1STUA

Double stranded rna binding domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
68
structure length
68
Chain Sequence
PISQVHEIGIKRNMTVHFKVLREEGPAHMKNFITACIVGSIVTEGEGNGKKVSKKRAAEKMLVELQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Double stranded rna binding domain
molecule keywords MATERNAL EFFECT PROTEIN STAUFEN
publication title NMR solution structure of a dsRNA binding domain from Drosophila staufen protein reveals homology to the N-terminal domain of ribosomal protein S5.
pubmed rcsb
source organism Drosophila melanogaster
total genus 10
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1995-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1stuA00
4DR5E 4LF8E 4GKJE 4GKKE 2RSMA 1T4NA 2LTSA 4LF5E 1YZ9A 1X47A 4JI2E 2L2NA 4JI1E 2RTXA 2HHHE 4X8WA 2LBSB 1IBME 4JI8E 4DV0E 3J7Yp 4DR2E 2MDRA 4JI4E 3ADIA 4JI3E 4JI6E 4YY3E 1XMQE 2L3CA 2LRSA 3VYYA 1XNQE 1RC7A 1YYWA 4B3RE 5LMUE 1UILA 3ADJA 2LJHA 1T4OA 2DB2A 4DV1E 1X49A 2L2KB 2NUFA 5CFFE 2UU9E 4LFCE 4DV6E 1X48A 2B3TB 4JI0E 3C4TA 4LF4E 4JI7E 4K0KE 3C4BA 2EZ6A 4DR7E 4X66E 2ZM6E 4DV7E 4NXNE 2JY9A 1YYOA 2UUAE 2RS7A 5IWAE 2UUCE 4JI5E 1PKPA 1WHNA 1FKAE 1T4LB 1N36E 1UHZA 5BR8E 1J26A 4DR6E 1O0WA 4NXME 4LFBE 2F4VE 2UXBE 4LFAE 2LUQA 1HR0E 1XMOE 4DUZE 4DV2E 4OX9E 4DKKA 3P1XA 2YT4A 4JV5E 4B3SE 1WHQA 1IBLE 1HNZE 4DR1E 1DI2A 2LUPB 2RS6A 4DR4E 2N3HA 2UXCE 2IHR1 3T1YE 2L2MA 3T1HE 4X64E 2DMYA 4YHHE 4DV3E 2VQEE 2NUGA 4X62E 2VQFE 2NUEA 4LF6E 3HTXA 4DV4E 4AQYE 4B3ME 2JVAA 2LTRA 2L3JA 4M2ZA 4LF9E 4DR3E 3VYXA 1HNXE 1N32E 4M30A 4DV5E 2B7TA 1STUA 2N3GA 2UXDE 3OTOE 1N34E 1EKZA 4X65E 1ZBTA 3ADLA 1XNRE 1YYKA 2E5LE 4B3TE 2DIXA 1IBKE 2NA2A 3LLHA 4DUYE 1QU6A 1GQEA 2L33A 2B7VA 2UUBE 4LF7E 3ADGA 1FJGE 4KHPE 4JYAE 2CPNA 4WFTA 1RQ0A 5LMNE 1J5EE 2KHXA 4OOGC 4WYQB 1I94E 1N33E 1HNWE
chains in the Genus database with same CATH superfamily
