5KL7A

Wilms tumor protein (wt1) znf2-4q369r in complex with carboxylated dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
87
structure length
87
Chain Sequence
b'EKPYQCDFKDCERRFSRSDRLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Wilms tumor protein
publication title Denys-Drash syndrome associated WT1 glutamine 369 mutants have altered sequence-preferences and altered responses to epigenetic modifications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 29
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2016-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 5kl7A00
2MKDA 2EMIA 2NABA 1F2IG 2YTFA 2YU8A 2YRKA 2YTDA 2ELZA 2WCC3 2EMBA 1A1KA 1X3CA 2EOFA 2LT7A 2MKNA 2WBUA 2A25A 2RSIA 1A1IA 2EM5A 4FK5C 5KL3A 4X9JA 2EOQA 1TN9A 2R1FA 2LCEA 2WBTA 2EOJA 5KL5A 2EM2A 3MHHC 2EM7A 1X5WA 2CT1A 4F2JC 2LV2A 4F6MA 2EPRA 1UN6B 2EL4A 4R2DA 2EM3A 3M99B 2EN3A 2EJ4A 2YTIA 1ZAAC 3MHSC 2EMAA 2YTPA 4R2PA 2JP9A 2DMIA 2GHFA 4IJDA 4R2QA 2EMYA 2YTOA 2HGHA 1ZU1A 2EN1A 2EPUA 2M9AA 2EOMA 1KJKA 2LVHA 5KL4A 2EMGA 2YSPA 2EM4A 2ENAA 2EPPA 1Z1BA 1LLMC 2EMCA 2CSHA 2LO3A 2EOIA 2YTEA 1ZR9A 2EE8A 1BB8A 2DGCA 1A1FA 2DLQA 3EPKA 5KL6A 1YUJA 1UBDC 1YSAC 2CTDA 2YU5A 2EL5A 2EOXA 2EPCA 2EPXA 4R2AA 1RMDA 2EN2A 2EMKA 2YTJA 1P47A 2EMFA 2EPAA 2DLKA 2EM0A 2YSOA 5KL2A 3VHTB 2GLIA 1WJPA 4R2EA 2EQ0A 2MDGA 4R2RA 3EPHA 2VRDA 1A1GA 1X6FA 2EM9A 1BBOA 2EMHA 4WSGA 2EOYA 2EP3A 2EOHA 2BB8A 2YTGA 3EPLA 2ELYA 2ENHA 2EOEA 2EN7A 2EOOA 2EQ3A 1X6EA 4F6NA 1A1JA 1TF3A 3EPJA 1AAYA 2EMWA 2EOZA 4R2SA 1B69A 2EQ1A 5KL7A 4M9VC 2YRHA 2EM6A 1YUIA 2ADRA 1TF6A 2EN6A 1G2FC 1MEYC 1JK2A 2WBSA 2PRTA 2EN8A 2RPCA 2E72A 3UK3C 1A1LA 4R2CA 2JPAA 2EMXA 2I13A 1JK1A 4IS1C 2YTNA 2EMZA 2D9HA 2J7JA 1NCSA 2EM8A 1DGCA 2YTQA 2ENCA 2EN4A 2EL6A 2YRMA 1G2DC 2EOSA 2EORA 2EMLA 4GZNC 1A1HA 2DRPA 2EPZA 1X6HA
chains in the Genus database with same CATH superfamily
