5KL7A

Wilms tumor protein (wt1) znf2-4q369r in complex with carboxylated dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
87
structure length
87
Chain Sequence
EKPYQCDFKDCERRFSRSDRLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Wilms tumor protein
publication title Denys-Drash syndrome associated WT1 glutamine 369 mutants have altered sequence-preferences and altered responses to epigenetic modifications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 29
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2016-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 5kl7A00
4R2DA 2EL4A 2YU8A 2YU5A 2I13A 2EMZA 2EN1A 1YUIA 2WBTA 5KL3A 2WCC3 1A1HA 1ZAAC 2CT1A 1X6HA 2ENHA 1G2FC 2EN4A 2DMIA 2EPRA 2EN7A 2EQ1A 2YSOA 2BB8A 1X3CA 1G2DC 2DRPA 1WJPA 3UK3C 3EPJA 2YSPA 4GZNC 2EM8A 2LCEA 4IS1C 1B69A 2ELYA 2YTIA 1A1IA 2EM9A 2CTDA 2EE8A 5KL4A 2EOEA 4F2JC 2VRDA 1A1KA 1ZU1A 2YRMA 1Z1BA 2JPAA 2EM0A 2EORA 2EM7A 3EPLA 3MHHC 2EMGA 2J7JA 3MHSC 1TN9A 2EMAA 1JK2A 1NCSA 2EN8A 2YTJA 4R2AA 1ZR9A 2EMFA 2EPXA 2R1FA 1UBDC 1JK1A 2EMBA 2YTEA 5KL2A 2EOXA 4M9VC 2YRHA 2EOYA 1TF3A 4R2CA 1AAYA 3EPHA 2HGHA 2EMYA 4R2EA 2RSIA 2EOQA 2EMIA 2DLQA 2EOOA 2EMXA 2RPCA 2MKDA 4F6MA 3VHTB 2ENCA 2EL6A 2EJ4A 2YTQA 2JP9A 2EPZA 2ENAA 4WSGA 2EMWA 4R2SA 3M99B 1A1LA 1A1JA 1F2IG 2YRKA 2PRTA 2EPCA 2YTDA 2YTOA 5KL6A 4R2QA 1MEYC 1DGCA 1X6FA 2EMCA 2EOIA 2EOJA 4R2PA 2EP3A 2YTNA 1YSAC 2EOZA 2EMHA 2A25A 2EQ3A 1X5WA 4R2RA 2EQ0A 2LT7A 2LO3A 2LV2A 2ADRA 2M9AA 4IJDA 2EN2A 2EPPA 1A1FA 2YTPA 2NABA 2DGCA 2EPUA 1A1GA 1YUJA 2ELZA 2YTFA 5KL5A 2EL5A 2EMKA 2EOHA 2EN6A 1X6EA 4F6NA 2LVHA 2D9HA 2YTGA 2EOSA 3EPKA 2EM6A 2EOFA 1TF6A 2MDGA 2EM2A 1BB8A 2E72A 1BBOA 2EPAA 2GHFA 1UN6B 1KJKA 2WBSA 2CSHA 5KL7A 1RMDA 2EN3A 2GLIA 2EM4A 1P47A 4FK5C 2EMLA 2MKNA 1LLMC 2DLKA 4X9JA 2WBUA 2EOMA 2EM3A 2EM5A
chains in the Genus database with same CATH superfamily