1X6HA 4L5NC 4DR5E 2YTOA 2EPMX 2RSMA 1T4NA 2CT1A 3EPLA 1YUIA 2EMYA 1EH8A 2EPOA 4JI1E 2K4VA 3EPJA 1BBOA 4HEIA 4BHCA 1PJSA 2D9HA 3VK6A 2LRSA 1XNQE 2EMCA 2LE2A 2BBGA 1A1HA 2LJHA 1T4OA 5IXMB 4DV1E 4N4RB 2RQLA 2EL4A 3BIDA 4R2RA 1BB8A 5CFFE 4WX9A 4BBYA 5IT9C 2B3TB 4O5GA 1BBGA 3C6KA 4FK5C 2EZ6A 3OMLA 2V88A 2YTNA 2E72A 3BF2A 2EPXA 2YTPA 4WXCA 4X66E 2ZM6E 4DV7E 5AC4A 2FGGA 2RPCA 5IWAE 2YRKA 4JI5E 1N36E 3J81C 2YTIA 1J26A 1IQOA 4X9JA 1O0WA 3IWCA 1DQ3A 2UXBE 4LFAE 2EMLA 2V89A 2KOUA 2JOXA 1AH5A 4TUIA 4KWYA 1WHQA 1IBLE 1HNZE 1A1JA 2EOZA 4DR4E 2DLKA 2N3HA 4R2QA 3T1YE 3T1HE 4NZVA 2VQEE 4NHRA 2YPNA 2R1FA 2G7HA 4DV4E 3L00A 1B69A 2JVAA 2LTRA 1KJKA 5F3WA 2E1MA 2EN3A 4F9BB 4LF9E 2DSYA 3EPKA 1HNXE 5LL6R 4DV5E 4J8ZA 3BBGA 2B7TA 1A1LA 3JTZA 1X6EA 2N3GA 3OTOE 3JAMC 2YTEA 3ADLA 4ZYGA 4HTGA 3H09A 2YTGA 2EWLA 2EPZA 2R76A 2V83A 1MGTA 1LLMC 2V8QB 5A6BD 1GQEA 4P78A 4O4KA 1T39A 2EOOA 1NCSA 2LCEA 5KL2A 1IQSA 2KHXA 4WYQB 1I94E 2YWQA 4BS9A 1RMDA 1EH7A 3DJWA 3RMPA 2V87A 5KL7A 2NABA 4R2EA 2DRPA 2LTSA 2EMWA 1WRJA 1YSAC 4LF5E 2JOBA 2WBUA 4WSGA 2HHHE 2LBSB 4JI8E 4DV0E 4DR2E 4JI4E 3K6QA 2M1SA 4JI3E 4JI6E 2EJ4A 1XMQE 2L3CA 4ZYDA 4B3RE 4WSPA 2EMAA 1ZU1A 2EOEA 2WBSA 1EH6A 4IJDA 3VHTB 2L2KB 2EOQA 4F54A 4LFCE 4GZNC 4JI0E 3C4TA 5AE3A 2EM2A 4LF4E 4JI7E 2YTFA 2FTXB 3BGHA 3HPSA 2EOYA 2L8TA 2ADRA 2I9IA 2EN7A 2UUAE 2RS7A 1G2DC 1PKPA 2GLIA 1FKAE 4BCAA 3THOB 2MC6A 1L4SA 1UHZA 4F2JC 2EQ3A 2DGCA 4NXME 4LFBE 2LUQA 5A6AA 2YSOA 4OX9E 3P1XA 2L92A 2EPKX 4B3SE 2EP3A 2LUPB 2IHR1 2EE8A 2NUGA 4R2DA 1SR9A 4X62E 2YTDA 4LF6E 3HTXA 4RHBB 1T38A 5T6JA 2L3JA 1IMUA 3KZYA 4R2CA 2CTDA 1N32E 2YTJA 1KYQA 3UK3C 1TF3A 4F9AB 4M9VC 2EM5A 2EMGA 2ENAA 3KZZA 1X5WA 2V86A 4R2PA 2EPNA 2WBTA 1G2FC 2EPPA 4LTYA 2M7QA 1YPNA 2DIXA 3HPZA 1IBKE 4B3TE 3LLHA 3M99B 1UBDC 5TSEA 5A2QC 2L33A 4IS1C 3MHSC 4LF7E 1ZBQA 2BB8A 4O43A 2K7IA 1TN9A 2GPIA 2ODRD 2CPNA 4WFTA 1NEIA 3KWRA 1JK2A 1SFEA 5LMNE 1J5EE 2FV4B 4L8NA 1N33E 2EMBA 2EOMA 4LF8E 4GKJE 2LMZA 2YSPA 2EQ0A 2EOXA 2JWOA 4GEQB 2H36X 1YZ9A 1X47A 2VRDA 3ZOQB 3JU0A 2RTXA 2WZOA 4X8WA 1IBME 4F6NA 3J7Yp 2MDRA 4YY3E 1RC7A 2EN2A 3DF6A 3ADJA 2DB2A 2MC5A 2LO3A 2ELZA 1YUJA 4O24A 1Z1BA 2EM3A 1X49A 2NUFA 2EORA 2EPRA 4DV6E 2EM8A 1X48A 5DNYA 2EM6A 4K0KE 4I8OA 2JXPA 1GTKA 2EL5A 4NXNE 5A69A 1YYOA 2LT7A 2EN8A 2EPLX 2ENHA 1X3CA 2LV2A 3J80C 5AE2A 5BR8E 2DLQA 3HQ1A 1WJPA 2HC5A 1HR0E 1PDAA 2EM0A 1DI2A 3C6MA 2UXCE 4X64E 2DMYA 4YHHE 4DV3E 2RSIA 4BC9A 2VQFE 2V85A 2NUEA 3EQ1A 2HJJA 4B3ME 2EM9A 2MKNA 2EOHA 5A6JA 4DR3E 