 5LMNE 1YYWA 2B7TA 1QNTA 5AE1A 3RMPA 2K7IA 4ZYHA 1YZ9A 1ZR9A 4B3RE 1B69A 4M9VC 2N3GA 3THNA 2EN3A 1XNQE 3BBGA 2EN4A 4BBYA 4JI4E 4BC9A 2EM0A 2EMCA 2KONA 5KL3A 3C6KA 3ADIA 2YTDA 2KHXA 2V83A 4WXDA 4JI0E 2RTXA 2EL4A 1SFEA 1BBGA 1PKPA 4F54A 5IT9C 2JY9A 2E5LE 4LFBE 2EOQA 2FGGA 2JOBA 2EJ4A 1J26A 2EMYA 2L2NA 2EN8A 2V85A 2WCC3 1X48A 3T1YE 2MC5A 2E72A 2HJJA 1YUJA 2LE2A 2CPNA 2EOOA 4O4KA 1WXRA 2VRDA 3VYXA 2MDGA 4R2QA 3HXLA 5DNYA 1MEYC 4O43A 2CT1A 4LU9A 4DUZE 2ENAA 3L00A 4Q28A 1O0WA 3HPSA 2YTFA 1QU6A 2EN7A 1PJTA 3HPZA 5LLQA 1NCSA 1GZ6A 4DV3E 3T1HE 1T38A 4K0KE 2RSMA 3JU0A 3VHTB 1IQSA 1RQ0A 1TF3A 2E1MA 4JI1E 1DQ3A 2EL6A 2DSYA 2EMFA 2YZTA 4DR7E 2HGHA 1HNWE 4JI5E 4L8NA 1KJKA 2M9AA 3QG5C 1ZBTA 2M4IA 2EPKX 2EM8A 2EOYA 2WBUA 5AE3A 4I8OA 1PJSA 1UHZA 3KZZA 3AV0A 4ZYDA 2EMWA 4B3ME 1N33E 4WX9A 2LJHA 3IWCA 1EH8A 2EOFA 2JOXA 2GLIA 2ODRD 2LTRA 3J81C 2EM5A 4X65E 4DV6E 1A1LA 4DV5E 2JWOA 3C4TA 2LJUA 3MSWA 2HHHE 4NZVA 4NXNE 1L4SA 4F6MA 1STUA 3K6QA 4X8WA 2LRSA 2DGCA 2MKDA 2YTJA 4JI7E 2NUFA 5KL4A 4KWYA 1F2IG 2I13A 4LF9E 4BS9A 4BHBA 2V87A 1A1FA 2LO3A 1BB8A 2EPRA 1WHNA 3BF2A 2D9HA 3VYYA 4DR4E 1ZBQA 1IBKE 5IXMB 5KL7A 4JYAE 2LUPB 1EH7A 2EPCA 5A6AA 2EM2A 4MLVA 3BGHA 2EM6A 2MDRA 2UXCE 2MKNA 3J7Yp 1XMOE 2N8XA 1YPNA 4LTYA 2UU9E 2DLKA 2YSPA 4WFTA 1YSAC 4DMIA 4X9JA 2M1SA 2L33A 1P47A 4KZSA 4X62E 2V89A 1J5EE 2EPPA 2RQLA 2FTXB 5LL6R 1X49A 1IQOA 4ZYEA 2L3JA 2NA2A 1XMQE 2EM7A 1ZAAC 4N4RB 5ADZA 5F3WA 3THOB 4GKJE 1DI2A 2YTEA 4YY3E 3ADGA 2EPMX 1TF6A 2YT4A 2YWQA 2RSIA 2DLQA 2R1FA 2VQEE 4BC7A 1YFHA 1IBME 4R8OA 5A69A 4OOGC 3JTZA 2HC5A 4IJDA 4M0VA 4JI8E 1T4OA 5CFFE 4HEIA 4IS1C 2EMBA 1GTKA 3ECRA 5AC5A 1ZU1A 2UXDE 2YU8A 2DMIA 2RS6A 4TUGA 4F6NA 4TUIA 1WHQA 2YRMA 4WPYA 2EOIA 3C4BA 1IMUA 4L5NC 2Q8UA 4DV7E 3HQ1A 2YRKA 2LV2A 1NEIA 1HNZE 1AAYA 3KWRA 4JI3E 4R2SA 5LMUE 2ENCA 1XNRE 4ZYGA 3IWBA 1T39A 1X3CA 1A1HA 2LTSA 2EMAA 2UXBE 4DR3E 4DUYE 2ODRC 4DR5E 4HTGA 4F9BB 2EPUA 2MC6A 3EPLA 1G2FC 4X64E 2CTDA 2FV4B 1WRJA 2WBTA 2LMZA 4DV4E 1A1KA 2L2KB 4LFCE 5AC4A 2EQ3A 2ADRA 2YU5A 2EPXA 5KL6A 4OX9E 3BIDA 