2MKDA 2EMIA 2YTDA 5AC5A 5A69A 4KWYA 4BBYA 2WCC3 1X3CA 2MKNA 2H36X 1A1IA 3F6HA 3HPSA 4M2ZA 4LF8E 2VF1A 2WBTA 3L00A 4DV7E 3MHHC 2I9IA 4I8OA 4J8ZA 2EPNA 4GKKE 4DR5E 1RC7A 1HNXE 2EPRA 1ZBQA 2EL4A 2LTSA 4R2DA 2LBSB 4JI2E 3M99B 2EPMX 4LFCE 2DSYA 4F9CB 2DB2A 2RSMA 5IT9C 4M30A 1T39A 2DMIA 4IJDA 2YTOA 4WX9A 1DQ3A 2M9AA 4LF6E 2EMGA 2LUQA 2EMCA 3KWRA 2CSHA 2EOIA 4Q35B 4X66E 1BB8A 1A1FA 5A6AA 2DLQA 2L6MA 4F9BB 1YZ9A 1YSAC 4RHBB 2EOXA 2EPXA 2UXBE 4M0VA 4P78A 1HR0E 2YTJA 1P47A 2LJUA 2RS7A 2GLIA 1YYWA 4R2EA 2EPLX 4WYQB 5IV8B 4DV0E 2EOYA 2EOHA 3EPLA 3HQ1A 2L2KB 4K0KE 3KZZA 1PJQA 4JI3E 2EN7A 2VQFE 2EPKX 4DR6E 2EOOA 1AAYA 2DIXA 2DMYA 2EOZA 4LFAE 1B69A 3OMLA 3LLHA 1FJGE 2IHR1 2V89A 2L3JA 2ADRA 4LF5E 1MEYC 1T4NA 3J81C 2WBSA 2JYAA 2PRTA 4DR2E 4JYAE 2MC6A 5T6JA 4YY3E 2K7IA 4IS1C 2YTNA 2EMZA 2V8QB 5LMUE 2D9HA 2J7JA 2LTRA 2ENCA 1GQEA 2EN4A 3THNA 4DV6E 1X49A 1G2DC 3IWCA 2EMLA 1A1HA 2DRPA 5BR8E 2UUCE 5LL6R 2NABA 1F2IG 2R76A 4B3SE 2JOXA 4F9AB 2EOFA 2JR1A 2RS6A 2LRSA 2A25A 2RSIA 2EM5A 3BBGA 1L4SA 5KL3A 3H09A 2EOQA 4X9JA 5A6BD 1TN9A 1WHQA 2LCEA 2EOJA 3J80C 1N32E 2EM7A 3F6GA 4F2JC 4JI4E 1XMOE 2KOUA 4O5GA 2E1MA 4F6MA 4BCAA 2GPIA 1NEIA 1ZAAC 2M4IA 2N3HA 2GHFA 1PDAA 2HGHA 1ZU1A 2EN1A 2UXCE 2EOMA 3MSWA 4GEQB 4DR7E 2L33A 2ENAA 2EPPA 5IWAE 1LLMC 4KHPE 2YTEA 2DGCA 5CFFE 2LE2A 1RQ0A 3EPKA 1UBDC 2YU5A 2FTXB 4BMJA 2M7QA 1BBGA 4R2AA 3HXLA 4BS9A 1EH6A 2YPNA 5A6JA 2JWOA 1T4LB 2DLKA 2EM0A 2YSOA 2Q8UA 3C4TA 1IBME 1WJPA 4R2RA 4MLVA 2LUPB 3ADLA 1A1GA 1UILA 2HJJA 5AE1A 3C6KA 4WSGA 4X64E 1GTKA 1WHNA 2RTXA 1MGTA 2N3GA 2EQ3A 1X6EA 4F6NA 1TF3A 3EPJA 5ADZA 1UHZA 2EQ1A 2M1SA 5A6KA 4BHBA 5IXMB 1YUIA 4DV1E 4JI1E 3BIDA 4NXNE 1N3GA 1DI2A 3UK3C 1A1LA 4R2CA 5A2QC 2I13A 2UXDE 2LJHA 4WFTA 3THOB 1AH5A 5LLQA 2YTQA 2ZM6E 3JU0A 2EL6A 5AASA 2NUGA 1IBLE 3ADJA 4GZNC 3BF2A 2EPZA 3DF6A 2YTFA 2YU8A 2ELZA 1WXRA 1HNWE 3VK6A 4NXME 3P1XA 2EMBA 4YHHE 4DUYE 3TQMA 4HEIA 2WBUA 1X48A 2R1FA 4HTGA 3EQ1A 4TUGA 1N33E 2JVAA 1X5WA 1I94E 4L8NA 4ZYEA 2EPOA 4O4KA 3BGHA 4LU9A 5TSEA 4JV5E 2EN3A 1N36E 3MHSC 2YTPA 2JP9A 3KZYA 4WSPA 4R2QA 3JTZA 2FV4B 2YZTA 3C4BA 1SFEA 5FLXC 2V85A 4TUIA 1YYKA 1KJKA 