4M30A 4Q35B 1P47A 4Q28A 2UXDE 5ADZA 1A1FA 1N34E 5AASA 2VF1A 5AC5A 1X6FA 2EN1A 4RH8A 4LU9A 4MLVA 2E5LE 3FIGA 4BMJA 4DUYE 2YZTA 2B7VA 2MKDA 2UUBE 1FJGE 4KHPE 2EMXA 3ECRA 5IV8B 4JYAE 2CSHA 1MEYC 3MSWA 2GHFA 2M9AA 1RQ0A 3AV0A 2EOSA 4OOGC 5A6BA 1HNWE 3MHHC 4GKKE 5LLQA 2J7JA 2N8XA 2YTQA 4JI2E 4F6MA 2L2NA 2EN4A 2EL6A 1N3GA 5A6KA 3ADIA 3QG5C 1TF6A 1A1GA 1DGCA 2LVHA 3VYYA 2EOFA 1YYWA 2VE7C 5LMUE 1UILA 3J7AG 4MLQA 2JYAA 5KL4A 2WCC3 4BHBA 2EMFA 2F8BA 3F6HA 4WPYA 1F2IG 2UU9E 3THNA 2YRMA 2B9DA 4R8OA 1GZ6A 2EM7A 3C4BA 1JK1A 4DR7E 2L6MA 2JP9A 4M0VA 2JY9A 4P7DA 2UUCE 1WHNA 5KL5A 1T4LB 3IWBA 2EOIA 2ELYA 5KL6A 3AUZA 2YRHA 4DR6E 2A25A 1ZAAC 2EPCA 2F4VE 2PRTA 1XMOE 1WXRA 4DUZE 2YU5A 4DV2E 4DKKA 4F9CB 2YT4A 4JV5E 2DMIA 1PJQA 4DR1E 2RS6A 1QNTA 2EMZA 4TUGA 2EM4A 1UN6B 2L2MA 2EMIA 3IWDA 2M4IA 4BC7A 2HGHA 3EPHA 4R2SA 2EN6A 2EMKA 2EMHA 2ENCA 4AQYE 4KZSA 1AAYA 4M2ZA 2LJUA 3VYXA 3HXLA 2EOJA 2EQ1A 1STUA 5FLXC 3F6GA 4ZYEA 1EKZA 2YU8A 4X65E 2JPAA 4R2AA 1ZBTA 1XNRE 2EPAA 1YYKA 1A1IA 3LMLA 1A1KA 2NA2A 1QU6A 2MDGA 4WXDA 4R03A 2EPUA 3ADGA 5AE1A 2I13A 4DMIA 1PJTA 3TQMA 2Q8UA 4ZYHA 1YFHA 2ODRC 2KONA 5KL3A 2JR1A 1ZR9A
chains in the Genus database with same CATH topology
4DR5E 4L5NC 2V87A 3RMPA 4LF8E 4GKJE 4GKKE 2LMZA 4GEQB 2RSMA 2JWOA 1T4NA 2LTSA 2H36X 4LF5E 1YZ9A 1X47A 2JOBA 4JI2E 2L2NA 3ZOQB 3JU0A 2K4VA 2RTXA 2HHHE 4JI1E 2WZOA 4X8WA 2LBSB 1IBME 4JI8E 4DV0E 3J7Yp 4DR2E 2MDRA 4JI4E 3ADIA 3K6QA 2M1SA 4JI3E 4JI6E 4YY3E 1XMQE 3VK6A 2LRSA 2L3CA 3VYYA 1RC7A 1XNQE 1YYWA 4B3RE 2LE2A 4WSPA 2VE7C 5LMUE 1UILA 3J7AG 3DF6A 3ADJA 2LJHA 1T4OA 2DB2A 2MC5A 4DV1E 1X49A 2F8BA 3F6HA 2L2KB 2NUFA 4WPYA 4F54A 5CFFE 4BBYA 2UU9E 4LFCE 4DV6E 1X48A 5IT9C 2B3TB 2B9DA 3C4TA 4R8OA 5AE3A 5DNYA 4JI7E 4JI0E 4LF4E 2FTXB 4I8OA 1GZ6A 3HPSA 4K0KE 3C4BA 2EZ6A 3OMLA 2V88A 2L6MA 4X66E 2L8TA 2ZM6E 4DR7E 4DV7E 4M0VA 4NXNE 2JY9A 4P7DA 2FGGA 1YYOA 2UUAE 2RS7A 5IWAE 2UUCE 4JI5E 1PKPA 1WHNA 1FKAE 4BCAA 1T4LB 3IWBA 1N36E 3J81C 3AUZA 3J80C 2MC6A 5AE2A 1UHZA 5BR8E 1J26A 3HQ1A 4DR6E 1O0WA 3IWCA 4NXME 4LFBE 1DQ3A 2F4VE 2UXBE 4LFAE 2LUQA 1HR0E 1XMOE 2V89A 2KOUA 1WXRA 4DUZE 2JOXA 4DV2E 4OX9E 4DKKA 3P1XA 2YT4A 2L92A 4F9CB 4TUIA 4JV5E 4B3SE 