5KL7A

Wilms tumor protein (wt1) znf2-4q369r in complex with carboxylated dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
87
structure length
87
Chain Sequence
EKPYQCDFKDCERRFSRSDRLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Denys-Drash syndrome associated WT1 glutamine 369 mutants have altered sequence-preferences and altered responses to epigenetic modifications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords Wilms tumor protein
total genus 29
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2016-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 5kl7A00
3EPJA 2A25A 4GZNC 2YTNA 2YTQA 5KL7A 5KL2A 2DGCA 2EN8A 2RSIA 1X3CA 2EM5A 2EQ0A 2EM0A 2EM2A 2YTGA 1JK2A 1Z1BA 1UBDC 4FK5C 2YSOA 2WBTA 2YTPA 3M99B 2LCEA 2MKNA 1G2DC 4M9VC 1ZU1A 2EOMA 2YRMA 1ZAAC 2I13A 4R2AA 2ELYA 2EOHA 1A1LA 1TF6A 1BBOA 1B69A 1A1JA 3EPHA 2HGHA 2EMWA 2EM9A 2EN3A 4F2JC 1P47A 2GHFA 2EN7A 2EN4A 1KJKA 2EM4A 2WBUA 2EPRA 1A1KA 2DLKA 2EPUA 2DMIA 2EOYA 4R2QA 4R2PA 2VRDA 1A1FA 2LO3A 2ADRA 5KL5A 1AAYA 2R1FA 2NABA 2PRTA 2WBSA 1DGCA 2EMXA 2EPZA 2YSPA 1A1HA 2YTIA 2YTOA 4X9JA 2EM7A 2MKDA 2WCC3 4F6MA 2EPCA 1LLMC 1A1GA 2EOZA 1YUIA 5KL3A 1MEYC 2YU5A 2EOIA 2EN1A 5KL4A 2EMFA 2EN2A 2YTDA 2ELZA 2E72A 2CTDA 4IJDA 2EMCA 2EL5A 4R2EA 1YSAC 1X6FA 2LT7A 4IS1C 4R2CA 2EOSA 2EQ1A 2YTJA 2JP9A 2YU8A 2EORA 2J7JA 5KL6A 1WJPA 2YTEA 2EOOA 2EMYA 2DRPA 2D9HA 2EE8A 4R2DA 1X6HA 2EOEA 2LVHA 4R2RA 2EMHA 1TF3A 4F6NA 3MHSC 1YUJA 2CSHA 2EP3A 2EMKA 1ZR9A 2EOFA 2CT1A 2MDGA 2YRKA 2YTFA 3MHHC 3UK3C 2JPAA 2EL4A 1A1IA 4WSGA 1TN9A 2EMLA 1F2IG 2EQ3A 2EOJA 3EPKA 2EPAA 3EPLA 2EM3A 2ENAA 2EMAA 2EL6A 2EMBA 1RMDA 2EN6A 2LV2A 2RPCA 2YRHA 1X6EA 2EM6A 2EOQA 1UN6B 2EMZA 3VHTB 2ENCA 2DLQA 2EMIA 2GLIA 2EMGA 2EJ4A 1G2FC 1BB8A 1NCSA 2EM8A 2EPXA 1X5WA 2EOXA 2EPPA 4R2SA 2M9AA 2BB8A 2ENHA 1JK1A
chains in the Genus database with same CATH superfamily
