5KL7A

Wilms tumor protein (wt1) znf2-4q369r in complex with carboxylated dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
87
structure length
87
Chain Sequence
EKPYQCDFKDCERRFSRSDRLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords Wilms tumor protein
publication title Denys-Drash syndrome associated WT1 glutamine 369 mutants have altered sequence-preferences and altered responses to epigenetic modifications.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2016-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 5kl7A00
2EQ3A 5KL4A 1G2DC 2EOMA 2EMXA 2GHFA 1TN9A 2EMGA 2YTIA 2EMIA 2MDGA 5KL3A 1Z1BA 2ADRA 2EPPA 1MEYC 2WCC3 2JPAA 2R1FA 2YTOA 1A1HA 2ELYA 2EMYA 4IJDA 2EM2A 3VHTB 2DGCA 1YUJA 1WJPA 2EPAA 3MHSC 1JK2A 1B69A 1BBOA 2EM7A 2VRDA 1JK1A 2EN8A 2RSIA 2LO3A 2YU8A 2WBTA 2EN4A 2EOYA 2EMAA 2ENHA 2LT7A 1G2FC 4F6NA 4F6MA 1AAYA 2EM5A 2ELZA 2YTEA 1A1IA 2EOFA 2EMLA 1A1GA 2ENCA 2YU5A 4F2JC 1NCSA 1P47A 1ZR9A 5KL2A 2EN3A 2EPCA 4FK5C 2HGHA 2EOZA 2EMKA 2EE8A 2EN6A 2YRKA 2EM3A 2EORA 2EPRA 2EPZA 2EMZA 3EPHA 2MKNA 1A1LA 1A1KA 1ZAAC 2EL6A 2EOOA 4R2PA 4R2QA 3EPJA 1DGCA 1ZU1A 2M9AA 1LLMC 4R2CA 2EM8A 2EM9A 1X6FA 2I13A 2YSOA 1RMDA 1BB8A 2EM6A 2EL5A 5KL6A 2DLKA 2EOJA 1UBDC 2EJ4A 1A1JA 2CSHA 3UK3C 1YSAC 1YUIA 2PRTA 2YTPA 2EOQA 2EL4A 4R2EA 2EN7A 4WSGA 4R2AA 2YTNA 2YTFA 2EMFA 2EM4A 2RPCA 4IS1C 2EMBA 5KL5A 2EOXA 4X9JA 1F2IG 2WBSA 4R2SA 2WBUA 4GZNC 4M9VC 2EMHA 2MKDA 2EOHA 2EPXA 2D9HA 1UN6B 1X3CA 2EMCA 2EOSA 1TF6A 2DLQA 2E72A 2EP3A 2LCEA 2CT1A 2NABA 1KJKA 2LVHA 1A1FA 2ENAA 2EOEA 2EPUA 2EM0A 2YRMA 2BB8A 2YRHA 1X6HA 2YTGA 2EOIA 2YTJA 2YSPA 4R2RA 1X6EA 2EQ1A 1X5WA 2LV2A 2JP9A 5KL7A 2DMIA 2DRPA 2YTDA 2A25A 2GLIA 3EPLA 2EN2A 2EN1A 3MHHC 3EPKA 2YTQA 2EQ0A 4R2DA 2CTDA 2J7JA 3M99B 1TF3A 2EMWA
chains in the Genus database with same CATH superfamily