2A25A 5IWAE 4RHBB 2NABA 2VE7C 4LF5E 4BHCA 2L2MA 5BR8E 2YTGA 2R76A 1T4LB 2V8QB 1BBOA 2BB8A 4AQYE 2ENHA 2EE8A 2M7QA 4B3TE 3J80C 1YYOA 2EL5A 2EOSA 2LVHA 2LT7A 3ADJA 2G7HA 2EPLX 5A6JA 4NXME 1HNXE 2EPNA 3OTOE 3OMLA 4LF8E 2EQ0A 4JV5E 5KL5A 2GPIA 1IBLE 2ELYA 1UBDC 1YUIA 3VK6A 2NUEA 4M30A 4X66E 4MLQA 2F8BA 3IWDA 4F9AB 3AUZA 1T4NA 2EMIA 4R2EA
chains in the Genus database with same CATH topology
4OOGC 2JVAA 5A2QC 3JTZA 4M0VA 4JI8E 4DV3E 3F6GA 4LFAE 3T1HE 1T4OA 2UUAE 4K0KE 2B7VA 5CFFE 2RSMA 3JU0A 2VQFE 2LBSB 3LLHA 1N34E 4GKKE 1GQEA 4LF4E 5F3WA 1RQ0A 4BMJA 2KOUA 2E1MA 1DI2A 4JI1E 1DQ3A 3F6HA 2DSYA 5AE2A 2YZTA 4DR1E 2UXDE 4DR7E 4DKKA 1HNWE 3HTXA 2RS6A 4JI5E 4TUGA 3LMLA 4L8NA 4TUIA 1N32E 4YHHE 1WHQA 2L3CA 2B3TB 3DJWA 4WPYA 4DR2E 1YYKA 2DB2A 3C4BA 1N36E 4J8ZA 4L5NC 1ZBTA 2M4IA 2UUCE 4DV7E 1UILA 2JR1A 3HQ1A 4M2ZA 3DF6A 1HNZE 5AE3A 4I8OA 3KWRA 1SR9A 1UHZA 3P1XA 4DV0E 3AV0A 4JI3E 3ADLA 2H36X 2NUGA 5LMUE 1IBME 1FKAE 4B3ME 1XNRE 2F4VE 1N33E 2LJHA 3IWBA 3IWCA 1RC7A 2JOXA 2ODRD 2LTRA 3J81C 4P78A 2L92A 4X65E 4DV6E 4DV5E 2ZM6E 2EWLA 2JWOA 3C4TA 4P7DA 3MSWA 2LTSA 5LMNE 2HHHE 4WSPA 1YYWA 2B7TA 4NXNE 2UXBE 5AE1A 4DR3E 2L8TA 4DUYE 3RMPA 1STUA 2ODRC 2IHR1 3K6QA 4X8WA 4DR5E 3J7AG 2LRSA 4F9BB 1YZ9A 4JI7E 2MC6A 2NUFA 2B9DA 4B3RE 2EZ6A 2WZOA 2N3HA 4LF9E 2N3GA 4BS9A 4X64E 2V87A 5FLXC 2FV4B 4JI6E 4GEQB 4B3SE 1WHNA 2V86A 2RS7A 1XNQE 4BBYA 4JI4E 2LMZA 4BC9A 4DV4E 3VYYA 1FJGE 2DMYA 2K4VA 2KONA 3JAMC 4DV1E 2V88A 1ZBQA 4DR4E 2L2KB 3ADIA 4LFCE 1IBKE 4KHPE 2KHXA 2V83A 4OX9E 4F9CB 2UUBE 5IWAE 2RTXA 4JI0E 4JYAE 2LUPB 2VE7C 4LF5E 2L2MA 1PKPA 5BR8E 4F54A 4LF7E 5IT9C 2JY9A 2E5LE 2MDRA 1T4LB 2V8QB 4R8OA 2UXCE 4AQYE 1HR0E 4LFBE 3J7Yp 1XMOE 2FGGA 2JOBA 5AASA 1J26A 4LTYA 5T6JA 2M7QA 2UU9E 4B3TE 2L2NA 3J80C 4WFTA 1YYOA 3FIGA 2V85A 1EKZA 4DMIA 1X48A 1I94E 4DV2E 3T1YE 2M1SA 2MC5A 3ADJA 2L33A 4KZSA 4X62E 2V89A 2G7HA 1J5EE 2LE2A 2CPNA 1WXRA 1HNXE 3OTOE 4NXME 2FTXB 3OMLA 3VYXA 5LL6R 3HXLA 5DNYA 4LF8E 4JV5E 1X49A 2L3JA 2NA2A 1IBLE 2L6MA 4LU9A 1XMQE 4DUZE 3VK6A 2NUEA 4M30A 4Q28A 4R03A 