3EPJA 3THNA 1HR0E 3F6HA 4NXNE 2YTQA 5KL7A 5IT9C 4X8WA 1PJSA 2EPLX 4B3ME 4DR7E 3JU0A 2JVAA 4P7DA 2WBTA 4DV7E 4B3SE 4Q35B 4BC9A 4I8OA 2ELYA 2EOHA 4JI7E 1YYOA 2HGHA 2EM9A 2JXPA 4BMJA 5DNYA 3C4BA 1P47A 4O5GA 2V88A 1A1KA 1EH6A 3K6QA 4M0VA 4R03A 4DR2E 2L2NA 1DGCA 2L6MA 5LLQA 3H09A 4LF5E 1RQ0A 1LLMC 1SFEA 2DSYA 1MEYC 3MSWA 2YU5A 3VYYA 4DR3E 5KL4A 4LF4E 1BBGA 3IWDA 3KWRA 1XNRE 2EMFA 2EN2A 3IWCA 4DR6E 2ELZA 1N36E 3T1HE 4KZSA 4DUYE 2EL5A 4R2EA 1PKPA 2MC5A 2EOSA 2Q8UA 5A6JA 4WSPA 2V85A 1XMQE 4DR1E 2YTEA 2UU9E 2D9HA 4R2DA 4ZYEA 2EOEA 4F6NA 1IMUA 4WYQB 2CSHA 2EMKA 4O24A 3P1XA 2EOFA 2CT1A 4RH8A 1HNXE 3MHHC 2JPAA 5A69A 2FV4B 2EL4A 4BC7A 3ADJA 1ZBTA 3EPKA 2ODRC 2EPAA 4BBYA 1J5EE 4NXME 2EL6A 2LV2A 3VHTB 2RSMA 2DLQA 2EMIA 2GLIA 2DB2A 2RTXA 4NHRA 4LFCE 1STUA 4M2ZA 1EH7A 4R2SA 4JI3E 2EZ6A 1JK1A 3ZOQB 3AUZA 2A25A 2M7QA 2F4VE 2UXDE 1T38A 4LFAE 2LE2A 1X3CA 2EM5A 2EQ0A 2EM0A 1JK2A 1Z1BA 1ZBQA 2UUBE 4FK5C 3KZYA 2YSOA 3M99B 3JAMC 2LTRA 2EOMA 2HJJA 2YRMA 1T4LB 2JY9A 4O43A 4R2AA 2V86A 1A1LA 1TF6A 1BBOA 2L3CA 4BHCA 2EN7A 2EM4A 5AC4A 4GKKE 1A1FA 2DLKA 2DMIA 2EOYA 2ADRA 5KL5A 2LUPB 2VF1A 2R1FA 2PRTA 3AV0A 2YPNA 2EMXA 2EPZA 2EPNA 2YTOA 2UUAE 2WCC3 2EOZA 4DR5E 1N34E 3BBGA 2B7VA 1MGTA 5KL3A 2B3TB 2EWLA 1GZ6A 2EOIA 4KHPE 2EN1A 4AQYE 2L2KB 2LRSA 2JR1A 4IJDA 5IXMB 3BIDA 1YSAC 1X6FA 3J81C 2L3JA 4IS1C 4R2CA 1L4SA 2YTJA 3L00A 1QU6A 2NUEA 3VYXA 3C6MA 2KHXA 2M4IA 1WJPA 4KWYA 2EOOA 2K7IA 4ZYDA 5A6AA 2EMHA 2MDRA 4MLQA 2NUFA 4GKJE 2EP3A 2VQFE 1DQ3A 1ZR9A 2LTSA 1HNWE 3UK3C 1YYWA 3RMPA 1IBKE 1TN9A 4JYAE 1F2IG 4GEQB 3EPLA 2KONA 1NEIA 1KYQA 2EMBA 1T39A 3C4TA 3BF2A 2H36X 3HXLA 3THOB 2EN6A 2RPCA 2EM6A 2EOQA 2LJHA 4OX9E 2EJ4A 2NA2A 5AE1A 2L8TA 4X64E 3F6GA 2EPXA 4JI2E 5CFFE 4WX9A 4HTGA 2ENHA 4ZYGA 2V8QB 3T1YE 2VE7C 3ADIA 5A6KA 4GZNC 2UXCE 2BBGA 2YTNA 1QNTA 5A6BD 2EN8A 4TUIA 2RSIA 2RQLA 2JOBA 1YYKA 2DIXA 2YTGA 1X49A 1UBDC 2JWOA 4DV4E 1IQOA 2YTPA 4M30A 4YY3E 2MKNA 2LJUA 4BS9A 3EQ1A 2M1SA 3OMLA 1SR9A 4LF9E 1B69A 3EPHA 2E5LE 2EN3A 4F2JC 2EPRA 2EPUA 2VRDA 1J26A 2LO3A 1FKAE 3DF6A 2NABA 3HPZA 4O4KA 1A1HA 3HTXA 3QG5C 4X9JA 2MKDA 1A1GA 2EPCA 2L33A 3VK6A 1IBLE 2B9DA 