2NUFA 2LVHA 5KL4A 2YSPA 2EM4A 2EZ6A 2F4VE 2FGGA 1XNQE 2LO3A 4X8WA 2EE8A 2MC5A 5KL6A 1YUJA 3T1HE 4LF9E 3VYYA 2B3TB 2RQLA 4WPYA 4L5NC 1IMUA 2UUBE 4OOGC 1RMDA 2KONA 2V87A 2EMFA 4DV5E 2V83A 3VHTB 1PJTA 4DV4E 4DR3E 3T1YE 2VRDA 2JY9A 1X6FA 1XMQE 5F3WA 1J26A 2HC5A 1GZ6A 2EP3A 4N4RB 2YTGA 2B9DA 4WXCA 2ELYA 2EOEA 4GKJE 1YYOA 3ADGA 3DJWA 1A1JA 2EMWA 4R8OA 4R2SA 3OTOE 3ADIA 2V86A 4O43A 1IQOA 5KL7A 2NUEA 4M9VC 2YRHA 4BC9A 2B7TA 1EH7A 2UU9E 4DR1E 2EN6A 1G2FC 1JK2A 4BC7A 3VYXA 2EN8A 2RPCA 4ZYGA 3HPZA 2E72A 4R03A 2K4VA 2JPAA 1KYQA 1SR9A 4LTYA 1DGCA 1ZBTA 2YRMA 5LMNE 2EOSA 3IWBA 2E5LE 1X6HA 2CPNA 1T38A 2MDRA 4DV3E 2YRKA 3AV0A 2UUAE 1A1KA 4B3RE 4DKKA 3FIGA 2LT7A 2KHXA 2BBGA 2ODRD 4FK5C 2B7VA 4JI0E 1IBKE 5KL5A 2EM2A 3J7AG 3AUZA 2WZOA 3HTXA 4DMIA 2CT1A 2LV2A 1EKZA 4ZYDA 4DR4E 1UN6B 2EWLA 4X65E 4B3ME 2EM3A 1QU6A 2EJ4A 1YFHA 2YTIA 3QG5C 2EMAA 2L3CA 4R2PA 4O24A 2EMYA 2YWQA 4Q28A 2HHHE 2EPUA 4NHRA 4AQYE 2ODRC 4JI6E 1Z1BA 4X62E 1J5EE 3J7Yp 2F8BA 4JI8E 1ZR9A 3ECRA 1PKPA 2L2MA 1QNTA 4KZSA 4OX9E 2CTDA 2EL5A 4RH8A 1HNZE 3ZOQB 2EPCA 4LFBE 4LF7E 1X47A 2EN2A 2EMKA 2EPAA 5KL2A 4P7DA 4DUZE 1EH8A 1XNRE 2EQ0A 1YPNA 2MDGA 2YT4A 3EPHA 3C6MA 2N8XA 4F54A 2EM9A 1FKAE 1BBOA 2EMHA 2L92A 3RMPA 2BB8A 4ZYHA 2JXPA 1PJSA 2G7HA 3LMLA 5DNYA 4JI7E 2ENHA 3JAMC 1T4OA 1IQSA 2VE7C 1N34E 3IWDA 4LF4E 4BHCA 2EM6A 3K6QA 2L2NA 1WRJA 1TF6A 2NA2A 4B3TE 4MLQA 4DV2E 5AC4A 1STUA 2EMXA 5A6BA 1JK1A 2JOBA 5AE2A 2LMZA 5AE3A 4NZVA 1NCSA 2EM8A 2L8TA 2VQEE 2V88A 2EORA 1O0WA 4JI5E 4WXDA
chains in the Genus database with same CATH topology
2MKDA 2EMIA 2NABA 1F2IG 2YTFA 2YU8A 2YRKA 2YTDA 2ELZA 2WCC3 2EMBA 1A1KA 1X3CA 2EOFA 2LT7A 2MKNA 2WBUA 2A25A 2RSIA 1A1IA 2EM5A 4FK5C 5KL3A 4X9JA 2EOQA 1TN9A 2R1FA 2LCEA 2WBTA 2EOJA 5KL5A 2EM2A 3MHHC 2EM7A 1X5WA 2CT1A 4F2JC 2LV2A 4F6MA 2EPRA 1UN6B 2EL4A 4R2DA 2EM3A 3M99B 2EN3A 2EJ4A 2YTIA 1ZAAC 3MHSC 2EMAA 2YTPA 4R2PA 2JP9A 2DMIA 2GHFA 4IJDA 4R2QA 2EMYA 2YTOA 2HGHA 1ZU1A 2EN1A 2EPUA 2M9AA 2EOMA 1KJKA 2LVHA 5KL4A 2EMGA 2YSPA 2EM4A 