1XMQE 1J26A 4JI2E 1TN9A 3JU0A 2YTIA 1Z1BA 2EPPA 2EWLA 2R1FA 1N32E 3VYXA 4IJDA 2EM2A 4F9BB 4LF7E 1YUJA 1WJPA 1DQ3A 2JY9A 3LLHA 3VK6A 1JK2A 3DF6A 2Q8UA 2LO3A 2WBTA 4LF5E 2LT7A 1G2FC 4F6NA 4WXCA 4DR7E 4WSPA 2YTEA 4JI6E 2EMLA 2V86A 2RQLA 1N33E 3IWBA 4F9CB 2HGHA 2F4VE 4BC9A 1PJSA 2L2KB 2UU9E 1A1KA 4R2PA 2B7TA 3BGHA 3IWDA 1DGCA 1ZU1A 2M9AA 3ADJA 2EM8A 1YYWA 1X6FA 4MLVA 3C4TA 2EM6A 4LU9A 2EJ4A 3UK3C 1XNRE 2L6MA 4OX9E 3ADGA 4LF8E 2V8QB 2FTXB 1ZBQA 1STUA 2M4IA 2YTNA 3F6HA 1BBGA 2RPCA 1QNTA 4AQYE 2M1SA 2JXPA 1IBME 2RSMA 5KL5A 1GTKA 4DKKA 1EKZA 5AC4A 4R2SA 3HQ1A 2WBUA 2V88A 1SR9A 5LMNE 4DV6E 4LFBE 4O43A 1T4OA 2EMHA 2LMZA 1PJQA 2KOUA 1IQSA 1EH6A 2NUGA 2CT1A 5IWAE 4LF9E 4LFAE 1KJKA 1X49A 5CFFE 4DV3E 2YT4A 2YSPA 4R2RA 2EQ1A 4X64E 1HR0E 1X5WA 4DR2E 2LBSB 5KL7A 4RH8A 2UUAE 2DRPA 2YTDA 2GLIA 2EPLX 3BBGA 3MHHC 4R2DA 1IMUA 4WX9A 5LLQA 5KL4A 2MDGA 5KL3A 1N36E 2ADRA 2JPAA 3LMLA 2WCC3 1PJTA 4B3SE 4WYQB 5LL6R 4I8OA 1WRJA 3AUZA 1QU6A 1B69A 1BBOA 2UUCE 2VQEE 5LMUE 1JK1A 4DMIA 2RSIA 2JWOA 3IWCA 2EN4A 2FV4B 4YHHE 2UUBE 2N8XA 4Q28A 1PDAA 1AAYA 2ELZA 3HPZA 4TUIA 2EOFA 4R03A 2ENCA 4M30A 1A1GA 1NEIA 5IXMB 4LF6E 2EPCA 4FK5C 2EOZA 3ADLA 1MGTA 1N34E 2EORA 3FIGA 2EPRA 2EMZA 2VE7C 4BHBA 2HHHE 1A1LA 1GZ6A 2H36X 1WXRA 4DV5E 1ZAAC 5ADZA 4BCAA 2FGGA 4B3ME 4M0VA 1LLMC 2UXBE 3K6QA 2LUPB 1J5EE 4X8WA 1YZ9A 2KHXA 2EM9A 4DR4E 2I13A 4ZYDA 4NXME 2YSOA 1RMDA 2EL5A 3OMLA 3BIDA 5DNYA 1A1JA 4O24A 2HJJA 2JVAA 1YSAC 1YFHA 5AE2A 4KHPE 1FKAE 2LE2A 1EH8A 2RTXA 1WHQA 2YTFA 2N3HA 3JTZA 2MC5A 4JI3E 2EMBA 1X48A 2LTSA 2WZOA 2EOXA 4X9JA 1F2IG 2WBSA 2L8TA 4F54A 4M9VC 4HEIA 3C4BA 2EOHA 2I9IA 1I94E 2EPXA 1YPNA 5AE3A 4WFTA 3EQ1A 2M7QA 3ADIA 2EP3A 2LCEA 4DR6E 1HNWE 2NABA 2LVHA 3C6KA 2HC5A 4OOGC 1FJGE 2F8BA 3HXLA 3THNA 2YRMA 1X6HA 1IBLE 4J8ZA 4WXDA 1T39A 1KYQA 4P78A 4K0KE 5T6JA 5A6AA 2EZ6A 4GKJE 2EN1A 4DR3E 3EPKA 2B9DA 2VQFE 1GQEA 2EPMX 2CTDA 1TF3A 2EMXA 1T38A 2L2NA 4GKKE 1HNXE 5AASA 4X62E 2ELYA 2MC6A 4N4RB 4ZYGA 2EPAA 3J7Yp 2L3CA 2EN8A 4JI4E 2V87A 5IT9C 3T1HE 5BR8E 2YU8A 1T4LB 2L92A 4M2ZA 4L5NC 4BC7A 3ZOQB 2EMAA 2ENHA 1ZBTA 4ZYHA 4DV2E 2EM5A 3T1YE 5A6JA 1EH7A 4F2JC 4JI5E 1NCSA 3J80C 4YY3E 4GEQB 2B3TB 2EN6A 