5LL6R 2EL4A 2YU8A 2I13A 4LF5E 2NUGA 4R8OA 1YUIA 4JI8E 1ZAAC 2L33A 1T39A 5IXMB 2JXPA 3DF6A 4DR7E 1X6HA 3ADLA 4WFTA 2EPRA 1ZBQA 1STUA 1G2DC 2EPMX 1WJPA 1EH6A 4O43A 4J8ZA 1FJGE 2NA2A 4IS1C 3J81C 1PJTA 2I9IA 2RSMA 1UILA 4YHHE 3F6GA 1A1KA 2YRMA 1Z1BA 4DV2E 3EPLA 1QU6A 3AV0A 3QG5C 2J7JA 2EPOA 2K7IA 1J5EE 5CFFE 2YTJA 3IWDA 4OX9E 2EMFA 2V8QB 1XNQE 1JK1A 2YTEA 1YYKA 4Q28A 1PKPA 1TF3A 2RPCA 4F6MA 3VYYA 1X49A 2MKDA 1XNRE 1N33E 1YPNA 2VE7C 4HTGA 5A6BD 2EMWA 2L2MA 3BBGA 4KWYA 3M99B 3RMPA 4DV4E 2YRKA 4KZSA 1L4SA 4JYAE 2EOIA 1YYWA 5IWAE 4DR5E 1YZ9A 2B7TA 2DMYA 2EP3A 2YTNA 4KHPE 2UUBE 2EPNA 2VQFE 2LV2A 2L3CA 2KONA 2ADRA 4IJDA 3H09A 2EPPA 3ADGA 4WXDA 2NABA 4F9CB 1GZ6A 2LTRA 5LLQA 2UUCE 3T1YE 1N32E 2LVHA 2L92A 2N3GA 2DIXA 4BHCA 2EM6A 2EOFA 3ZOQB 4X62E 1BB8A 2CPNA 2E1MA 2EPAA 4WX9A 4N4RB 4F54A 4JI1E 3OMLA 4BC9A 4FK5C 3AUZA 1GQEA 2FTXB 2JR1A 2LRSA 1LLMC 2MKNA 4LFAE 2WBUA 4JI7E 1PDAA 2N3HA 3C4BA 3C6MA 2JVAA 4LF6E 2YZTA 1PJQA 2EMZA 2RQLA 2EN1A 2M4IA 4MLVA 4DR2E 1WHQA 2UXDE 2L8TA 4BBYA 2V88A 3HPZA 1G2FC 2EN4A 1IMUA 3J7Yp 2V87A 1BBGA 1DQ3A 1KYQA 3F6HA 1YYOA 2MC6A 3EPJA 2KOUA 3KWRA 4BHBA 1FKAE 4JI0E 3IWCA 5DNYA 2VRDA 1ZU1A 5AC5A 2JPAA 2L2KB 2EM0A 3FIGA 2NUEA 1T4NA 1WRJA 2JYAA 4M30A 3MHHC 5A2QC 2EMAA 1NCSA 1RQ0A 2LJHA 1NEIA 4R2AA 2EPXA 1UBDC 2KHXA 4B3RE 2UXCE 5KL2A 1UHZA 1SR9A 1WXRA 2EOXA 4R2CA 1AAYA 3EPHA 1X48A 2VF1A 2MDRA 4DV1E 2WZOA 1HNXE 4R2EA 4ZYGA 4Q35B 3DJWA 3VHTB 2LMZA 2UU9E 1WHNA 4WSGA 2PRTA 1MEYC 3KZZA 1DGCA 1X6FA 3BF2A 2L2NA 4LFBE 4GKKE 5F3WA 1YSAC 2EOZA 4BCAA 3THOB 4NZVA 4TUIA 2A25A 2LT7A 1XMOE 4M2ZA 1J26A 2MC5A 1X47A 2L6MA 5IV8B 4RH8A 2YTPA 2DGCA 1A1GA 4DUYE 3ADIA 2YTFA 2EL5A 1ZBTA 2ODRD 4M0VA 1T4OA 4P7DA 2RS6A 1EKZA 4K0KE 4DR4E 2EM2A 4JI6E 1BBOA 1PJSA 2WBSA 2V86A 2CSHA 5KL7A 2GLIA 4X9JA 2IHR1 2M1SA 4NXME 4X66E 1DI2A 2EM5A 2B3TB 4R2DA 3BGHA 4B3ME 1MGTA 1IBLE 4JI2E 2EPKX 3C6KA 3OTOE 2V83A 5KL3A 2CT1A 2YT4A 5TSEA 2DMIA 2EN7A 2YSOA 2BB8A 4LF7E 2JWOA 2DRPA 5LMNE 1YFHA 1T38A 2YSPA 4OOGC 4LF8E 2LCEA 3LMLA 1B69A 2YTIA 1A1IA 4I8OA 1HNWE 5LMUE 2JY9A 2R76A 4BC7A 3VYXA 4HEIA 2EMGA 1TN9A 4P78A 3C4TA 3T1HE 2B9DA 2HJJA 1ZR9A 3IWBA 3ADJA 2LE2A 2VQEE 2EMBA 3JU0A 1N36E 2HGHA 2K4VA 2F4VE 2EMYA 2EOQA 2EMXA 2DLQA 4GKJE 5BR8E 2EL6A 3HTXA 2EPZA 4R2SA 1A1JA 3KZYA 2B7VA 4F9AB 2EPCA 