2ENAA 2EPPA 1Z1BA 1LLMC 2EMCA 2CSHA 2LO3A 2EOIA 2YTEA 1ZR9A 2EE8A 1BB8A 2DGCA 1A1FA 2DLQA 3EPKA 5KL6A 1YUJA 1UBDC 1YSAC 2CTDA 2YU5A 2EL5A 2EOXA 2EPCA 2EPXA 4R2AA 1RMDA 2EN2A 2EMKA 2YTJA 1P47A 2EMFA 2EPAA 2DLKA 2EM0A 2YSOA 5KL2A 3VHTB 2GLIA 1WJPA 4R2EA 2EQ0A 2MDGA 4R2RA 3EPHA 2VRDA 1A1GA 1X6FA 2EM9A 1BBOA 2EMHA 4WSGA 2EOYA 2EP3A 2EOHA 2BB8A 2YTGA 3EPLA 2ELYA 2ENHA 2EOEA 2EN7A 2EOOA 2EQ3A 1X6EA 4F6NA 1A1JA 1TF3A 3EPJA 1AAYA 2EMWA 2EOZA 4R2SA 1B69A 2EQ1A 5KL7A 4M9VC 2YRHA 2EM6A 1YUIA 2ADRA 1TF6A 2EN6A 1G2FC 1MEYC 1JK2A 2WBSA 2PRTA 2EN8A 2RPCA 2E72A 3UK3C 1A1LA 4R2CA 2JPAA 2EMXA 2I13A 1JK1A 4IS1C 2YTNA 2EMZA 2D9HA 2J7JA 1NCSA 2EM8A 1DGCA 2YTQA 2ENCA 2EN4A 2EL6A 2YRMA 1G2DC 2EOSA 2EORA 2EMLA 4GZNC 1A1HA 2DRPA 2EPZA 1X6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MKD A;  2EMI A;  2NAB A;  1F2I G;  2YTF A;  2YU8 A;  2YRK A;  2YTD A;  2ELZ A;  2WCC 3;  2EMB A;  1A1K A;  1X3C A;  2EOF A;  2LT7 A;  2MKN A;  2WBU A;  2A25 A;  2RSI A;  1A1I A;  2EM5 A;  4FK5 C;  5KL3 A;  4X9J A;  2EOQ A;  1TN9 A;  2R1F A;  2LCE A;  2WBT A;  2EOJ A;  5KL5 A;  2EM2 A;  3MHH C;  2EM7 A;  1X5W A;  2CT1 A;  4F2J C;  2LV2 A;  4F6M A;  2EPR A;  1UN6 B;  2EL4 A;  4R2D A;  2EM3 A;  3M99 B;  2EN3 A;  2EJ4 A;  2YTI A;  1ZAA C;  3MHS C;  2EMA A;  2YTP A;  4R2P A;  2JP9 A;  2DMI A;  2GHF A;  4IJD A;  4R2Q A;  2EMY A;  2YTO A;  2HGH A;  1ZU1 A;  2EN1 A;  2EPU A;  2M9A A;  2EOM A;  1KJK A;  2LVH A;  5KL4 A;  2EMG A;  2YSP A;  2EM4 A;  2ENA A;  2EPP A;  1Z1B A;  1LLM C;  2EMC A;  2CSH A;  2LO3 A;  2EOI A;  2YTE A;  1ZR9 A;  2EE8 A;  1BB8 A;  2DGC A;  1A1F A;  2DLQ A;  3EPK A;  5KL6 A;  1YUJ A;  1UBD C;  1YSA C;  2CTD A;  2YU5 A;  2EL5 A;  2EOX A;  2EPC A;  2EPX A;  4R2A A;  1RMD A;  2EN2 A;  2EMK A;  2YTJ A;  1P47 A;  2EMF A;  2EPA A;  2DLK A;  2EM0 A;  2YSO A;  5KL2 A;  3VHT B;  2GLI A;  1WJP A;  4R2E A;  2EQ0 A;  2MDG A;  4R2R A;  3EPH A;  2VRD A;  1A1G A;  1X6F A;  2EM9 A;  1BBO A;  2EMH A;  4WSG A;  2EOY A;  2EP3 A;  2EOH A;  