4TUGA 2YRKA 2EM3A 1AH5A 3EPHA 4DV4E 4B3RE 4JI0E 3AV0A 2EL6A 3TQMA 2IHR1 3L00A 1O0WA 2K7IA 4R2CA 4LFCE 1IBKE 2JR1A 4KWYA 4R8OA 4L8NA 2DLKA 1UBDC 1SFEA 1T4NA 1YUIA 2PRTA 2YTPA 2EOQA 2EL4A 2EN7A 3DJWA 4WSGA 4RHBB 4R2AA 3RMPA 2E5LE 3HTXA 2EM4A 4B3TE 3KZYA 4IS1C 2B7VA 5AC5A 4JV5E 2DMYA 2LJHA 4P7DA 3J81C 4BBYA 4LTYA 4LF4E 2MKDA 4BHCA 1N3GA 2DB2A 5IV8B 3C6MA 2D9HA 1UN6B 1X3CA 3H09A 2YZTA 2EMCA 2UXCE 1TF6A 2E72A 2VF1A 5AE1A 2V85A 5A6BD 2V83A 5FLXC 2ENAA 2EPUA 4WPYA 3J7AG 2BB8A 4DV0E 2YTGA 2YTJA 1X6EA 4DV1E 2JOXA 2N3GA 5TSEA 2YPNA 2JP9A 4DUYE 2DMIA 2A25A 2EN2A 2LJUA 3HPSA 4Q35B 2EPKX 3THOB 4NXNE 2EQ3A 1G2DC 2EOMA 2JYAA 2ODRC 2DIXA 2GHFA 2ODRD 2NUFA 2EMGA 1RQ0A 2EMIA 2NA2A 1MEYC 1YYKA 4NHRA 1PKPA 2V89A 2YTOA 1A1HA 2EMYA 2R76A 3VHTB 2DGCA 1UILA 3MHSC 4NZVA 2ZM6E 4HTGA 2EM7A 4O5GA 5A2QC 2VRDA 4JI1E 3F6GA 2L2MA 2EPOA 2JOBA 2EOYA 2MDRA 1DI2A 4F6MA 1A1IA 2E1MA 1UHZA 2CPNA 2L3JA 2YU5A 1L4SA 1P47A 1ZR9A 5KL2A 2EN3A 4DR5E 2EMKA 2EE8A 2EPZA 4X65E 1YYOA 2G7HA 2MKNA 3P1XA 4MLQA 3KZZA 2EOOA 2L33A 5A69A 4R2QA 3EPJA 1XMOE 3MSWA 1X47A 1WHNA 1RC7A 1BB8A 2KONA 5KL6A 2EOJA 3QG5C 2CSHA 3ECRA 2LRSA 4R2EA 3VYYA 2NUEA 2EMFA 2BBGA 4KZSA 4JI7E 4F9AB 1XNQE 2DSYA 4JYAE 2K4VA 4GZNC 2EPNA 1IQOA 4JI8E 2LTRA 2RS7A 5A6KA 4BS9A 4DUZE 2LUQA 3JAMC 2EOSA 4ZYEA 2DLQA 4BMJA 5A6BA 4O4KA 4DR1E 3KWRA 1A1FA 2GPIA 2EOEA 2EM0A 4DV7E 5F3WA 2YRHA 2YWQA 2EOIA 4X66E 2LV2A 3OTOE 1HNZE 3EPLA 2UXDE 2YTQA 2RS6A 2EQ0A 3BF2A 2J7JA 3M99B 2EMWA
chains in the Genus database with same CATH topology
2EQ3A 5KL4A 1G2DC 2EOMA 2EMXA 2GHFA 1TN9A 2EMGA 2YTIA 2EMIA 2MDGA 5KL3A 1Z1BA 2ADRA 2EPPA 1MEYC 2WCC3 2JPAA 2R1FA 2YTOA 1A1HA 2ELYA 2EMYA 4IJDA 2EM2A 3VHTB 2DGCA 1YUJA 1WJPA 2EPAA 3MHSC 1JK2A 1B69A 1BBOA 2EM7A 2VRDA 1JK1A 2EN8A 2RSIA 2LO3A 2YU8A 2WBTA 2EN4A 2EOYA 2EMAA 2ENHA 2LT7A 1G2FC 4F6NA 4F6MA 1AAYA 2EM5A 2ELZA 2YTEA 1A1IA 2EOFA 2EMLA 1A1GA 2ENCA 2YU5A 4F2JC 1NCSA 1P47A 1ZR9A 5KL2A 2EN3A 2EPCA 4FK5C 2HGHA 2EOZA 2EMKA 2EE8A 2EN6A 2YRKA 2EM3A 2EORA 2EPRA 