1WHQA 1IBLE 1HNZE 4DR1E 1DI2A 2LUPB 2RS6A 4DR4E 4TUGA 2N3HA 2UXCE 2IHR1 3T1YE 2L2MA 3T1HE 3IWDA 4X64E 2DMYA 4YHHE 4DV3E 2M4IA 2VQEE 2NUGA 4BC7A 1SR9A 4BC9A 4X62E 2VQFE 2V85A 4LF6E 2NUEA 3HTXA 2G7HA 4DV4E 4AQYE 4KZSA 2JVAA 4B3ME 2LTRA 5T6JA 2E1MA 5F3WA 4F9BB 2L3JA 4LF9E 2DSYA 4M2ZA 4DR3E 3HXLA 3VYXA 1HNXE 1N32E 4M30A 5LL6R 4DV5E 4J8ZA 4F9AB 2B7TA 1STUA 3JTZA 2N3GA 4Q28A 5ADZA 5FLXC 3OTOE 3JAMC 2UXDE 3F6GA 1N34E 1EKZA 5AASA 2VF1A 2V86A 4X65E 1ZBTA 3ADLA 1XNRE 4LU9A 1YYKA 4LTYA 2M7QA 3H09A 3LMLA 2E5LE 4B3TE 2DIXA 2EWLA 3FIGA 3HPZA 2NA2A 3LLHA 4BMJA 4DUYE 2V83A 1IBKE 2V8QB 1QU6A 5A2QC 1GQEA 2L33A 2YZTA 2B7VA 4P78A 2UUBE 4R03A 1ZBQA 4LF7E 3ADGA 5AE1A 1FJGE 4KHPE 4DMIA 4JYAE 2ODRD 3MSWA 2ODRC 2CPNA 2KONA 4WFTA 3KWRA 1RQ0A 5LMNE 3AV0A 1J5EE 2KHXA 4OOGC 2FV4B 4WYQB 4L8NA 1I94E 4BS9A 1N33E 3DJWA 2JR1A 1HNWE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR5 E;  4LF8 E;  4GKJ E;  4GKK E;  2RSM A;  1T4N A;  2LTS A;  4LF5 E;  1YZ9 A;  1X47 A;  4JI2 E;  2L2N A;  4JI1 E;  2RTX A;  2HHH E;  4X8W A;  2LBS B;  1IBM E;  4JI8 E;  4DV0 E;  3J7Y p;  4DR2 E;  2MDR A;  4JI4 E;  3ADI A;  4JI3 E;  4JI6 E;  4YY3 E;  1XMQ E;  2L3C A;  2LRS A;  3VYY A;  1XNQ E;  1RC7 A;  1YYW A;  4B3R E;  5LMU E;  1UIL A;  3ADJ A;  2LJH A;  1T4O A;  2DB2 A;  4DV1 E;  1X49 A;  2L2K B;  2NUF A;  5CFF E;  2UU9 E;  4LFC E;  4DV6 E;  1X48 A;  2B3T B;  4JI0 E;  3C4T A;  4LF4 E;  4JI7 E;  4K0K E;  3C4B A;  2EZ6 A;  4DR7 E;  4X66 E;  2ZM6 E;  4DV7 E;  4NXN E;  2JY9 A;  1YYO A;  2UUA E;  2RS7 A;  5IWA E;  2UUC E;  4JI5 E;  1PKP A;  1WHN A;  1FKA E;  1T4L B;  1N36 E;  1UHZ A;  5BR8 E;  1J26 A;  4DR6 E;  1O0W A;  4NXM E;  4LFB E;  2F4V E;  2UXB E;  4LFA E;  2LUQ A;  1HR0 E;  1XMO E;  4DUZ E;  4DV2 E;  4OX9 E;  4DKK A;  3P1X A;  2YT4 A;  4JV5 E;  4B3S E;  1WHQ A;  1IBL E;  1HNZ E;  4DR1 E;  1DI2 A;  2LUP B;  2RS6 A;  4DR4 E;  2N3H A;  2UXC E;  2IHR 1;  3T1Y E;  2L2M A;  3T1H E;  4X64 E;  2DMY A;  4YHH E;  4DV3 E;  2VQE E;  2NUG A;  4X62 E;  2VQF E;  2NUE A;  4LF6 E;  3HTX A;  4DV4 E;  4AQY E;  4B3M E;  2JVA A;  2LTR A;  2L3J A;  4M2Z A;  4LF9 E;  4DR3 E;  3VYX A;  1HNX E;  1N32 E;  4M30 A;  4DV5 E;  2B7T