2BB8 A;  2YTG A;  3EPL A;  2ELY A;  2ENH A;  2EOE A;  2EN7 A;  2EOO A;  2EQ3 A;  1X6E A;  4F6N A;  1A1J A;  1TF3 A;  3EPJ A;  1AAY A;  2EMW A;  2EOZ A;  4R2S A;  1B69 A;  2EQ1 A;  5KL7 A;  4M9V C;  2YRH A;  2EM6 A;  1YUI A;  2ADR A;  1TF6 A;  2EN6 A;  1G2F C;  1MEY C;  1JK2 A;  2WBS A;  2PRT A;  2EN8 A;  2RPC A;  2E72 A;  3UK3 C;  1A1L A;  4R2C A;  2JPA A;  2EMX A;  2I13 A;  1JK1 A;  4IS1 C;  2YTN A;  2EMZ A;  2D9H A;  2J7J A;  1NCS A;  2EM8 A;  1DGC A;  2YTQ A;  2ENC A;  2EN4 A;  2EL6 A;  2YRM A;  1G2D C;  2EOS A;  2EOR A;  2EML A;  4GZN C;  1A1H A;  2DRP A;  2EPZ A;  1X6H A; 
#chains in the Genus database with same CATH topology
 2MKD A;  2EMI A;  2YTD A;  5AC5 A;  5A69 A;  4KWY A;  4BBY A;  2WCC 3;  1X3C A;  2MKN A;  2H36 X;  1A1I A;  3F6H A;  3HPS A;  4M2Z A;  4LF8 E;  2VF1 A;  2WBT A;  3L00 A;  4DV7 E;  3MHH C;  2I9I A;  4I8O A;  4J8Z A;  2EPN A;  4GKK E;  4DR5 E;  1RC7 A;  1HNX E;  2EPR A;  1ZBQ A;  2EL4 A;  2LTS A;  4R2D A;  2LBS B;  4JI2 E;  3M99 B;  2EPM X;  4LFC E;  2DSY A;  4F9C B;  2DB2 A;  2RSM A;  5IT9 C;  4M30 A;  1T39 A;  2DMI A;  4IJD A;  2YTO A;  4WX9 A;  1DQ3 A;  2M9A A;  4LF6 E;  2EMG A;  2LUQ A;  2EMC A;  3KWR A;  2CSH A;  2EOI A;  4Q35 B;  4X66 E;  1BB8 A;  1A1F A;  5A6A A;  2DLQ A;  2L6M A;  4F9B B;  1YZ9 A;  1YSA C;  4RHB B;  2EOX A;  2EPX A;  2UXB E;  4M0V A;  4P78 A;  1HR0 E;  2YTJ A;  1P47 A;  2LJU A;  2RS7 A;  2GLI A;  1YYW A;  4R2E A;  2EPL X;  4WYQ B;  5IV8 B;  4DV0 E;  2EOY A;  2EOH A;  3EPL A;  3HQ1 A;  2L2K B;  4K0K E;  3KZZ A;  1PJQ A;  4JI3 E;  2EN7 A;  2VQF E;  2EPK X;  4DR6 E;  2EOO A;  1AAY A;  2DIX A;  2DMY A;  2EOZ A;  4LFA E;  1B69 A;  3OML A;  3LLH A;  1FJG E;  2IHR 1;  2V89 A;  2L3J A;  2ADR A;  4LF5 E;  1MEY C;  1T4N A;  3J81 C;  2WBS A;  2JYA A;  2PRT A;  4DR2 E;  4JYA E;  2MC6 A;  5T6J A;  4YY3 E;  2K7I A;  4IS1 C;  2YTN A;  2EMZ A;  2V8Q B;  5LMU E;  2D9H A;  2J7J A;  2LTR A;  2ENC A;  1GQE A;  2EN4 A;  3THN A;  4DV6 E;  1X49 A;  1G2D C;  3IWC