1O0WA 5ADZA 3H09A 2F8BA 4X66E 4YY3E 3IWDA 3ADGA 4WYQB 4BCAA 4F9AB 2YT4A 3AUZA 3HPSA 4JI2E 2VQEE 1QU6A 4GKJE 4LF6E 2LUQA 1X47A 3HPZA 3ZOQB 4BC7A 1T4NA 4DR6E 2VF1A 2DIXA 1GZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OOG C;  2JVA A;  4DV3 E;  4JI8 E;  4LFA E;  3T1H E;  1T4O A;  2UUA E;  4K0K E;  2B7V A;  5CFF E;  2RSM A;  2VQF E;  2LBS B;  3LLH A;  1N34 E;  4GKK E;  1GQE A;  4LF4 E;  1RQ0 A;  4JI1 E;  4DR1 E;  2UXD E;  4DR7 E;  4DKK A;  1HNW E;  3HTX A;  2RS6 A;  4JI5 E;  1N32 E;  4YHH E;  1WHQ A;  2B3T B;  4DR2 E;  1YYK A;  2DB2 A;  3C4B A;  1N36 E;  1ZBT A;  2UUC E;  4DV7 E;  1UIL A;  4M2Z A;  1HNZ E;  3P1X A;  1UHZ A;  4DV0 E;  4JI3 E;  3ADL A;  5LMU E;  1FKA E;  4B3M E;  1XNR E;  2F4V E;  1N33 E;  2LJH A;  1RC7 A;  2LTR A;  4X65 E;  4DV6 E;  4DV5 E;  2ZM6 E;  3C4T A;  2LTS A;  5LMN E;  2HHH E;  1YYW A;  2UXB E;  2B7T A;  4NXN E;  4DR3 E;  4DUY E;  1STU A;  2IHR 1;  4X8W A;  4DR5 E;  2LRS A;  1YZ9 A;  4JI7 E;  2NUF A;  4B3R E;  2EZ6 A;  2N3H A;  4LF9 E;  2N3G A;  4X64 E;  4JI6 E;  4B3S E;  1XNQ E;  1WHN A;  2RS7 A;  4JI4 E;  1FJG E;  4DV4 E;  3VYY A;  2DMY A;  4DV1 E;  4DR4 E;  2L2K B;  3ADI A;  4LFC E;  1IBK E;  4KHP E;  2KHX A;  4OX9 E;  2UUB E;  5IWA E;  2RTX A;  4JI0 E;  4JYA E;  2LUP B;  4LF5 E;  2L2M A;  1PKP A;  5BR8 E;  4LF7 E;  2JY9 A;  2E5L E;  2MDR A;  1T4L B;  2UXC E;  4AQY E;  1HR0 E;  4LFB E;  3J7Y p;  1XMO E;  1J26 A;  2UU9 E;  4B3T E;  2L2N A;  4WFT A;  1YYO A;  1EKZ A;  1X48 A;  1I94 E;  4DV2 E;  3T1Y E;  3ADJ A;  2L33 A;  4X62 E;  1J5E E;  4NXM E;  2CPN A;  1HNX E;  3OTO E;  3VYX A;  4LF8 E;  4JV5 E;  1X49 A;  2L3J A;  2NA2 A;  1IBL E;  1XMQ E;  4DUZ E;  2NUE A;  4M30 A;  4X66 E;  1O0W A;  4GKJ E;  2L3C A;  2NUG A;  1DI2 A;  4YY3 E;  3ADG A;  4WYQ B;  2YT4 A;  4JI2 E;  2VQE E;  1QU6 A;  4LF6 E;  2LUQ A;  1X47 A;  1T4N A;  4DR6 E;  1IBM E;  2DIX A; 
#chains in the Genus database with same CATH topology