A;  1STU A;  2N3G A;  2UXD E;  3OTO E;  1N34 E;  1EKZ A;  4X65 E;  1ZBT A;  3ADL A;  1XNR E;  1YYK A;  2E5L E;  4B3T E;  2DIX A;  1IBK E;  2NA2 A;  3LLH A;  4DUY E;  1QU6 A;  1GQE A;  2L33 A;  2B7V A;  2UUB E;  4LF7 E;  3ADG A;  1FJG E;  4KHP E;  4JYA E;  2CPN A;  4WFT A;  1RQ0 A;  5LMN E;  1J5E E;  2KHX A;  4OOG C;  4WYQ B;  1I94 E;  1N33 E;  1HNW E; 
#chains in the Genus database with same CATH topology
 1X6H A;  4L5N C;  4DR5 E;  2YTO A;  2EPM X;  2RSM A;  1T4N A;  2CT1 A;  3EPL A;  1YUI A;  2EMY A;  1EH8 A;  2EPO A;  4JI1 E;  2K4V A;  3EPJ A;  1BBO A;  4HEI A;  4BHC A;  1PJS A;  2D9H A;  3VK6 A;  2LRS A;  1XNQ E;  2EMC A;  2LE2 A;  2BBG A;  1A1H A;  2LJH A;  1T4O A;  5IXM B;  4DV1 E;  4N4R B;  2RQL A;  2EL4 A;  3BID A;  4R2R A;  1BB8 A;  5CFF E;  4WX9 A;  4BBY A;  5IT9 C;  2B3T B;  4O5G A;  1BBG A;  3C6K A;  4FK5 C;  2EZ6 A;  3OML A;  2V88 A;  2YTN A;  2E72 A;  3BF2 A;  2EPX A;  2YTP A;  4WXC A;  4X66 E;  2ZM6 E;  4DV7 E;  5AC4 A;  2FGG A;  2RPC A;  5IWA E;  2YRK A;  4JI5 E;  1N36 E;  3J81 C;  2YTI A;  1J26 A;  1IQO A;  4X9J A;  1O0W A;  3IWC A;  1DQ3 A;  2UXB E;  4LFA E;  2EML A;  2V89 A;  2KOU A;  2JOX A;  1AH5 A;  4TUI A;  4KWY A;  1WHQ A;  1IBL E;  1HNZ E;  1A1J A;  2EOZ A;  4DR4 E;  2DLK A;  2N3H A;  4R2Q A;  3T1Y E;  3T1H E;  4NZV A;  2VQE E;  4NHR A;  2YPN A;  2R1F A;  2G7H A;  4DV4 E;  3L00 A;  1B69 A;  2JVA A;  2LTR A;  1KJK A;  5F3W A;  2E1M A;  2EN3 A;  4F9B B;  4LF9 E;  2DSY A;  3EPK A;  1HNX E;  5LL6 R;  4DV5 E;  4J8Z A;  3BBG A;  2B7T A;  1A1L A;  3JTZ A;  1X6E A;  2N3G A;  3OTO E;  3JAM C;  2YTE A;  3ADL A;  4ZYG A;  4HTG A;  3H09 A;  2YTG A;  2EWL A;  2EPZ A;  2R76 A;  2V83 A;  1MGT A;  1LLM C;  2V8Q B;  5A6B D;  1GQE A;  4P78 A;  4O4K A;  1T39 A;  2EOO A;  1NCS A;  2LCE A;  5KL2 A;  1IQS A;  2KHX A;  4WYQ B;  1I94 E;  2YWQ A;  4BS9 A;  1RMD A;  1EH7 A;  3DJW A;  3RMP A;  2V87 A;  5KL7 A;  2NAB A;  4R2E A;  2DRP A;  2LTS A;  2EMW A;  1WRJ A;  1YSA C;  4LF5 E;  2JOB A;  2WBU A;  4WSG A;  2HHH E;  2LBS B;  4JI8 E;  4DV0 E;  4DR2 E;  4JI4 E;  3K6Q A;  2M1S A;  4JI3 E;  4JI6 E;  2EJ4 A;  1XMQ E;  2L3C A;  4ZYD A;  4B3R E;  4WSP A;  2EMA