2YTDA 2FV4B 4TUGA 1AH5A 1HNZE 2EOJA 4R2PA 2Q8UA 1SFEA 1T4LB 4O4KA 5A6AA 3K6QA 4JI4E 5AASA 4NHRA 2JOXA 1X5WA 2EQ0A 4O5GA 2LO3A 2M9AA 2EN2A 4ZYEA 2N8XA 5IT9C 4X64E 2EPUA 2ELZA 2LUQA 2EOHA 1EH8A 2EN6A 3J80C 3JAMC 5T6JA 5ADZA 2D9HA 2YTGA 2EOSA 3EPKA 5A6KA 1TF6A 2MDGA 3L00A 3ECRA 2L3JA 4DR1E 4YY3E 2EPLX 2GHFA 4X65E 1KJKA 2NUFA 2F8BA 1RMDA 1P47A 3P1XA 4AQYE 3EQ1A 2DLKA 4WXCA 5AE3A 2JOBA 5FLXC 1IQOA 4DV5E 2YU5A 4JV5E 5AC4A 1GTKA 4DV7E 4DUZE 2M7QA 4B3TE 5A6JA 2WBTA 5A69A 2WCC3 1A1HA 2FGGA 4DKKA 4DV6E 2ENHA 1IBKE 4F9BB 2G7HA 4DR3E 2DB2A 2EQ1A 1X3CA 3UK3C 4JI3E 4LTYA 4GZNC 2EM8A 2EZ6A 4BS9A 4WSPA 2ELYA 3BIDA 4MLQA 1QNTA 2CTDA 2EM9A 2EE8A 4R03A 5KL4A 2EOEA 4F2JC 4RHBB 2EORA 4ZYHA 2RS7A 2EM7A 4NXNE 2EWLA 3MHSC 2LJUA 1JK2A 2EN8A 4LFCE 1IQSA 2R1FA 3VK6A 3HQ1A 4ZYDA 2GPIA 2YRHA 4M9VC 1N3GA 2EOYA 4DV0E 2LTSA 4WPYA 4DV3E 4BMJA 2V89A 2BBGA 2RSIA 2RTXA 2EMIA 2EOOA 2ENCA 2EJ4A 2YTQA 2JP9A 1N34E 2ENAA 4WYQB 5AE1A 1A1LA 1F2IG 2UXBE 1O0WA 2YTOA 2HC5A 3TQMA 2H36X 5KL6A 2YPNA 4R2QA 1I94E 2EMCA 4LF4E 2ODRC 4GEQB 1RC7A 4DR6E 2YWQA 1HR0E 2UUAE 2EMHA 2EQ3A 2ZM6E 4R2RA 3HPSA 4B3SE 3JTZA 1IBME 3HXLA 3THNA 2DSYA 5AE2A 1A1FA 4DMIA 4JI5E 1YUJA 5KL5A 2EMKA 2V85A 5A6BA 1X6EA 4F6NA 2EOMA 4LF9E 4L5NC 2LBSB 2HHHE 1EH7A 2E5LE 2LUPB 3J7AG 2E72A 3LLHA 4L8NA 1UN6B 4X8WA 2EN3A 2EM4A 3MSWA 2EMLA 1XMQE 4LU9A 4O24A 2EM3A
chains in the Genus database with same CATH topology
4R2DA 2EL4A 2YU8A 2YU5A 2I13A 2EMZA 2EN1A 1YUIA 2WBTA 5KL3A 2WCC3 1A1HA 1ZAAC 2CT1A 1X6HA 2ENHA 1G2FC 2EN4A 2DMIA 2EPRA 2EN7A 2EQ1A 2YSOA 2BB8A 1X3CA 1G2DC 2DRPA 1WJPA 3UK3C 3EPJA 2YSPA 4GZNC 2EM8A 2LCEA 4IS1C 1B69A 2ELYA 2YTIA 1A1IA 2EM9A 2CTDA 2EE8A 5KL4A 2EOEA 4F2JC 2VRDA 1A1KA 1ZU1A 2YRMA 1Z1BA 2JPAA 2EM0A 2EORA 2EM7A 3EPLA 3MHHC 2EMGA 2J7JA 3MHSC 1TN9A 2EMAA 1JK2A 1NCSA 2EN8A 2YTJA 4R2AA 1ZR9A 2EMFA 2EPXA 2R1FA 1UBDC 1JK1A 2EMBA 2YTEA 5KL2A 2EOXA 4M9VC 2YRHA 2EOYA 1TF3A 4R2CA 1AAYA 3EPHA 2HGHA 2EMYA 4R2EA 2RSIA 2EOQA 2EMIA 2DLQA 2EOOA 2EMXA 2RPCA 2MKDA 4F6MA 3VHTB 2ENCA 2EL6A 2EJ4A 2YTQA 2JP9A 2EPZA 2ENAA 4WSGA 2EMWA 4R2SA 3M99B 1A1LA 