3C6KA 5IWAE 1RC7A 2KOUA 3ADGA 2WZOA 1UILA 4RHBB 2DMYA 4L5NC 2YTDA 2VQEE 1I94E 4B3RE 2E72A 2G7HA 2EMCA 2HC5A 5LMNE 1N33E 1DI2A 2FTXB 2EQ1A 4JI8E 4Q28A 2JP9A 2N8XA 1O0WA 2JYAA 1IQSA 1IBME 2MC6A 4YHHE 2ZM6E 2DRPA 4NZVA 4R2RA 2FGGA 1T4NA 1N32E 2V87A 5ADZA 1PJQA 4L8NA 4LU9A 2MDGA 2V89A 2YRKA 2YWQA 1WHQA 2YTFA 1XMOE 1PJTA 3J7AG 1A1IA 2V83A 2EOJA 4F54A 2ENAA 4DV0E 4WFTA 5AE3A 1X6EA 2EMZA 4LF6E 2YZTA 4OOGC 3ADLA 1BB8A 1EH8A 4LF8E 2EM8A 1X5WA 2EOXA 2RS6A 4P78A 2N3HA 5LL6R 2EPPA 4LTYA 5AASA 5F3WA 2BB8A 2ODRD 4N4RB 3J7Yp 2LMZA 2L92A 3LMLA 5KL2A 4DUZE 2DGCA 2K4VA 3JTZA 3FIGA 5A6BA 4JI4E 3OTOE 2E1MA 2EM2A 4X66E 1GQEA 2LCEA 1G2DC 4M9VC 4LFBE 1YPNA 1ZU1A 1ZAAC 1HNZE 2I13A 5IV8B 4BCAA 1A1JA 3HPSA 4JI6E 2EMWA 3BGHA 4LF7E 1N3GA 2UXBE 2CPNA 5FLXC 2GHFA 2EN4A 1KJKA 3ECRA 3TQMA 2WBUA 4R2QA 5A2QC 4R2PA 3DJWA 1X47A 1AAYA 2I9IA 4DV5E 1PDAA 1UHZA 2WBSA 2YSPA 5TSEA 4DR4E 2YTIA 1FJGE 2L2MA 2EM7A 4F6MA 1YFHA 1YUIA 4DMIA 4JV5E 2B7TA 1YZ9A 4DV6E 4K0KE 4JI1E 4WXCA 2CTDA 4BHBA 1EKZA 5AC5A 1XNQE 2LT7A 1WRJA 5AE2A 1WXRA 2EPKX 2HHHE 4X62E 4ZYHA 1X48A 2YU8A 4MLVA 2EORA 2J7JA 4F9BB 5KL6A 2LUQA 2EMYA 4X65E 2EE8A 1X6HA 2LVHA 3HQ1A 1TF3A 3MHSC 4F9CB 4TUGA 1YUJA 3KZZA 2NUGA 2GPIA 2RS7A 4DV2E 4R8OA 2EPMX 1T4OA 4DV3E 5T6JA 4JI5E 4WXDA 4WSGA 2EMLA 2EQ3A 2EPOA 2EM3A 1AH5A 2EMAA 2F8BA 2UUCE 3IWBA 2YT4A 4J8ZA 3LLHA 1RMDA 3J80C 4JI0E 5BR8E 2YRHA 1UN6B 2ENCA 1GTKA 2EMGA 1G2FC 1NCSA 2R76A 4F9AB 4DKKA 4B3TE 2LBSB 5LMUE 2IHR1 4WPYA 2N3GA 1WHNA 2JOXA 2M9AA 4HEIA 4DV1E
chains in the Genus database with same CATH topology
3EPJA 2A25A 4GZNC 2YTNA 2YTQA 5KL7A 5KL2A 2DGCA 2EN8A 2RSIA 1X3CA 2EM5A 2EQ0A 2EM0A 2EM2A 2YTGA 1JK2A 1Z1BA 1UBDC 4FK5C 2YSOA 2WBTA 2YTPA 3M99B 2LCEA 2MKNA 1G2DC 4M9VC 1ZU1A 2EOMA 2YRMA 1ZAAC 2I13A 4R2AA 2ELYA 2EOHA 1A1LA 1TF6A 1BBOA 1B69A 1A1JA 3EPHA 2HGHA 2EMWA 2EM9A 2EN3A 4F2JC 1P47A 2GHFA 2EN7A 2EN4A 1KJKA 2EM4A 2WBUA 2EPRA 1A1KA 2DLKA 2EPUA 2DMIA 2EOYA 4R2QA 4R2PA 2VRDA 1A1FA 2LO3A 2ADRA 5KL5A 1AAYA 2R1FA 2NABA 2PRTA 2WBSA 