2EPZA 2EMZA 3EPHA 2MKNA 1A1LA 1A1KA 1ZAAC 2EL6A 2EOOA 4R2PA 4R2QA 3EPJA 1DGCA 1ZU1A 2M9AA 1LLMC 4R2CA 2EM8A 2EM9A 1X6FA 2I13A 2YSOA 1RMDA 1BB8A 2EM6A 2EL5A 5KL6A 2DLKA 2EOJA 1UBDC 2EJ4A 1A1JA 2CSHA 3UK3C 1YSAC 1YUIA 2PRTA 2YTPA 2EOQA 2EL4A 4R2EA 2EN7A 4WSGA 4R2AA 2YTNA 2YTFA 2EMFA 2EM4A 2RPCA 4IS1C 2EMBA 5KL5A 2EOXA 4X9JA 1F2IG 2WBSA 4R2SA 2WBUA 4GZNC 4M9VC 2EMHA 2MKDA 2EOHA 2EPXA 2D9HA 1UN6B 1X3CA 2EMCA 2EOSA 1TF6A 2DLQA 2E72A 2EP3A 2LCEA 2CT1A 2NABA 1KJKA 2LVHA 1A1FA 2ENAA 2EOEA 2EPUA 2EM0A 2YRMA 2BB8A 2YRHA 1X6HA 2YTGA 2EOIA 2YTJA 2YSPA 4R2RA 1X6EA 2EQ1A 1X5WA 2LV2A 2JP9A 5KL7A 2DMIA 2DRPA 2YTDA 2A25A 2GLIA 3EPLA 2EN2A 2EN1A 3MHHC 3EPKA 2YTQA 2EQ0A 4R2DA 2CTDA 2J7JA 3M99B 1TF3A 2EMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EQ3 A;  5KL4 A;  1G2D C;  2EOM A;  2EMX A;  2GHF A;  1TN9 A;  2EMG A;  2YTI A;  2EMI A;  2MDG A;  5KL3 A;  1Z1B A;  2ADR A;  2EPP A;  1MEY C;  2WCC 3;  2JPA A;  2R1F A;  2YTO A;  1A1H A;  2ELY A;  2EMY A;  4IJD A;  2EM2 A;  3VHT B;  2DGC A;  1YUJ A;  1WJP A;  2EPA A;  3MHS C;  1JK2 A;  1B69 A;  1BBO A;  2EM7 A;  2VRD A;  1JK1 A;  2EN8 A;  2RSI A;  2LO3 A;  2YU8 A;  2WBT A;  2EN4 A;  2EOY A;  2EMA A;  2ENH A;  2LT7 A;  1G2F C;  4F6N A;  4F6M A;  1AAY A;  2EM5 A;  2ELZ A;  2YTE A;  1A1I A;  2EOF A;  2EML A;  1A1G A;  2ENC A;  2YU5 A;  4F2J C;  1NCS A;  1P47 A;  1ZR9 A;  5KL2 A;  2EN3 A;  2EPC A;  4FK5 C;  2HGH A;  2EOZ A;  2EMK A;  2EE8 A;  2EN6 A;  2YRK A;  2EM3 A;  2EOR A;  2EPR A;  2EPZ A;  2EMZ A;  3EPH A;  2MKN A;  1A1L A;  1A1K A;  1ZAA C;  2EL6 A;  2EOO A;  4R2P A;  4R2Q A;  3EPJ A;  1DGC A;  1ZU1 A;  2M9A A;  1LLM C;  4R2C A;  2EM8 A;  2EM9 A;  1X6F A;  2I13 A;  2YSO A;  1RMD A;  1BB8 A;  2EM6 A;  2EL5 A;  5KL6 A;  2DLK A;  2EOJ A;  1UBD C;  2EJ4 A;  1A1J A;  2CSH A;  3UK3 C;  1YSA C;  1YUI A;  2PRT A;  2YTP A;  2EOQ A;  2EL4 A;  4R2E A;  2EN7 A;  4WSG A;  4R2A A;  2YTN A;  2YTF A;  2EMF A;  2EM4 A;  2RPC A;  4IS1 C;  2EMB A;  5KL5 A;  2EOX A;  4X9J