1A1JA 1F2IG 2YRKA 2PRTA 2EPCA 2YTDA 2YTOA 5KL6A 4R2QA 1MEYC 1DGCA 1X6FA 2EMCA 2EOIA 2EOJA 4R2PA 2EP3A 2YTNA 1YSAC 2EOZA 2EMHA 2A25A 2EQ3A 1X5WA 4R2RA 2EQ0A 2LT7A 2LO3A 2LV2A 2ADRA 2M9AA 4IJDA 2EN2A 2EPPA 1A1FA 2YTPA 2NABA 2DGCA 2EPUA 1A1GA 1YUJA 2ELZA 2YTFA 5KL5A 2EL5A 2EMKA 2EOHA 2EN6A 1X6EA 4F6NA 2LVHA 2D9HA 2YTGA 2EOSA 3EPKA 2EM6A 2EOFA 1TF6A 2MDGA 2EM2A 1BB8A 2E72A 1BBOA 2EPAA 2GHFA 1UN6B 1KJKA 2WBSA 2CSHA 5KL7A 1RMDA 2EN3A 2GLIA 2EM4A 1P47A 4FK5C 2EMLA 2MKNA 1LLMC 2DLKA 4X9JA 2WBUA 2EOMA 2EM3A 2EM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R2D A;  2EL4 A;  2YU8 A;  2YU5 A;  2I13 A;  2EMZ A;  2EN1 A;  1YUI A;  2WBT A;  5KL3 A;  2WCC 3;  1A1H A;  1ZAA C;  2CT1 A;  1X6H A;  2ENH A;  1G2F C;  2EN4 A;  2DMI A;  2EPR A;  2EN7 A;  2EQ1 A;  2YSO A;  2BB8 A;  1X3C A;  1G2D C;  2DRP A;  1WJP A;  3UK3 C;  3EPJ A;  2YSP A;  4GZN C;  2EM8 A;  2LCE A;  4IS1 C;  1B69 A;  2ELY A;  2YTI A;  1A1I A;  2EM9 A;  2CTD A;  2EE8 A;  5KL4 A;  2EOE A;  4F2J C;  2VRD A;  1A1K A;  1ZU1 A;  2YRM A;  1Z1B A;  2JPA A;  2EM0 A;  2EOR A;  2EM7 A;  3EPL A;  3MHH C;  2EMG A;  2J7J A;  3MHS C;  1TN9 A;  2EMA A;  1JK2 A;  1NCS A;  2EN8 A;  2YTJ A;  4R2A A;  1ZR9 A;  2EMF A;  2EPX A;  2R1F A;  1UBD C;  1JK1 A;  2EMB A;  2YTE A;  5KL2 A;  2EOX A;  4M9V C;  2YRH A;  2EOY A;  1TF3 A;  4R2C A;  1AAY A;  3EPH A;  2HGH A;  2EMY A;  4R2E A;  2RSI A;  2EOQ A;  2EMI A;  2DLQ A;  2EOO A;  2EMX A;  2RPC A;  2MKD A;  4F6M A;  3VHT B;  2ENC A;  2EL6 A;  2EJ4 A;  2YTQ A;  2JP9 A;  2EPZ A;  2ENA A;  4WSG A;  2EMW A;  4R2S A;  3M99 B;  1A1L A;  1A1J A;  1F2I G;  2YRK A;  2PRT A;  2EPC A;  2YTD A;  2YTO A;  5KL6 A;  4R2Q A;  1MEY C;  1DGC A;  1X6F A;  2EMC A;  2EOI A;  2EOJ A;  4R2P A;  2EP3 A;  2YTN A;  1YSA C;  2EOZ A;  2EMH A;  2A25 A;  2EQ3 A;  1X5W A;  4R2R A;  2EQ0 A;  2LT7 A;  2LO3 A;  2LV2 A;  2ADR A;  2M9A A;  4IJD A;  2EN2 A;  2EPP A;  1A1F A;  2YTP A;  2NAB A;  2DGC A;  2EPU A;  1A1G A;  1YUJ A;  2ELZ A;  2YTF A;  5KL5 A;  2EL5 A;  2EMK A;  2EOH A;  2EN6 A;  1X6E A;  4F6N A;  2LVH A;  2D9H