1DGCA 2EMXA 2EPZA 2YSPA 1A1HA 2YTIA 2YTOA 4X9JA 2EM7A 2MKDA 2WCC3 4F6MA 2EPCA 1LLMC 1A1GA 2EOZA 1YUIA 5KL3A 1MEYC 2YU5A 2EOIA 2EN1A 5KL4A 2EMFA 2EN2A 2YTDA 2ELZA 2E72A 2CTDA 4IJDA 2EMCA 2EL5A 4R2EA 1YSAC 1X6FA 2LT7A 4IS1C 4R2CA 2EOSA 2EQ1A 2YTJA 2JP9A 2YU8A 2EORA 2J7JA 5KL6A 1WJPA 2YTEA 2EOOA 2EMYA 2DRPA 2D9HA 2EE8A 4R2DA 1X6HA 2EOEA 2LVHA 4R2RA 2EMHA 1TF3A 4F6NA 3MHSC 1YUJA 2CSHA 2EP3A 2EMKA 1ZR9A 2EOFA 2CT1A 2MDGA 2YRKA 2YTFA 3MHHC 3UK3C 2JPAA 2EL4A 1A1IA 4WSGA 1TN9A 2EMLA 1F2IG 2EQ3A 2EOJA 3EPKA 2EPAA 3EPLA 2EM3A 2ENAA 2EMAA 2EL6A 2EMBA 1RMDA 2EN6A 2LV2A 2RPCA 2YRHA 1X6EA 2EM6A 2EOQA 1UN6B 2EMZA 3VHTB 2ENCA 2DLQA 2EMIA 2GLIA 2EMGA 2EJ4A 1G2FC 1BB8A 1NCSA 2EM8A 2EPXA 1X5WA 2EOXA 2EPPA 4R2SA 2M9AA 2BB8A 2ENHA 1JK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EPJ A;  2A25 A;  4GZN C;  2YTN A;  2YTQ A;  5KL7 A;  5KL2 A;  2DGC A;  2EN8 A;  2RSI A;  1X3C A;  2EM5 A;  2EQ0 A;  2EM0 A;  2EM2 A;  2YTG A;  1JK2 A;  1Z1B A;  1UBD C;  4FK5 C;  2YSO A;  2WBT A;  2YTP A;  3M99 B;  2LCE A;  2MKN A;  1G2D C;  4M9V C;  1ZU1 A;  2EOM A;  2YRM A;  1ZAA C;  2I13 A;  4R2A A;  2ELY A;  2EOH A;  1A1L A;  1TF6 A;  1BBO A;  1B69 A;  1A1J A;  3EPH A;  2HGH A;  2EMW A;  2EM9 A;  2EN3 A;  4F2J C;  1P47 A;  2GHF A;  2EN7 A;  2EN4 A;  1KJK A;  2EM4 A;  2WBU A;  2EPR A;  1A1K A;  2DLK A;  2EPU A;  2DMI A;  2EOY A;  4R2Q A;  4R2P A;  2VRD A;  1A1F A;  2LO3 A;  2ADR A;  5KL5 A;  1AAY A;  2R1F A;  2NAB A;  2PRT A;  2WBS A;  1DGC A;  2EMX A;  2EPZ A;  2YSP A;  1A1H A;  2YTI A;  2YTO A;  4X9J A;  2EM7 A;  2MKD A;  2WCC 3;  4F6M A;  2EPC A;  1LLM C;  1A1G A;  2EOZ A;  1YUI A;  5KL3 A;  1MEY C;  2YU5 A;  2EOI A;  2EN1 A;  5KL4 A;  2EMF A;  2EN2 A;  2YTD A;  2ELZ A;  2E72 A;  2CTD A;  4IJD A;  2EMC A;  2EL5 A;  4R2E A;  1YSA C;  1X6F A;  2LT7 A;  4IS1 C;  4R2C A;  2EOS A;  2EQ1 A;  2YTJ A;  2JP9 A;  2YU8 A;  2EOR A;  2J7J A;  5KL6 A;  1WJP A;  2YTE A;  2EOO A;  2EMY A;  2DRP A;  2D9H A;  2EE8 A;  4R2D A;  1X6H A;  2EOE A;  