A;  2EML A;  1A1H A;  2DRP A;  5BR8 E;  2UUC E;  5LL6 R;  2NAB A;  1F2I G;  2R76 A;  4B3S E;  2JOX A;  4F9A B;  2EOF A;  2JR1 A;  2RS6 A;  2LRS A;  2A25 A;  2RSI A;  2EM5 A;  3BBG A;  1L4S A;  5KL3 A;  3H09 A;  2EOQ A;  4X9J A;  5A6B D;  1TN9 A;  1WHQ A;  2LCE A;  2EOJ A;  3J80 C;  1N32 E;  2EM7 A;  3F6G A;  4F2J C;  4JI4 E;  1XMO E;  2KOU A;  4O5G A;  2E1M A;  4F6M A;  4BCA A;  2GPI A;  1NEI A;  1ZAA C;  2M4I A;  2N3H A;  2GHF A;  1PDA A;  2HGH A;  1ZU1 A;  2EN1 A;  2UXC E;  2EOM A;  3MSW A;  4GEQ B;  4DR7 E;  2L33 A;  2ENA A;  2EPP A;  5IWA E;  1LLM C;  4KHP E;  2YTE A;  2DGC A;  5CFF E;  2LE2 A;  1RQ0 A;  3EPK A;  1UBD C;  2YU5 A;  2FTX B;  4BMJ A;  2M7Q A;  1BBG A;  4R2A A;  3HXL A;  4BS9 A;  1EH6 A;  2YPN A;  5A6J A;  2JWO A;  1T4L B;  2DLK A;  2EM0 A;  2YSO A;  2Q8U A;  3C4T A;  1IBM E;  1WJP A;  4R2R A;  4MLV A;  2LUP B;  3ADL A;  1A1G A;  1UIL A;  2HJJ A;  5AE1 A;  3C6K A;  4WSG A;  4X64 E;  1GTK A;  1WHN A;  2RTX A;  1MGT A;  2N3G A;  2EQ3 A;  1X6E A;  4F6N A;  1TF3 A;  3EPJ A;  5ADZ A;  1UHZ A;  2EQ1 A;  2M1S A;  5A6K A;  4BHB A;  5IXM B;  1YUI A;  4DV1 E;  4JI1 E;  3BID A;  4NXN E;  1N3G A;  1DI2 A;  3UK3 C;  1A1L A;  4R2C A;  5A2Q C;  2I13 A;  2UXD E;  2LJH A;  4WFT A;  3THO B;  1AH5 A;  5LLQ A;  2YTQ A;  2ZM6 E;  3JU0 A;  2EL6 A;  5AAS A;  2NUG A;  1IBL E;  3ADJ A;  4GZN C;  3BF2 A;  2EPZ A;  3DF6 A;  2YTF A;  2YU8 A;  2ELZ A;  1WXR A;  1HNW E;  3VK6 A;  4NXM E;  3P1X A;  2EMB A;  4YHH E;  4DUY E;  3TQM A;  4HEI A;  2WBU A;  1X48 A;  2R1F A;  4HTG A;  3EQ1 A;  4TUG A;  1N33 E;  2JVA A;  1X5W A;  1I94 E;  4L8N A;  4ZYE A;  2EPO A;  4O4K A;  3BGH A;  4LU9 A;  5TSE A;  4JV5 E;  2EN3 A;  1N36 E;  3MHS C;  2YTP A;  2JP9 A;  3KZY A;  4WSP A;  4R2Q A;  3JTZ A;  2FV4 B;  2YZT A;  3C4B A;  1SFE A;  5FLX C;  2V85 A;  4TUI A;  1YYK A;  1KJK A;  2NUF A;  2LVH A;  5KL4 A;  2YSP A;  2EM4 A;  2EZ6 A;  2F4V E;  2FGG A;  1XNQ E;  2LO3 A;  4X8W A;  2EE8 A;  2MC5 A;  5KL6 A;  1YUJ A;  3T1H E;  4LF9 