A;  2YTG A;  2EOS A;  3EPK A;  2EM6 A;  2EOF A;  1TF6 A;  2MDG A;  2EM2 A;  1BB8 A;  2E72 A;  1BBO A;  2EPA A;  2GHF A;  1UN6 B;  1KJK A;  2WBS A;  2CSH A;  5KL7 A;  1RMD A;  2EN3 A;  2GLI A;  2EM4 A;  1P47 A;  4FK5 C;  2EML A;  2MKN A;  1LLM C;  2DLK A;  4X9J A;  2WBU A;  2EOM A;  2EM3 A;  2EM5 A; 
#chains in the Genus database with same CATH topology
 5LL6 R;  2EL4 A;  2YU8 A;  2I13 A;  4LF5 E;  2NUG A;  4R8O A;  1YUI A;  4JI8 E;  1ZAA C;  2L33 A;  1T39 A;  5IXM B;  2JXP A;  3DF6 A;  4DR7 E;  1X6H A;  3ADL A;  4WFT A;  2EPR A;  1ZBQ A;  1STU A;  1G2D C;  2EPM X;  1WJP A;  1EH6 A;  4O43 A;  4J8Z A;  1FJG E;  2NA2 A;  4IS1 C;  3J81 C;  1PJT A;  2I9I A;  2RSM A;  1UIL A;  4YHH E;  3F6G A;  1A1K A;  2YRM A;  1Z1B A;  4DV2 E;  3EPL A;  1QU6 A;  3AV0 A;  3QG5 C;  2J7J A;  2EPO A;  2K7I A;  1J5E E;  5CFF E;  2YTJ A;  3IWD A;  4OX9 E;  2EMF A;  2V8Q B;  1XNQ E;  1JK1 A;  2YTE A;  1YYK A;  4Q28 A;  1PKP A;  1TF3 A;  2RPC A;  4F6M A;  3VYY A;  1X49 A;  2MKD A;  1XNR E;  1N33 E;  1YPN A;  2VE7 C;  4HTG A;  5A6B D;  2EMW A;  2L2M A;  3BBG A;  4KWY A;  3M99 B;  3RMP A;  4DV4 E;  2YRK A;  4KZS A;  1L4S A;  4JYA E;  2EOI A;  1YYW A;  5IWA E;  4DR5 E;  1YZ9 A;  2B7T A;  2DMY A;  2EP3 A;  2YTN A;  4KHP E;  2UUB E;  2EPN A;  2VQF E;  2LV2 A;  2L3C A;  2KON A;  2ADR A;  4IJD A;  3H09 A;  2EPP A;  3ADG A;  4WXD A;  2NAB A;  4F9C B;  1GZ6 A;  2LTR A;  5LLQ A;  2UUC E;  3T1Y E;  1N32 E;  2LVH A;  2L92 A;  2N3G A;  2DIX A;  4BHC A;  2EM6 A;  2EOF A;  3ZOQ B;  4X62 E;  1BB8 A;  2CPN A;  2E1M A;  2EPA A;  4WX9 A;  4N4R B;  4F54 A;  4JI1 E;  3OML A;  4BC9 A;  4FK5 C;  3AUZ A;  1GQE A;  2FTX B;  2JR1 A;  2LRS A;  1LLM C;  2MKN A;  4LFA E;  2WBU A;  4JI7 E;  1PDA A;  2N3H A;  3C4B A;  3C6M A;  2JVA A;  4LF6 E;  2YZT A;  1PJQ A;  2EMZ A;  2RQL A;  2EN1 A;  2M4I A;  4MLV A;  4DR2 E;  1WHQ A;  2UXD E;  2L8T A;  4BBY A;  2V88 A;  3HPZ A;  1G2F C;  2EN4 A;  1IMU A;  3J7Y p;  2V87 A;  1BBG A;  1DQ3 A;  1KYQ A;  3F6H A;  1YYO A;  2MC6 A;  3EPJ A;  2KOU A;  3KWR A;  4BHB A;  1FKA E;  4JI0 E;  3IWC