 2JVA A;  2EP3 A;  4LFA E;  2EPA A;  2B7V A;  2EM4 A;  3MHH C;  2VQF E;  2LBS B;  3LLH A;  1N34 E;  2EM3 A;  1GQE A;  2DRP A;  4R2D A;  1UN6 B;  1JK1 A;  3LML A;  1N32 E;  4YHH E;  2EML A;  4DR2 E;  1YYK A;  2DB2 A;  2YTN A;  1X6E A;  4J8Z A;  1PJQ A;  2EPO A;  1RMD A;  2JR1 A;  4F2J C;  2YTO A;  3DF6 A;  2WBS A;  5KL2 A;  2EOX A;  2LCE A;  3ADL A;  2H36 X;  2EN1 A;  2YSO A;  1FKA E;  2JP9 A;  2F4V E;  2ELZ A;  2EOE A;  4P78 A;  5A6B A;  2EN2 A;  2L92 A;  2ZM6 E;  2YTQ A;  4P7D A;  2JYA A;  4WSP A;  2L8T A;  2IHR 1;  3J7A G;  2JPA A;  2EQ1 A;  2EMH A;  2B9D A;  2EZ6 A;  2WZO A;  2N3H A;  2J7J A;  5FLX C;  4JI6 E;  4GEQ B;  4B3S E;  3KZY A;  2V86 A;  2RS7 A;  1EH6 A;  1FJG E;  1DGC A;  2DMY A;  2K4V A;  3JAM C;  5A6K A;  1X5W A;  2V88 A;  4DV1 E;  4R2P A;  2EPZ A;  2BBG A;  4KHP E;  4F9C B;  2UUB E;  2CSH A;  4GZN C;  2EMX A;  3TQM A;  2EMG A;  4LF7 E;  2EOM A;  1A1J A;  2RPC A;  4NHR A;  1HR0 E;  2EMZ A;  2EN6 A;  5AAS A;  2JXP A;  5T6J A;  3C6M A;  3FIG A;  3EQ1 A;  1EKZ A;  1I94 E;  4DV2 E;  1WJP A;  3EPH A;  1G2D C;  2YTP A;  2EOJ A;  1A1I A;  1AH5 A;  2L6M A;  2I9I A;  3EPJ A;  4WSG A;  2EMK A;  4R03 A;  3H09 A;  2L3C A;  2NUG A;  4BCA A;  4WYQ B;  1JK2 A;  4JI2 E;  4RH8 A;  4LF6 E;  3M99 B;  2LUQ A;  1X47 A;  3ZOQ B;  4DR6 E;  2VF1 A;  2DIX A;  5A2Q C;  3F6G A;  2UUA E;  1PDA A;  2EOZ A;  5TSE A;  3MHS C;  4R2R A;  4GKK E;  1LLM C;  5A6B D;  5IV8 B;  4LF4 E;  4BMJ A;  2KOU A;  1KYQ A;  3F6H A;  4DR1 E;  5AE2 A;  4WXC A;  2EOH A;  2EOR A;  4DKK A;  3HTX A;  3EPK A;  2B3T B;  3DJW A;  1N3G A;  1N36 E;  1A1G A;  3UK3 C;  4R2A A;  2UUC E;  1UIL A;  4M2Z A;  2GHF A;  3P1X A;  1SR9 A;  4DV0 E;  4FK5 C;  1X6H A;  1MGT A;  1Z1B A;  4O24 A;  1RC7 A;  4Q35 B;  2PRT A;  2YTI A;  4R2C A;  2EM9 A;  1X6F A;  4O5G A;  2EWL A;  1TN9 A;  2YPN A;  2YRH A;  5LMN E;  1YYW A;  2B7T A;  1QNT A;  5AE1 A;  3RMP A;  2K7I A;  4ZYH A;  1YZ9 A;  1ZR9 A;  4B3R E;  1B69 A;  4M9V C;  2N3G A;  3THN A;  2EN3 A;  1XNQ E;  3BBG A;  2EN4 A;  4BBY A;  4JI4 E;  4BC9 A;  2EM0 A;  2EMC A;  2KON A;  5KL3 A;  3C6K A;  3ADI A;  2YTD A;  2KHX A;  2V83 A;  4WXD A;  