2LVH A;  4R2R A;  2EMH A;  1TF3 A;  4F6N A;  3MHS C;  1YUJ A;  2CSH A;  2EP3 A;  2EMK A;  1ZR9 A;  2EOF A;  2CT1 A;  2MDG A;  2YRK A;  2YTF A;  3MHH C;  3UK3 C;  2JPA A;  2EL4 A;  1A1I A;  4WSG A;  1TN9 A;  2EML A;  1F2I G;  2EQ3 A;  2EOJ A;  3EPK A;  2EPA A;  3EPL A;  2EM3 A;  2ENA A;  2EMA A;  2EL6 A;  2EMB A;  1RMD A;  2EN6 A;  2LV2 A;  2RPC A;  2YRH A;  1X6E A;  2EM6 A;  2EOQ A;  1UN6 B;  2EMZ A;  3VHT B;  2ENC A;  2DLQ A;  2EMI A;  2GLI A;  2EMG A;  2EJ4 A;  1G2F C;  1BB8 A;  1NCS A;  2EM8 A;  2EPX A;  1X5W A;  2EOX A;  2EPP A;  4R2S A;  2M9A A;  2BB8 A;  2ENH A;  1JK1 A; 
#chains in the Genus database with same CATH topology
 3EPJ A;  3THN A;  1HR0 E;  3F6H A;  4NXN E;  2YTQ A;  5KL7 A;  5IT9 C;  4X8W A;  1PJS A;  2EPL X;  4B3M E;  4DR7 E;  3JU0 A;  2JVA A;  4P7D A;  2WBT A;  4DV7 E;  4B3S E;  4Q35 B;  4BC9 A;  4I8O A;  2ELY A;  2EOH A;  4JI7 E;  1YYO A;  2HGH A;  2EM9 A;  2JXP A;  4BMJ A;  5DNY A;  3C4B A;  1P47 A;  4O5G A;  2V88 A;  1A1K A;  1EH6 A;  3K6Q A;  4M0V A;  4R03 A;  4DR2 E;  2L2N A;  1DGC A;  2L6M A;  5LLQ A;  3H09 A;  4LF5 E;  1RQ0 A;  1LLM C;  1SFE A;  2DSY A;  1MEY C;  3MSW A;  2YU5 A;  3VYY A;  4DR3 E;  5KL4 A;  4LF4 E;  1BBG A;  3IWD A;  3KWR A;  1XNR E;  2EMF A;  2EN2 A;  3IWC A;  4DR6 E;  2ELZ A;  1N36 E;  3T1H E;  4KZS A;  4DUY E;  2EL5 A;  4R2E A;  1PKP A;  2MC5 A;  2EOS A;  2Q8U A;  5A6J A;  4WSP A;  2V85 A;  1XMQ E;  4DR1 E;  2YTE A;  2UU9 E;  2D9H A;  4R2D A;  4ZYE A;  2EOE A;  4F6N A;  1IMU A;  4WYQ B;  2CSH A;  2EMK A;  4O24 A;  3P1X A;  2EOF A;  2CT1 A;  4RH8 A;  1HNX E;  3MHH C;  2JPA A;  5A69 A;  2FV4 B;  2EL4 A;  4BC7 A;  3ADJ A;  1ZBT A;  3EPK A;  2ODR C;  2EPA A;  4BBY A;  1J5E E;  4NXM E;  2EL6 A;  2LV2 A;  3VHT B;  2RSM A;  2DLQ A;  2EMI A;  2GLI A;  2DB2 A;  2RTX A;  4NHR A;  4LFC E;  1STU A;  4M2Z A;  1EH7 A;  4R2S A;  4JI3 E;  2EZ6 A;  1JK1 A;  3ZOQ B;  3AUZ A;  2A25 A;  2M7Q A;  2F4V E;  2UXD E;  1T38 A;  4LFA E;  2LE2 A;  1X3C A;  2EM5 A;  2EQ0 A;  