A;  1ZU1 A;  2EOE A;  2WBS A;  1EH6 A;  4IJD A;  3VHT B;  2L2K B;  2EOQ A;  4F54 A;  4LFC E;  4GZN C;  4JI0 E;  3C4T A;  5AE3 A;  2EM2 A;  4LF4 E;  4JI7 E;  2YTF A;  2FTX B;  3BGH A;  3HPS A;  2EOY A;  2L8T A;  2ADR A;  2I9I A;  2EN7 A;  2UUA E;  2RS7 A;  1G2D C;  1PKP A;  2GLI A;  1FKA E;  4BCA A;  3THO B;  2MC6 A;  1L4S A;  1UHZ A;  4F2J C;  2EQ3 A;  2DGC A;  4NXM E;  4LFB E;  2LUQ A;  5A6A A;  2YSO A;  4OX9 E;  3P1X A;  2L92 A;  2EPK X;  4B3S E;  2EP3 A;  2LUP B;  2IHR 1;  2EE8 A;  2NUG A;  4R2D A;  1SR9 A;  4X62 E;  2YTD A;  4LF6 E;  3HTX A;  4RHB B;  1T38 A;  5T6J A;  2L3J A;  1IMU A;  3KZY A;  4R2C A;  2CTD A;  1N32 E;  2YTJ A;  1KYQ A;  3UK3 C;  1TF3 A;  4F9A B;  4M9V C;  2EM5 A;  2EMG A;  2ENA A;  3KZZ A;  1X5W A;  2V86 A;  4R2P A;  2EPN A;  2WBT A;  1G2F C;  2EPP A;  4LTY A;  2M7Q A;  1YPN A;  2DIX A;  3HPZ A;  1IBK E;  4B3T E;  3LLH A;  3M99 B;  1UBD C;  5TSE A;  5A2Q C;  2L33 A;  4IS1 C;  3MHS C;  4LF7 E;  1ZBQ A;  2BB8 A;  4O43 A;  2K7I A;  1TN9 A;  2GPI A;  2ODR D;  2CPN A;  4WFT A;  1NEI A;  3KWR A;  1JK2 A;  1SFE A;  5LMN E;  1J5E E;  2FV4 B;  4L8N A;  1N33 E;  2EMB A;  2EOM A;  4LF8 E;  4GKJ E;  2LMZ A;  2YSP A;  2EQ0 A;  2EOX A;  2JWO A;  4GEQ B;  2H36 X;  1YZ9 A;  1X47 A;  2VRD A;  3ZOQ B;  3JU0 A;  2RTX A;  2WZO A;  4X8W A;  1IBM E;  4F6N A;  3J7Y p;  2MDR A;  4YY3 E;  1RC7 A;  2EN2 A;  3DF6 A;  3ADJ A;  2DB2 A;  2MC5 A;  2LO3 A;  2ELZ A;  1YUJ A;  4O24 A;  1Z1B A;  2EM3 A;  1X49 A;  2NUF A;  2EOR A;  2EPR A;  4DV6 E;  2EM8 A;  1X48 A;  5DNY A;  2EM6 A;  4K0K E;  4I8O A;  2JXP A;  1GTK A;  2EL5 A;  4NXN E;  5A69 A;  1YYO A;  2LT7 A;  2EN8 A;  2EPL X;  2ENH A;  1X3C A;  2LV2 A;  3J80 C;  5AE2 A;  5BR8 E;  2DLQ A;  3HQ1 A;  1WJP A;  2HC5 A;  1HR0 E;  1PDA A;  2EM0 A;  1DI2 A;  3C6M A;  2UXC E;  4X64 E;  2DMY A;  4YHH E;  4DV3 E;  2RSI A;  4BC9 A;  2VQF E;  2V85 A;  2NUE A;  3EQ1 A;  2HJJ A;  4B3M E;  2EM9 A;  2MKN A;  2EOH A;  5A6J A;  4DR3 E;  4M30 A;  4Q35 B;  1P47 A;  4Q28 A;  2UXD E;  5ADZ A;  1A1F A;  1N34 E;  5AAS A;  2VF1 A;  5AC5 A;  1X6F A;  2EN1 A;  4RH8 A;  4LU9 A;  4MLV A;  2E5L E;  3FIG A;  4BMJ A;  4DUY E;  2YZT A;  2B7V