4JI0 E;  2RTX A;  2EL4 A;  1SFE A;  1BBG A;  1PKP A;  4F54 A;  5IT9 C;  2JY9 A;  2E5L E;  4LFB E;  2EOQ A;  2FGG A;  2JOB A;  2EJ4 A;  1J26 A;  2EMY A;  2L2N A;  2EN8 A;  2V85 A;  2WCC 3;  1X48 A;  3T1Y E;  2MC5 A;  2E72 A;  2HJJ A;  1YUJ A;  2LE2 A;  2CPN A;  2EOO A;  4O4K A;  1WXR A;  2VRD A;  3VYX A;  2MDG A;  4R2Q A;  3HXL A;  5DNY A;  1MEY C;  4O43 A;  2CT1 A;  4LU9 A;  4DUZ E;  2ENA A;  3L00 A;  4Q28 A;  1O0W A;  3HPS A;  2YTF A;  1QU6 A;  2EN7 A;  1PJT A;  3HPZ A;  5LLQ A;  1NCS A;  1GZ6 A;  4DV3 E;  3T1H E;  1T38 A;  4K0K E;  2RSM A;  3JU0 A;  3VHT B;  1IQS A;  1RQ0 A;  1TF3 A;  2E1M A;  4JI1 E;  1DQ3 A;  2EL6 A;  2DSY A;  2EMF A;  2YZT A;  4DR7 E;  2HGH A;  1HNW E;  4JI5 E;  4L8N A;  1KJK A;  2M9A A;  3QG5 C;  1ZBT A;  2M4I A;  2EPK X;  2EM8 A;  2EOY A;  2WBU A;  5AE3 A;  4I8O A;  1PJS A;  1UHZ A;  3KZZ A;  3AV0 A;  4ZYD A;  2EMW A;  4B3M E;  1N33 E;  4WX9 A;  2LJH A;  3IWC A;  1EH8 A;  2EOF A;  2JOX A;  2GLI A;  2ODR D;  2LTR A;  3J81 C;  2EM5 A;  4X65 E;  4DV6 E;  1A1L A;  4DV5 E;  2JWO A;  3C4T A;  2LJU A;  3MSW A;  2HHH E;  4NZV A;  4NXN E;  1L4S A;  4F6M A;  1STU A;  3K6Q A;  4X8W A;  2LRS A;  2DGC A;  2MKD A;  2YTJ A;  4JI7 E;  2NUF A;  5KL4 A;  4KWY A;  1F2I G;  2I13 A;  4LF9 E;  4BS9 A;  4BHB A;  2V87 A;  1A1F A;  2LO3 A;  1BB8 A;  2EPR A;  1WHN A;  3BF2 A;  2D9H A;  3VYY A;  4DR4 E;  1ZBQ A;  1IBK E;  5IXM B;  5KL7 A;  4JYA E;  2LUP B;  1EH7 A;  2EPC A;  5A6A A;  2EM2 A;  4MLV A;  3BGH A;  2EM6 A;  2MDR A;  2UXC E;  2MKN A;  3J7Y p;  1XMO E;  2N8X A;  1YPN A;  4LTY A;  2UU9 E;  2DLK A;  2YSP A;  4WFT A;  1YSA C;  4DMI A;  4X9J A;  2M1S A;  2L33 A;  1P47 A;  4KZS A;  4X62 E;  2V89 A;  1J5E E;  2EPP A;  2RQL A;  2FTX B;  5LL6 R;  1X49 A;  1IQO A;  4ZYE A;  2L3J A;  2NA2 A;  1XMQ E;  2EM7 A;  1ZAA C;  4N4R B;  5ADZ A;  5F3W A;  3THO B;  4GKJ E;  1DI2 A;  2YTE A;  4YY3 E;  3ADG A;  2EPM X;  1TF6 A;  2YT4 A;  2YWQ A;  2RSI A;  2DLQ A;  2R1F A;  2VQE E;  4BC7 A;  1YFH A;  1IBM E;  4R8O A;  5A69 A;  4OOG C;  3JTZ A;  