A;  5DNY A;  2VRD A;  1ZU1 A;  5AC5 A;  2JPA A;  2L2K B;  2EM0 A;  3FIG A;  2NUE A;  1T4N A;  1WRJ A;  2JYA A;  4M30 A;  3MHH C;  5A2Q C;  2EMA A;  1NCS A;  1RQ0 A;  2LJH A;  1NEI A;  4R2A A;  2EPX A;  1UBD C;  2KHX A;  4B3R E;  2UXC E;  5KL2 A;  1UHZ A;  1SR9 A;  1WXR A;  2EOX A;  4R2C A;  1AAY A;  3EPH A;  1X48 A;  2VF1 A;  2MDR A;  4DV1 E;  2WZO A;  1HNX E;  4R2E A;  4ZYG A;  4Q35 B;  3DJW A;  3VHT B;  2LMZ A;  2UU9 E;  1WHN A;  4WSG A;  2PRT A;  1MEY C;  3KZZ A;  1DGC A;  1X6F A;  3BF2 A;  2L2N A;  4LFB E;  4GKK E;  5F3W A;  1YSA C;  2EOZ A;  4BCA A;  3THO B;  4NZV A;  4TUI A;  2A25 A;  2LT7 A;  1XMO E;  4M2Z A;  1J26 A;  2MC5 A;  1X47 A;  2L6M A;  5IV8 B;  4RH8 A;  2YTP A;  2DGC A;  1A1G A;  4DUY E;  3ADI A;  2YTF A;  2EL5 A;  1ZBT A;  2ODR D;  4M0V A;  1T4O A;  4P7D A;  2RS6 A;  1EKZ A;  4K0K E;  4DR4 E;  2EM2 A;  4JI6 E;  1BBO A;  1PJS A;  2WBS A;  2V86 A;  2CSH A;  5KL7 A;  2GLI A;  4X9J A;  2IHR 1;  2M1S A;  4NXM E;  4X66 E;  1DI2 A;  2EM5 A;  2B3T B;  4R2D A;  3BGH A;  4B3M E;  1MGT A;  1IBL E;  4JI2 E;  2EPK X;  3C6K A;  3OTO E;  2V83 A;  5KL3 A;  2CT1 A;  2YT4 A;  5TSE A;  2DMI A;  2EN7 A;  2YSO A;  2BB8 A;  4LF7 E;  2JWO A;  2DRP A;  5LMN E;  1YFH A;  1T38 A;  2YSP A;  4OOG C;  4LF8 E;  2LCE A;  3LML A;  1B69 A;  2YTI A;  1A1I A;  4I8O A;  1HNW E;  5LMU E;  2JY9 A;  2R76 A;  4BC7 A;  3VYX A;  4HEI A;  2EMG A;  1TN9 A;  4P78 A;  3C4T A;  3T1H E;  2B9D A;  2HJJ A;  1ZR9 A;  3IWB A;  3ADJ A;  2LE2 A;  2VQE E;  2EMB A;  3JU0 A;  1N36 E;  2HGH A;  2K4V A;  2F4V E;  2EMY A;  2EOQ A;  2EMX A;  2DLQ A;  4GKJ E;  5BR8 E;  2EL6 A;  3HTX A;  2EPZ A;  4R2S A;  1A1J A;  3KZY A;  2B7V A;  4F9A B;  2EPC A;  2YTD A;  2FV4 B;  4TUG A;  1AH5 A;  1HNZ E;  2EOJ A;  4R2P A;  2Q8U A;  1SFE A;  1T4L B;  4O4K A;  5A6A A;  3K6Q A;  4JI4 E;  5AAS A;  4NHR A;  2JOX A;  1X5W A;  2EQ0 A;  4O5G A;  2LO3 A;  2M9A A;  2EN2 A;  4ZYE A;  2N8X A;  5IT9 C;  4X64 E;  2EPU A;  2ELZ A;  2LUQ A;  2EOH A;  1EH8 A;  2EN6 A;  3J80 C;  3JAM C;  5T6J A;  5ADZ A;  2D9H A;  2YTG A;  2EOS A;  3EPK