E;  3VYY A;  2B3T B;  2RQL A;  4WPY A;  4L5N C;  1IMU A;  2UUB E;  4OOG C;  1RMD A;  2KON A;  2V87 A;  2EMF A;  4DV5 E;  2V83 A;  3VHT B;  1PJT A;  4DV4 E;  4DR3 E;  3T1Y E;  2VRD A;  2JY9 A;  1X6F A;  1XMQ E;  5F3W A;  1J26 A;  2HC5 A;  1GZ6 A;  2EP3 A;  4N4R B;  2YTG A;  2B9D A;  4WXC A;  2ELY A;  2EOE A;  4GKJ E;  1YYO A;  3ADG A;  3DJW A;  1A1J A;  2EMW A;  4R8O A;  4R2S A;  3OTO E;  3ADI A;  2V86 A;  4O43 A;  1IQO A;  5KL7 A;  2NUE A;  4M9V C;  2YRH A;  4BC9 A;  2B7T A;  1EH7 A;  2UU9 E;  4DR1 E;  2EN6 A;  1G2F C;  1JK2 A;  4BC7 A;  3VYX A;  2EN8 A;  2RPC A;  4ZYG A;  3HPZ A;  2E72 A;  4R03 A;  2K4V A;  2JPA A;  1KYQ A;  1SR9 A;  4LTY A;  1DGC A;  1ZBT A;  2YRM A;  5LMN E;  2EOS A;  3IWB A;  2E5L E;  1X6H A;  2CPN A;  1T38 A;  2MDR A;  4DV3 E;  2YRK A;  3AV0 A;  2UUA E;  1A1K A;  4B3R E;  4DKK A;  3FIG A;  2LT7 A;  2KHX A;  2BBG A;  2ODR D;  4FK5 C;  2B7V A;  4JI0 E;  1IBK E;  5KL5 A;  2EM2 A;  3J7A G;  3AUZ A;  2WZO A;  3HTX A;  4DMI A;  2CT1 A;  2LV2 A;  1EKZ A;  4ZYD A;  4DR4 E;  1UN6 B;  2EWL A;  4X65 E;  4B3M E;  2EM3 A;  1QU6 A;  2EJ4 A;  1YFH A;  2YTI A;  3QG5 C;  2EMA A;  2L3C A;  4R2P A;  4O24 A;  2EMY A;  2YWQ A;  4Q28 A;  2HHH E;  2EPU A;  4NHR A;  4AQY E;  2ODR C;  4JI6 E;  1Z1B A;  4X62 E;  1J5E E;  3J7Y p;  2F8B A;  4JI8 E;  1ZR9 A;  3ECR A;  1PKP A;  2L2M A;  1QNT A;  4KZS A;  4OX9 E;  2CTD A;  2EL5 A;  4RH8 A;  1HNZ E;  3ZOQ B;  2EPC A;  4LFB E;  4LF7 E;  1X47 A;  2EN2 A;  2EMK A;  2EPA A;  5KL2 A;  4P7D A;  4DUZ E;  1EH8 A;  1XNR E;  2EQ0 A;  1YPN A;  2MDG A;  2YT4 A;  3EPH A;  3C6M A;  2N8X A;  4F54 A;  2EM9 A;  1FKA E;  1BBO A;  2EMH A;  2L92 A;  3RMP A;  2BB8 A;  4ZYH A;  2JXP A;  1PJS A;  2G7H A;  3LML A;  5DNY A;  4JI7 E;  2ENH A;  3JAM C;  1T4O A;  1IQS A;  2VE7 C;  1N34 E;  3IWD A;  4LF4 E;  4BHC A;  2EM6 A;  3K6Q A;  2L2N A;  1WRJ A;  1TF6 A;  2NA2 A;  4B3T E;  4MLQ A;  4DV2 E;  5AC4 A;  1STU A;  2EMX A;  5A6B A;  1JK1 A;  2JOB A;  5AE2 A;  2LMZ A;  5AE3 A;  4NZV A;  1NCS A;  2EM8 A;  2L8T A;  2VQE E;  2V88 A;  2EOR A;  1O0W A;  4JI5 E;  4WXD A; 