A;  2MKD A;  2UUB E;  1FJG E;  4KHP E;  2EMX A;  3ECR A;  5IV8 B;  4JYA E;  2CSH A;  1MEY C;  3MSW A;  2GHF A;  2M9A A;  1RQ0 A;  3AV0 A;  2EOS A;  4OOG C;  5A6B A;  1HNW E;  3MHH C;  4GKK E;  5LLQ A;  2J7J A;  2N8X A;  2YTQ A;  4JI2 E;  4F6M A;  2L2N A;  2EN4 A;  2EL6 A;  1N3G A;  5A6K A;  3ADI A;  3QG5 C;  1TF6 A;  1A1G A;  1DGC A;  2LVH A;  3VYY A;  2EOF A;  1YYW A;  2VE7 C;  5LMU E;  1UIL A;  3J7A G;  4MLQ A;  2JYA A;  5KL4 A;  2WCC 3;  4BHB A;  2EMF A;  2F8B A;  3F6H A;  4WPY A;  1F2I G;  2UU9 E;  3THN A;  2YRM A;  2B9D A;  4R8O A;  1GZ6 A;  2EM7 A;  3C4B A;  1JK1 A;  4DR7 E;  2L6M A;  2JP9 A;  4M0V A;  2JY9 A;  4P7D A;  2UUC E;  1WHN A;  5KL5 A;  1T4L B;  3IWB A;  2EOI A;  2ELY A;  5KL6 A;  3AUZ A;  2YRH A;  4DR6 E;  2A25 A;  1ZAA C;  2EPC A;  2F4V E;  2PRT A;  1XMO E;  1WXR A;  4DUZ E;  2YU5 A;  4DV2 E;  4DKK A;  4F9C B;  2YT4 A;  4JV5 E;  2DMI A;  1PJQ A;  4DR1 E;  2RS6 A;  1QNT A;  2EMZ A;  4TUG A;  2EM4 A;  1UN6 B;  2L2M A;  2EMI A;  3IWD A;  2M4I A;  4BC7 A;  2HGH A;  3EPH A;  4R2S A;  2EN6 A;  2EMK A;  2EMH A;  2ENC A;  4AQY E;  4KZS A;  1AAY A;  4M2Z A;  2LJU A;  3VYX A;  3HXL A;  2EOJ A;  2EQ1 A;  1STU A;  5FLX C;  3F6G A;  4ZYE A;  1EKZ A;  2YU8 A;  4X65 E;  2JPA A;  4R2A A;  1ZBT A;  1XNR E;  2EPA A;  1YYK A;  1A1I A;  3LML A;  1A1K A;  2NA2 A;  1QU6 A;  2MDG A;  4WXD A;  4R03 A;  2EPU A;  3ADG A;  5AE1 A;  2I13 A;  4DMI A;  1PJT A;  3TQM A;  2Q8U A;  4ZYH A;  1YFH A;  2ODR C;  2KON A;  5KL3 A;  2JR1 A;  1ZR9 A; 
#chains in the Genus database with same CATH homology
 4DR5 E;  4L5N C;  2V87 A;  3RMP A;  4LF8 E;  4GKJ E;  4GKK E;  2LMZ A;  4GEQ B;  2RSM A;  2JWO A;  1T4N A;  2LTS A;  2H36 X;  4LF5 E;  1YZ9 A;  1X47 A;  2JOB A;  4JI2 E;  2L2N A;  3ZOQ B;  3JU0 A;  2K4V A;  2RTX A;  2HHH E;  4JI1 E;  2WZO A;  4X8W A;  2LBS B;  1IBM E;  4JI8 E;  4DV0 E;  3J7Y p;  4DR2 E;  2MDR A;  4JI4 E;  3ADI A;  3K6Q A;  2M1S A;  4JI3 E;  4JI6 E;  4YY3 E;  1XMQ E;  3VK6 A;  2LRS A;  2L3C A;  3VYY A;  1RC7 A;  1XNQ E;  1YYW A;  4B3R E;  2LE2 A;  4WSP A;  2VE7 C;  5LMU E;  1UIL A;  3J7A G;  3DF6 A;  3ADJ A;  2LJH A;  1T4O A;  2DB2 A;  2MC5 A;  4DV1 E;  1X49 