2HC5 A;  4IJD A;  4M0V A;  4JI8 E;  1T4O A;  5CFF E;  4HEI A;  4IS1 C;  2EMB A;  1GTK A;  3ECR A;  5AC5 A;  1ZU1 A;  2UXD E;  2YU8 A;  2DMI A;  2RS6 A;  4TUG A;  4F6N A;  4TUI A;  1WHQ A;  2YRM A;  4WPY A;  2EOI A;  3C4B A;  1IMU A;  4L5N C;  2Q8U A;  4DV7 E;  3HQ1 A;  2YRK A;  2LV2 A;  1NEI A;  1HNZ E;  1AAY A;  3KWR A;  4JI3 E;  4R2S A;  5LMU E;  2ENC A;  1XNR E;  4ZYG A;  3IWB A;  1T39 A;  1X3C A;  1A1H A;  2LTS A;  2EMA A;  2UXB E;  4DR3 E;  4DUY E;  2ODR C;  4DR5 E;  4HTG A;  4F9B B;  2EPU A;  2MC6 A;  3EPL A;  1G2F C;  4X64 E;  2CTD A;  2FV4 B;  1WRJ A;  2WBT A;  2LMZ A;  4DV4 E;  1A1K A;  2L2K B;  4LFC E;  5AC4 A;  2EQ3 A;  2ADR A;  2YU5 A;  2EPX A;  5KL6 A;  4OX9 E;  3BID A;  2A25 A;  5IWA E;  4RHB B;  2NAB A;  2VE7 C;  4LF5 E;  4BHC A;  2L2M A;  5BR8 E;  2YTG A;  2R76 A;  1T4L B;  2V8Q B;  1BBO A;  2BB8 A;  4AQY E;  2ENH A;  2EE8 A;  2M7Q A;  4B3T E;  3J80 C;  1YYO A;  2EL5 A;  2EOS A;  2LVH A;  2LT7 A;  3ADJ A;  2G7H A;  2EPL X;  5A6J A;  4NXM E;  1HNX E;  2EPN A;  3OTO E;  3OML A;  4LF8 E;  2EQ0 A;  4JV5 E;  5KL5 A;  2GPI A;  1IBL E;  2ELY A;  1UBD C;  1YUI A;  3VK6 A;  2NUE A;  4M30 A;  4X66 E;  4MLQ A;  2F8B A;  3IWD A;  4F9A B;  3AUZ A;  1T4N A;  2EMI A;  4R2E A; 
#chains in the Genus database with same CATH homology
 4OOG C;  2JVA A;  5A2Q C;  3JTZ A;  4M0V A;  4JI8 E;  4DV3 E;  3F6G A;  4LFA E;  3T1H E;  1T4O A;  2UUA E;  4K0K E;  2B7V A;  5CFF E;  2RSM A;  3JU0 A;  2VQF E;  2LBS B;  3LLH A;  1N34 E;  4GKK E;  1GQE A;  4LF4 E;  5F3W A;  1RQ0 A;  4BMJ A;  2KOU A;  2E1M A;  1DI2 A;  4JI1 E;  1DQ3 A;  3F6H A;  2DSY A;  5AE2 A;  2YZT A;  4DR1 E;  2UXD E;  4DR7 E;  4DKK A;  1HNW E;  3HTX A;  2RS6 A;  4JI5 E;  4TUG A;  3LML A;  4L8N A;  4TUI A;  1N32 E;  4YHH E;  1WHQ A;  2L3C A;  2B3T B;  3DJW A;  4WPY A;  4DR2 E;  1YYK A;  2DB2 A;  3C4B A;  1N36 E;  4J8Z A;  4L5N C;  1ZBT A;  2M4I A;  2UUC E;  4DV7 E;  1UIL A;  2JR1 A;  3HQ1 A;  4M2Z A;  3DF6 A;  1HNZ E;  5AE3 A;  4I8O A;  3KWR A;  1SR9 A;  1UHZ A;  3P1X A;  4DV0 