A;  1F2I G;  2WBS A;  4R2S A;  2WBU A;  4GZN C;  4M9V C;  2EMH A;  2MKD A;  2EOH A;  2EPX A;  2D9H A;  1UN6 B;  1X3C A;  2EMC A;  2EOS A;  1TF6 A;  2DLQ A;  2E72 A;  2EP3 A;  2LCE A;  2CT1 A;  2NAB A;  1KJK A;  2LVH A;  1A1F A;  2ENA A;  2EOE A;  2EPU A;  2EM0 A;  2YRM A;  2BB8 A;  2YRH A;  1X6H A;  2YTG A;  2EOI A;  2YTJ A;  2YSP A;  4R2R A;  1X6E A;  2EQ1 A;  1X5W A;  2LV2 A;  2JP9 A;  5KL7 A;  2DMI A;  2DRP A;  2YTD A;  2A25 A;  2GLI A;  3EPL A;  2EN2 A;  2EN1 A;  3MHH C;  3EPK A;  2YTQ A;  2EQ0 A;  4R2D A;  2CTD A;  2J7J A;  3M99 B;  1TF3 A;  2EMW A; 
#chains in the Genus database with same CATH topology
 1XMQ E;  1J26 A;  4JI2 E;  1TN9 A;  3JU0 A;  2YTI A;  1Z1B A;  2EPP A;  2EWL A;  2R1F A;  1N32 E;  3VYX A;  4IJD A;  2EM2 A;  4F9B B;  4LF7 E;  1YUJ A;  1WJP A;  1DQ3 A;  2JY9 A;  3LLH A;  3VK6 A;  1JK2 A;  3DF6 A;  2Q8U A;  2LO3 A;  2WBT A;  4LF5 E;  2LT7 A;  1G2F C;  4F6N A;  4WXC A;  4DR7 E;  4WSP A;  2YTE A;  4JI6 E;  2EML A;  2V86 A;  2RQL A;  1N33 E;  3IWB A;  4F9C B;  2HGH A;  2F4V E;  4BC9 A;  1PJS A;  2L2K B;  2UU9 E;  1A1K A;  4R2P A;  2B7T A;  3BGH A;  3IWD A;  1DGC A;  1ZU1 A;  2M9A A;  3ADJ A;  2EM8 A;  1YYW A;  1X6F A;  4MLV A;  3C4T A;  2EM6 A;  4LU9 A;  2EJ4 A;  3UK3 C;  1XNR E;  2L6M A;  4OX9 E;  3ADG A;  4LF8 E;  2V8Q B;  2FTX B;  1ZBQ A;  1STU A;  2M4I A;  2YTN A;  3F6H A;  1BBG A;  2RPC A;  1QNT A;  4AQY E;  2M1S A;  2JXP A;  1IBM E;  2RSM A;  5KL5 A;  1GTK A;  4DKK A;  1EKZ A;  5AC4 A;  4R2S A;  3HQ1 A;  2WBU A;  2V88 A;  1SR9 A;  5LMN E;  4DV6 E;  4LFB E;  4O43 A;  1T4O A;  2EMH A;  2LMZ A;  1PJQ A;  2KOU A;  1IQS A;  1EH6 A;  2NUG A;  2CT1 A;  5IWA E;  4LF9 E;  4LFA E;  1KJK A;  1X49 A;  5CFF E;  4DV3 E;  2YT4 A;  2YSP A;  4R2R A;  2EQ1 A;  4X64 E;  1HR0 E;  1X5W A;  4DR2 E;  2LBS B;  5KL7 A;  4RH8 A;  2UUA E;  2DRP A;  2YTD A;  2GLI A;  2EPL X;  3BBG A;  3MHH C;  4R2D A;  1IMU A;  4WX9 A;  5LLQ A;  5KL4 A;  2MDG A;  5KL3 A;  1N36 E;  2ADR A;  2JPA A;  3LML A;  