2EM0 A;  1JK2 A;  1Z1B A;  1ZBQ A;  2UUB E;  4FK5 C;  3KZY A;  2YSO A;  3M99 B;  3JAM C;  2LTR A;  2EOM A;  2HJJ A;  2YRM A;  1T4L B;  2JY9 A;  4O43 A;  4R2A A;  2V86 A;  1A1L A;  1TF6 A;  1BBO A;  2L3C A;  4BHC A;  2EN7 A;  2EM4 A;  5AC4 A;  4GKK E;  1A1F A;  2DLK A;  2DMI A;  2EOY A;  2ADR A;  5KL5 A;  2LUP B;  2VF1 A;  2R1F A;  2PRT A;  3AV0 A;  2YPN A;  2EMX A;  2EPZ A;  2EPN A;  2YTO A;  2UUA E;  2WCC 3;  2EOZ A;  4DR5 E;  1N34 E;  3BBG A;  2B7V A;  1MGT A;  5KL3 A;  2B3T B;  2EWL A;  1GZ6 A;  2EOI A;  4KHP E;  2EN1 A;  4AQY E;  2L2K B;  2LRS A;  2JR1 A;  4IJD A;  5IXM B;  3BID A;  1YSA C;  1X6F A;  3J81 C;  2L3J A;  4IS1 C;  4R2C A;  1L4S A;  2YTJ A;  3L00 A;  1QU6 A;  2NUE A;  3VYX A;  3C6M A;  2KHX A;  2M4I A;  1WJP A;  4KWY A;  2EOO A;  2K7I A;  4ZYD A;  5A6A A;  2EMH A;  2MDR A;  4MLQ A;  2NUF A;  4GKJ E;  2EP3 A;  2VQF E;  1DQ3 A;  1ZR9 A;  2LTS A;  1HNW E;  3UK3 C;  1YYW A;  3RMP A;  1IBK E;  1TN9 A;  4JYA E;  1F2I G;  4GEQ B;  3EPL A;  2KON A;  1NEI A;  1KYQ A;  2EMB A;  1T39 A;  3C4T A;  3BF2 A;  2H36 X;  3HXL A;  3THO B;  2EN6 A;  2RPC A;  2EM6 A;  2EOQ A;  2LJH A;  4OX9 E;  2EJ4 A;  2NA2 A;  5AE1 A;  2L8T A;  4X64 E;  3F6G A;  2EPX A;  4JI2 E;  5CFF E;  4WX9 A;  4HTG A;  2ENH A;  4ZYG A;  2V8Q B;  3T1Y E;  2VE7 C;  3ADI A;  5A6K A;  4GZN C;  2UXC E;  2BBG A;  2YTN A;  1QNT A;  5A6B D;  2EN8 A;  4TUI A;  2RSI A;  2RQL A;  2JOB A;  1YYK A;  2DIX A;  2YTG A;  1X49 A;  1UBD C;  2JWO A;  4DV4 E;  1IQO A;  2YTP A;  4M30 A;  4YY3 E;  2MKN A;  2LJU A;  4BS9 A;  3EQ1 A;  2M1S A;  3OML A;  1SR9 A;  4LF9 E;  1B69 A;  3EPH A;  2E5L E;  2EN3 A;  4F2J C;  2EPR A;  2EPU A;  2VRD A;  1J26 A;  2LO3 A;  1FKA E;  3DF6 A;  2NAB A;  3HPZ A;  4O4K A;  1A1H A;  3HTX A;  3QG5 C;  4X9J A;  2MKD A;  1A1G A;  2EPC A;  2L33 A;  3VK6 A;  1IBL E;  2B9D A;  3C6K A;  5IWA E;  1RC7 A;  2KOU A;  3ADG A;  2WZO A;  1UIL A;  4RHB B;  2DMY A;  4L5N C;  2YTD A;  2VQE E;  1I94 E;  4B3R E;  2E72 A;  2G7H A;  2EMC A;  