E;  3AV0 A;  4JI3 E;  3ADL A;  2H36 X;  2NUG A;  5LMU E;  1IBM E;  1FKA E;  4B3M E;  1XNR E;  2F4V E;  1N33 E;  2LJH A;  3IWB A;  3IWC A;  1RC7 A;  2JOX A;  2ODR D;  2LTR A;  3J81 C;  4P78 A;  2L92 A;  4X65 E;  4DV6 E;  4DV5 E;  2ZM6 E;  2EWL A;  2JWO A;  3C4T A;  4P7D A;  3MSW A;  2LTS A;  5LMN E;  2HHH E;  4WSP A;  1YYW A;  2B7T A;  4NXN E;  2UXB E;  5AE1 A;  4DR3 E;  2L8T A;  4DUY E;  3RMP A;  1STU A;  2ODR C;  2IHR 1;  3K6Q A;  4X8W A;  4DR5 E;  3J7A G;  2LRS A;  4F9B B;  1YZ9 A;  4JI7 E;  2MC6 A;  2NUF A;  2B9D A;  4B3R E;  2EZ6 A;  2WZO A;  2N3H A;  4LF9 E;  2N3G A;  4BS9 A;  4X64 E;  2V87 A;  5FLX C;  2FV4 B;  4JI6 E;  4GEQ B;  4B3S E;  1WHN A;  2V86 A;  2RS7 A;  1XNQ E;  4BBY A;  4JI4 E;  2LMZ A;  4BC9 A;  4DV4 E;  3VYY A;  1FJG E;  2DMY A;  2K4V A;  2KON A;  3JAM C;  4DV1 E;  2V88 A;  1ZBQ A;  4DR4 E;  2L2K B;  3ADI A;  4LFC E;  1IBK E;  4KHP E;  2KHX A;  2V83 A;  4OX9 E;  4F9C B;  2UUB E;  5IWA E;  2RTX A;  4JI0 E;  4JYA E;  2LUP B;  2VE7 C;  4LF5 E;  2L2M A;  1PKP A;  5BR8 E;  4F54 A;  4LF7 E;  5IT9 C;  2JY9 A;  2E5L E;  2MDR A;  1T4L B;  2V8Q B;  4R8O A;  2UXC E;  4AQY E;  1HR0 E;  4LFB E;  3J7Y p;  1XMO E;  2FGG A;  2JOB A;  5AAS A;  1J26 A;  4LTY A;  5T6J A;  2M7Q A;  2UU9 E;  4B3T E;  2L2N A;  3J80 C;  4WFT A;  1YYO A;  3FIG A;  2V85 A;  1EKZ A;  4DMI A;  1X48 A;  1I94 E;  4DV2 E;  3T1Y E;  2M1S A;  2MC5 A;  3ADJ A;  2L33 A;  4KZS A;  4X62 E;  2V89 A;  2G7H A;  1J5E E;  2LE2 A;  2CPN A;  1WXR A;  1HNX E;  3OTO E;  4NXM E;  2FTX B;  3OML A;  3VYX A;  5LL6 R;  3HXL A;  5DNY A;  4LF8 E;  4JV5 E;  1X49 A;  2L3J A;  2NA2 A;  1IBL E;  2L6M A;  4LU9 A;  1XMQ E;  4DUZ E;  3VK6 A;  2NUE A;  4M30 A;  4Q28 A;  4R03 A;  1O0W A;  5ADZ A;  3H09 A;  2F8B A;  4X66 E;  4YY3 E;  3IWD A;  3ADG A;  4WYQ B;  4BCA A;  4F9A B;  2YT4 A;  3AUZ A;  3HPS A;  4JI2 E;  2VQE E;  1QU6 A;  4GKJ E;  4LF6 E;  2LUQ A;  1X47 A;  3HPZ A;  3ZOQ B;  4BC7 A;  1T4N A;  4DR6 E;  2VF1 A;  2DIX A;  1GZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...