2WCC 3;  1PJT A;  4B3S E;  4WYQ B;  5LL6 R;  4I8O A;  1WRJ A;  3AUZ A;  1QU6 A;  1B69 A;  1BBO A;  2UUC E;  2VQE E;  5LMU E;  1JK1 A;  4DMI A;  2RSI A;  2JWO A;  3IWC A;  2EN4 A;  2FV4 B;  4YHH E;  2UUB E;  2N8X A;  4Q28 A;  1PDA A;  1AAY A;  2ELZ A;  3HPZ A;  4TUI A;  2EOF A;  4R03 A;  2ENC A;  4M30 A;  1A1G A;  1NEI A;  5IXM B;  4LF6 E;  2EPC A;  4FK5 C;  2EOZ A;  3ADL A;  1MGT A;  1N34 E;  2EOR A;  3FIG A;  2EPR A;  2EMZ A;  2VE7 C;  4BHB A;  2HHH E;  1A1L A;  1GZ6 A;  2H36 X;  1WXR A;  4DV5 E;  1ZAA C;  5ADZ A;  4BCA A;  2FGG A;  4B3M E;  4M0V A;  1LLM C;  2UXB E;  3K6Q A;  2LUP B;  1J5E E;  4X8W A;  1YZ9 A;  2KHX A;  2EM9 A;  4DR4 E;  2I13 A;  4ZYD A;  4NXM E;  2YSO A;  1RMD A;  2EL5 A;  3OML A;  3BID A;  5DNY A;  1A1J A;  4O24 A;  2HJJ A;  2JVA A;  1YSA C;  1YFH A;  5AE2 A;  4KHP E;  1FKA E;  2LE2 A;  1EH8 A;  2RTX A;  1WHQ A;  2YTF A;  2N3H A;  3JTZ A;  2MC5 A;  4JI3 E;  2EMB A;  1X48 A;  2LTS A;  2WZO A;  2EOX A;  4X9J A;  1F2I G;  2WBS A;  2L8T A;  4F54 A;  4M9V C;  4HEI A;  3C4B A;  2EOH A;  2I9I A;  1I94 E;  2EPX A;  1YPN A;  5AE3 A;  4WFT A;  3EQ1 A;  2M7Q A;  3ADI A;  2EP3 A;  2LCE A;  4DR6 E;  1HNW E;  2NAB A;  2LVH A;  3C6K A;  2HC5 A;  4OOG C;  1FJG E;  2F8B A;  3HXL A;  3THN A;  2YRM A;  1X6H A;  1IBL E;  4J8Z A;  4WXD A;  1T39 A;  1KYQ A;  4P78 A;  4K0K E;  5T6J A;  5A6A A;  2EZ6 A;  4GKJ E;  2EN1 A;  4DR3 E;  3EPK A;  2B9D A;  2VQF E;  1GQE A;  2EPM X;  2CTD A;  1TF3 A;  2EMX A;  1T38 A;  2L2N A;  4GKK E;  1HNX E;  5AAS A;  4X62 E;  2ELY A;  2MC6 A;  4N4R B;  4ZYG A;  2EPA A;  3J7Y p;  2L3C A;  2EN8 A;  4JI4 E;  2V87 A;  5IT9 C;  3T1H E;  5BR8 E;  2YU8 A;  1T4L B;  2L92 A;  4M2Z A;  4L5N C;  4BC7 A;  3ZOQ B;  2EMA A;  2ENH A;  1ZBT A;  4ZYH A;  4DV2 E;  2EM5 A;  3T1Y E;  5A6J A;  1EH7 A;  4F2J C;  4JI5 E;  1NCS A;  3J80 C;  4YY3 E;  4GEQ B;  2B3T B;  2EN6 A;  4TUG A;  2YRK A;  2EM3 A;  1AH5 A;  3EPH A;  4DV4 E;  4B3R E;  4JI0 E;  3AV0 A;  2EL6 A;  3TQM A;  2IHR 1;  