A;  2F8B A;  3F6H A;  2L2K B;  2NUF A;  4WPY A;  4F54 A;  5CFF E;  4BBY A;  2UU9 E;  4LFC E;  4DV6 E;  1X48 A;  5IT9 C;  2B3T B;  2B9D A;  3C4T A;  4R8O A;  5AE3 A;  5DNY A;  4JI7 E;  4JI0 E;  4LF4 E;  2FTX B;  4I8O A;  1GZ6 A;  3HPS A;  4K0K E;  3C4B A;  2EZ6 A;  3OML A;  2V88 A;  2L6M A;  4X66 E;  2L8T A;  2ZM6 E;  4DR7 E;  4DV7 E;  4M0V A;  4NXN E;  2JY9 A;  4P7D A;  2FGG A;  1YYO A;  2UUA E;  2RS7 A;  5IWA E;  2UUC E;  4JI5 E;  1PKP A;  1WHN A;  1FKA E;  4BCA A;  1T4L B;  3IWB A;  1N36 E;  3J81 C;  3AUZ A;  3J80 C;  2MC6 A;  5AE2 A;  1UHZ A;  5BR8 E;  1J26 A;  3HQ1 A;  4DR6 E;  1O0W A;  3IWC A;  4NXM E;  4LFB E;  1DQ3 A;  2F4V E;  2UXB E;  4LFA E;  2LUQ A;  1HR0 E;  1XMO E;  2V89 A;  2KOU A;  1WXR A;  4DUZ E;  2JOX A;  4DV2 E;  4OX9 E;  4DKK A;  3P1X A;  2YT4 A;  2L92 A;  4F9C B;  4TUI A;  4JV5 E;  4B3S E;  1WHQ A;  1IBL E;  1HNZ E;  4DR1 E;  1DI2 A;  2LUP B;  2RS6 A;  4DR4 E;  4TUG A;  2N3H A;  2UXC E;  2IHR 1;  3T1Y E;  2L2M A;  3T1H E;  3IWD A;  4X64 E;  2DMY A;  4YHH E;  4DV3 E;  2M4I A;  2VQE E;  2NUG A;  4BC7 A;  1SR9 A;  4BC9 A;  4X62 E;  2VQF E;  2V85 A;  4LF6 E;  2NUE A;  3HTX A;  2G7H A;  4DV4 E;  4AQY E;  4KZS A;  2JVA A;  4B3M E;  2LTR A;  5T6J A;  2E1M A;  5F3W A;  4F9B B;  2L3J A;  4LF9 E;  2DSY A;  4M2Z A;  4DR3 E;  3HXL A;  3VYX A;  1HNX E;  1N32 E;  4M30 A;  5LL6 R;  4DV5 E;  4J8Z A;  4F9A B;  2B7T A;  1STU A;  3JTZ A;  2N3G A;  4Q28 A;  5ADZ A;  5FLX C;  3OTO E;  3JAM C;  2UXD E;  3F6G A;  1N34 E;  1EKZ A;  5AAS A;  2VF1 A;  2V86 A;  4X65 E;  1ZBT A;  3ADL A;  1XNR E;  4LU9 A;  1YYK A;  4LTY A;  2M7Q A;  3H09 A;  3LML A;  2E5L E;  4B3T E;  2DIX A;  2EWL A;  3FIG A;  3HPZ A;  2NA2 A;  3LLH A;  4BMJ A;  4DUY E;  2V83 A;  1IBK E;  2V8Q B;  1QU6 A;  5A2Q C;  1GQE A;  2L33 A;  2YZT A;  2B7V A;  4P78 A;  2UUB E;  4R03 A;  1ZBQ A;  4LF7 E;  3ADG A;  5AE1 A;  1FJG E;  4KHP E;  4DMI A;  4JYA E;  2ODR D;  3MSW A;  2ODR C;  2CPN A;  2KON A;  4WFT A;  3KWR A;  1RQ0 A;  5LMN E;  3AV0 A;  1J5E E;  2KHX A;  4OOG C;  2FV4 B;  4WYQ B;  4L8N A;  1I94 E;  4BS9 A;  1N33 E;  3DJW A;  2JR1 A;  1HNW E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...