2HC5 A;  5LMN E;  1N33 E;  1DI2 A;  2FTX B;  2EQ1 A;  4JI8 E;  4Q28 A;  2JP9 A;  2N8X A;  1O0W A;  2JYA A;  1IQS A;  1IBM E;  2MC6 A;  4YHH E;  2ZM6 E;  2DRP A;  4NZV A;  4R2R A;  2FGG A;  1T4N A;  1N32 E;  2V87 A;  5ADZ A;  1PJQ A;  4L8N A;  4LU9 A;  2MDG A;  2V89 A;  2YRK A;  2YWQ A;  1WHQ A;  2YTF A;  1XMO E;  1PJT A;  3J7A G;  1A1I A;  2V83 A;  2EOJ A;  4F54 A;  2ENA A;  4DV0 E;  4WFT A;  5AE3 A;  1X6E A;  2EMZ A;  4LF6 E;  2YZT A;  4OOG C;  3ADL A;  1BB8 A;  1EH8 A;  4LF8 E;  2EM8 A;  1X5W A;  2EOX A;  2RS6 A;  4P78 A;  2N3H A;  5LL6 R;  2EPP A;  4LTY A;  5AAS A;  5F3W A;  2BB8 A;  2ODR D;  4N4R B;  3J7Y p;  2LMZ A;  2L92 A;  3LML A;  5KL2 A;  4DUZ E;  2DGC A;  2K4V A;  3JTZ A;  3FIG A;  5A6B A;  4JI4 E;  3OTO E;  2E1M A;  2EM2 A;  4X66 E;  1GQE A;  2LCE A;  1G2D C;  4M9V C;  4LFB E;  1YPN A;  1ZU1 A;  1ZAA C;  1HNZ E;  2I13 A;  5IV8 B;  4BCA A;  1A1J A;  3HPS A;  4JI6 E;  2EMW A;  3BGH A;  4LF7 E;  1N3G A;  2UXB E;  2CPN A;  5FLX C;  2GHF A;  2EN4 A;  1KJK A;  3ECR A;  3TQM A;  2WBU A;  4R2Q A;  5A2Q C;  4R2P A;  3DJW A;  1X47 A;  1AAY A;  2I9I A;  4DV5 E;  1PDA A;  1UHZ A;  2WBS A;  2YSP A;  5TSE A;  4DR4 E;  2YTI A;  1FJG E;  2L2M A;  2EM7 A;  4F6M A;  1YFH A;  1YUI A;  4DMI A;  4JV5 E;  2B7T A;  1YZ9 A;  4DV6 E;  4K0K E;  4JI1 E;  4WXC A;  2CTD A;  4BHB A;  1EKZ A;  5AC5 A;  1XNQ E;  2LT7 A;  1WRJ A;  5AE2 A;  1WXR A;  2EPK X;  2HHH E;  4X62 E;  4ZYH A;  1X48 A;  2YU8 A;  4MLV A;  2EOR A;  2J7J A;  4F9B B;  5KL6 A;  2LUQ A;  2EMY A;  4X65 E;  2EE8 A;  1X6H A;  2LVH A;  3HQ1 A;  1TF3 A;  3MHS C;  4F9C B;  4TUG A;  1YUJ A;  3KZZ A;  2NUG A;  2GPI A;  2RS7 A;  4DV2 E;  4R8O A;  2EPM X;  1T4O A;  4DV3 E;  5T6J A;  4JI5 E;  4WXD A;  4WSG A;  2EML A;  2EQ3 A;  2EPO A;  2EM3 A;  1AH5 A;  2EMA A;  2F8B A;  2UUC E;  3IWB A;  2YT4 A;  4J8Z A;  3LLH A;  1RMD A;  3J80 C;  4JI0 E;  5BR8 E;  2YRH A;  1UN6 B;  2ENC A;  1GTK A;  2EMG A;  1G2F C;  1NCS A;  2R76 A;  4F9A B;  4DKK A;  4B3T E;  2LBS B;  5LMU E;  2IHR 1;  4WPY A;  2N3G A;  1WHN A;  2JOX A;  2M9A A;  4HEI A;  4DV1 E; 