3L00 A;  1O0W A;  2K7I A;  4R2C A;  4LFC E;  1IBK E;  2JR1 A;  4KWY A;  4R8O A;  4L8N A;  2DLK A;  1UBD C;  1SFE A;  1T4N A;  1YUI A;  2PRT A;  2YTP A;  2EOQ A;  2EL4 A;  2EN7 A;  3DJW A;  4WSG A;  4RHB B;  4R2A A;  3RMP A;  2E5L E;  3HTX A;  2EM4 A;  4B3T E;  3KZY A;  4IS1 C;  2B7V A;  5AC5 A;  4JV5 E;  2DMY A;  2LJH A;  4P7D A;  3J81 C;  4BBY A;  4LTY A;  4LF4 E;  2MKD A;  4BHC A;  1N3G A;  2DB2 A;  5IV8 B;  3C6M A;  2D9H A;  1UN6 B;  1X3C A;  3H09 A;  2YZT A;  2EMC A;  2UXC E;  1TF6 A;  2E72 A;  2VF1 A;  5AE1 A;  2V85 A;  5A6B D;  2V83 A;  5FLX C;  2ENA A;  2EPU A;  4WPY A;  3J7A G;  2BB8 A;  4DV0 E;  2YTG A;  2YTJ A;  1X6E A;  4DV1 E;  2JOX A;  2N3G A;  5TSE A;  2YPN A;  2JP9 A;  4DUY E;  2DMI A;  2A25 A;  2EN2 A;  2LJU A;  3HPS A;  4Q35 B;  2EPK X;  3THO B;  4NXN E;  2EQ3 A;  1G2D C;  2EOM A;  2JYA A;  2ODR C;  2DIX A;  2GHF A;  2ODR D;  2NUF A;  2EMG A;  1RQ0 A;  2EMI A;  2NA2 A;  1MEY C;  1YYK A;  4NHR A;  1PKP A;  2V89 A;  2YTO A;  1A1H A;  2EMY A;  2R76 A;  3VHT B;  2DGC A;  1UIL A;  3MHS C;  4NZV A;  2ZM6 E;  4HTG A;  2EM7 A;  4O5G A;  5A2Q C;  2VRD A;  4JI1 E;  3F6G A;  2L2M A;  2EPO A;  2JOB A;  2EOY A;  2MDR A;  1DI2 A;  4F6M A;  1A1I A;  2E1M A;  1UHZ A;  2CPN A;  2L3J A;  2YU5 A;  1L4S A;  1P47 A;  1ZR9 A;  5KL2 A;  2EN3 A;  4DR5 E;  2EMK A;  2EE8 A;  2EPZ A;  4X65 E;  1YYO A;  2G7H A;  2MKN A;  3P1X A;  4MLQ A;  3KZZ A;  2EOO A;  2L33 A;  5A69 A;  4R2Q A;  3EPJ A;  1XMO E;  3MSW A;  1X47 A;  1WHN A;  1RC7 A;  1BB8 A;  2KON A;  5KL6 A;  2EOJ A;  3QG5 C;  2CSH A;  3ECR A;  2LRS A;  4R2E A;  3VYY A;  2NUE A;  2EMF A;  2BBG A;  4KZS A;  4JI7 E;  4F9A B;  1XNQ E;  2DSY A;  4JYA E;  2K4V A;  4GZN C;  2EPN A;  1IQO A;  4JI8 E;  2LTR A;  2RS7 A;  5A6K A;  4BS9 A;  4DUZ E;  2LUQ A;  3JAM C;  2EOS A;  4ZYE A;  2DLQ A;  4BMJ A;  5A6B A;  4O4K A;  4DR1 E;  3KWR A;  1A1F A;  2GPI A;  2EOE A;  2EM0 A;  4DV7 E;  5F3W A;  2YRH A;  2YWQ A;  2EOI A;  4X66 E;  2LV2 A;  3OTO E;  1HNZ E;  3EPL A;  2UXD E;  2YTQ A;  2RS6 A;  2EQ0 A;  3BF2 A;  2J7J A;  3M99 B;  2EMW A; 