#chains in the Genus database with same CATH homology
 2MKD A;  2EMI A;  2NAB A;  1F2I G;  2YTF A;  2YU8 A;  2YRK A;  2YTD A;  2ELZ A;  2WCC 3;  2EMB A;  1A1K A;  1X3C A;  2EOF A;  2LT7 A;  2MKN A;  2WBU A;  2A25 A;  2RSI A;  1A1I A;  2EM5 A;  4FK5 C;  5KL3 A;  4X9J A;  2EOQ A;  1TN9 A;  2R1F A;  2LCE A;  2WBT A;  2EOJ A;  5KL5 A;  2EM2 A;  3MHH C;  2EM7 A;  1X5W A;  2CT1 A;  4F2J C;  2LV2 A;  4F6M A;  2EPR A;  1UN6 B;  2EL4 A;  4R2D A;  2EM3 A;  3M99 B;  2EN3 A;  2EJ4 A;  2YTI A;  1ZAA C;  3MHS C;  2EMA A;  2YTP A;  4R2P A;  2JP9 A;  2DMI A;  2GHF A;  4IJD A;  4R2Q A;  2EMY A;  2YTO A;  2HGH A;  1ZU1 A;  2EN1 A;  2EPU A;  2M9A A;  2EOM A;  1KJK A;  2LVH A;  5KL4 A;  2EMG A;  2YSP A;  2EM4 A;  2ENA A;  2EPP A;  1Z1B A;  1LLM C;  2EMC A;  2CSH A;  2LO3 A;  2EOI A;  2YTE A;  1ZR9 A;  2EE8 A;  1BB8 A;  2DGC A;  1A1F A;  2DLQ A;  3EPK A;  5KL6 A;  1YUJ A;  1UBD C;  1YSA C;  2CTD A;  2YU5 A;  2EL5 A;  2EOX A;  2EPC A;  2EPX A;  4R2A A;  1RMD A;  2EN2 A;  2EMK A;  2YTJ A;  1P47 A;  2EMF A;  2EPA A;  2DLK A;  2EM0 A;  2YSO A;  5KL2 A;  3VHT B;  2GLI A;  1WJP A;  4R2E A;  2EQ0 A;  2MDG A;  4R2R A;  3EPH A;  2VRD A;  1A1G A;  1X6F A;  2EM9 A;  1BBO A;  2EMH A;  4WSG A;  2EOY A;  2EP3 A;  2EOH A;  2BB8 A;  2YTG A;  3EPL A;  2ELY A;  2ENH A;  2EOE A;  2EN7 A;  2EOO A;  2EQ3 A;  1X6E A;  4F6N A;  1A1J A;  1TF3 A;  3EPJ A;  1AAY A;  2EMW A;  2EOZ A;  4R2S A;  1B69 A;  2EQ1 A;  5KL7 A;  4M9V C;  2YRH A;  2EM6 A;  1YUI A;  2ADR A;  1TF6 A;  2EN6 A;  1G2F C;  1MEY C;  1JK2 A;  2WBS A;  2PRT A;  2EN8 A;  2RPC A;  2E72 A;  3UK3 C;  1A1L A;  4R2C A;  2JPA A;  2EMX A;  2I13 A;  1JK1 A;  4IS1 C;  2YTN A;  2EMZ A;  2D9H A;  2J7J A;  1NCS A;  2EM8 A;  1DGC A;  2YTQ A;  2ENC A;  2EN4 A;  2EL6 A;  2YRM A;  1G2D C;  2EOS A;  2EOR A;  2EML A;  4GZN C;  1A1H A;  2DRP A;  2EPZ A;  1X6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...