#chains in the Genus database with same CATH homology
 3EPJ A;  2A25 A;  4GZN C;  2YTN A;  2YTQ A;  5KL7 A;  5KL2 A;  2DGC A;  2EN8 A;  2RSI A;  1X3C A;  2EM5 A;  2EQ0 A;  2EM0 A;  2EM2 A;  2YTG A;  1JK2 A;  1Z1B A;  1UBD C;  4FK5 C;  2YSO A;  2WBT A;  2YTP A;  3M99 B;  2LCE A;  2MKN A;  1G2D C;  4M9V C;  1ZU1 A;  2EOM A;  2YRM A;  1ZAA C;  2I13 A;  4R2A A;  2ELY A;  2EOH A;  1A1L A;  1TF6 A;  1BBO A;  1B69 A;  1A1J A;  3EPH A;  2HGH A;  2EMW A;  2EM9 A;  2EN3 A;  4F2J C;  1P47 A;  2GHF A;  2EN7 A;  2EN4 A;  1KJK A;  2EM4 A;  2WBU A;  2EPR A;  1A1K A;  2DLK A;  2EPU A;  2DMI A;  2EOY A;  4R2Q A;  4R2P A;  2VRD A;  1A1F A;  2LO3 A;  2ADR A;  5KL5 A;  1AAY A;  2R1F A;  2NAB A;  2PRT A;  2WBS A;  1DGC A;  2EMX A;  2EPZ A;  2YSP A;  1A1H A;  2YTI A;  2YTO A;  4X9J A;  2EM7 A;  2MKD A;  2WCC 3;  4F6M A;  2EPC A;  1LLM C;  1A1G A;  2EOZ A;  1YUI A;  5KL3 A;  1MEY C;  2YU5 A;  2EOI A;  2EN1 A;  5KL4 A;  2EMF A;  2EN2 A;  2YTD A;  2ELZ A;  2E72 A;  2CTD A;  4IJD A;  2EMC A;  2EL5 A;  4R2E A;  1YSA C;  1X6F A;  2LT7 A;  4IS1 C;  4R2C A;  2EOS A;  2EQ1 A;  2YTJ A;  2JP9 A;  2YU8 A;  2EOR A;  2J7J A;  5KL6 A;  1WJP A;  2YTE A;  2EOO A;  2EMY A;  2DRP A;  2D9H A;  2EE8 A;  4R2D A;  1X6H A;  2EOE A;  2LVH A;  4R2R A;  2EMH A;  1TF3 A;  4F6N A;  3MHS C;  1YUJ A;  2CSH A;  2EP3 A;  2EMK A;  1ZR9 A;  2EOF A;  2CT1 A;  2MDG A;  2YRK A;  2YTF A;  3MHH C;  3UK3 C;  2JPA A;  2EL4 A;  1A1I A;  4WSG A;  1TN9 A;  2EML A;  1F2I G;  2EQ3 A;  2EOJ A;  3EPK A;  2EPA A;  3EPL A;  2EM3 A;  2ENA A;  2EMA A;  2EL6 A;  2EMB A;  1RMD A;  2EN6 A;  2LV2 A;  2RPC A;  2YRH A;  1X6E A;  2EM6 A;  2EOQ A;  1UN6 B;  2EMZ A;  3VHT B;  2ENC A;  2DLQ A;  2EMI A;  2GLI A;  2EMG A;  2EJ4 A;  1G2F C;  1BB8 A;  1NCS A;  2EM8 A;  2EPX A;  1X5W A;  2EOX A;  2EPP A;  4R2S A;  2M9A A;  2BB8 A;  2ENH A;  1JK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...