#chains in the Genus database with same CATH homology
 2EQ3 A;  5KL4 A;  1G2D C;  2EOM A;  2EMX A;  2GHF A;  1TN9 A;  2EMG A;  2YTI A;  2EMI A;  2MDG A;  5KL3 A;  1Z1B A;  2ADR A;  2EPP A;  1MEY C;  2WCC 3;  2JPA A;  2R1F A;  2YTO A;  1A1H A;  2ELY A;  2EMY A;  4IJD A;  2EM2 A;  3VHT B;  2DGC A;  1YUJ A;  1WJP A;  2EPA A;  3MHS C;  1JK2 A;  1B69 A;  1BBO A;  2EM7 A;  2VRD A;  1JK1 A;  2EN8 A;  2RSI A;  2LO3 A;  2YU8 A;  2WBT A;  2EN4 A;  2EOY A;  2EMA A;  2ENH A;  2LT7 A;  1G2F C;  4F6N A;  4F6M A;  1AAY A;  2EM5 A;  2ELZ A;  2YTE A;  1A1I A;  2EOF A;  2EML A;  1A1G A;  2ENC A;  2YU5 A;  4F2J C;  1NCS A;  1P47 A;  1ZR9 A;  5KL2 A;  2EN3 A;  2EPC A;  4FK5 C;  2HGH A;  2EOZ A;  2EMK A;  2EE8 A;  2EN6 A;  2YRK A;  2EM3 A;  2EOR A;  2EPR A;  2EPZ A;  2EMZ A;  3EPH A;  2MKN A;  1A1L A;  1A1K A;  1ZAA C;  2EL6 A;  2EOO A;  4R2P A;  4R2Q A;  3EPJ A;  1DGC A;  1ZU1 A;  2M9A A;  1LLM C;  4R2C A;  2EM8 A;  2EM9 A;  1X6F A;  2I13 A;  2YSO A;  1RMD A;  1BB8 A;  2EM6 A;  2EL5 A;  5KL6 A;  2DLK A;  2EOJ A;  1UBD C;  2EJ4 A;  1A1J A;  2CSH A;  3UK3 C;  1YSA C;  1YUI A;  2PRT A;  2YTP A;  2EOQ A;  2EL4 A;  4R2E A;  2EN7 A;  4WSG A;  4R2A A;  2YTN A;  2YTF A;  2EMF A;  2EM4 A;  2RPC A;  4IS1 C;  2EMB A;  5KL5 A;  2EOX A;  4X9J A;  1F2I G;  2WBS A;  4R2S A;  2WBU A;  4GZN C;  4M9V C;  2EMH A;  2MKD A;  2EOH A;  2EPX A;  2D9H A;  1UN6 B;  1X3C A;  2EMC A;  2EOS A;  1TF6 A;  2DLQ A;  2E72 A;  2EP3 A;  2LCE A;  2CT1 A;  2NAB A;  1KJK A;  2LVH A;  1A1F A;  2ENA A;  2EOE A;  2EPU A;  2EM0 A;  2YRM A;  2BB8 A;  2YRH A;  1X6H A;  2YTG A;  2EOI A;  2YTJ A;  2YSP A;  4R2R A;  1X6E A;  2EQ1 A;  1X5W A;  2LV2 A;  2JP9 A;  5KL7 A;  2DMI A;  2DRP A;  2YTD A;  2A25 A;  2GLI A;  3EPL A;  2EN2 A;  2EN1 A;  3MHH C;  3EPK A;  2YTQ A;  2EQ0 A;  4R2D A;  2CTD A;  2J7J A;  3M99 B;  1TF3 A;  2EMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...