A;  5A6K A;  1TF6 A;  2MDG A;  3L00 A;  3ECR A;  2L3J A;  4DR1 E;  4YY3 E;  2EPL X;  2GHF A;  4X65 E;  1KJK A;  2NUF A;  2F8B A;  1RMD A;  1P47 A;  3P1X A;  4AQY E;  3EQ1 A;  2DLK A;  4WXC A;  5AE3 A;  2JOB A;  5FLX C;  1IQO A;  4DV5 E;  2YU5 A;  4JV5 E;  5AC4 A;  1GTK A;  4DV7 E;  4DUZ E;  2M7Q A;  4B3T E;  5A6J A;  2WBT A;  5A69 A;  2WCC 3;  1A1H A;  2FGG A;  4DKK A;  4DV6 E;  2ENH A;  1IBK E;  4F9B B;  2G7H A;  4DR3 E;  2DB2 A;  2EQ1 A;  1X3C A;  3UK3 C;  4JI3 E;  4LTY A;  4GZN C;  2EM8 A;  2EZ6 A;  4BS9 A;  4WSP A;  2ELY A;  3BID A;  4MLQ A;  1QNT A;  2CTD A;  2EM9 A;  2EE8 A;  4R03 A;  5KL4 A;  2EOE A;  4F2J C;  4RHB B;  2EOR A;  4ZYH A;  2RS7 A;  2EM7 A;  4NXN E;  2EWL A;  3MHS C;  2LJU A;  1JK2 A;  2EN8 A;  4LFC E;  1IQS A;  2R1F A;  3VK6 A;  3HQ1 A;  4ZYD A;  2GPI A;  2YRH A;  4M9V C;  1N3G A;  2EOY A;  4DV0 E;  2LTS A;  4WPY A;  4DV3 E;  4BMJ A;  2V89 A;  2BBG A;  2RSI A;  2RTX A;  2EMI A;  2EOO A;  2ENC A;  2EJ4 A;  2YTQ A;  2JP9 A;  1N34 E;  2ENA A;  4WYQ B;  5AE1 A;  1A1L A;  1F2I G;  2UXB E;  1O0W A;  2YTO A;  2HC5 A;  3TQM A;  2H36 X;  5KL6 A;  2YPN A;  4R2Q A;  1I94 E;  2EMC A;  4LF4 E;  2ODR C;  4GEQ B;  1RC7 A;  4DR6 E;  2YWQ A;  1HR0 E;  2UUA E;  2EMH A;  2EQ3 A;  2ZM6 E;  4R2R A;  3HPS A;  4B3S E;  3JTZ A;  1IBM E;  3HXL A;  3THN A;  2DSY A;  5AE2 A;  1A1F A;  4DMI A;  4JI5 E;  1YUJ A;  5KL5 A;  2EMK A;  2V85 A;  5A6B A;  1X6E A;  4F6N A;  2EOM A;  4LF9 E;  4L5N C;  2LBS B;  2HHH E;  1EH7 A;  2E5L E;  2LUP B;  3J7A G;  2E72 A;  3LLH A;  4L8N A;  1UN6 B;  4X8W A;  2EN3 A;  2EM4 A;  3MSW A;  2EML A;  1XMQ E;  4LU9 A;  4O24 A;  2EM3 A; 
#chains in the Genus database with same CATH homology
 4R2D A;  2EL4 A;  2YU8 A;  2YU5 A;  2I13 A;  2EMZ A;  2EN1 A;  1YUI A;  2WBT A;  5KL3 A;  2WCC 3;  1A1H A;  1ZAA C;  2CT1 A;  1X6H A;  2ENH A;  1G2F C;  2EN4 A;  2DMI A;  2EPR A;  2EN7 A;  2EQ1 A;  2YSO A;  2BB8 A;  1X3C A;  1G2D C;  2DRP A;  1WJP A;  3UK3 C;  3EPJ A;  2YSP A;  4GZN C;  2EM8 A;  2LCE A;  4IS1 C;  1B69 A;  2ELY A;  2YTI A;  1A1I A;  2EM9 A;  2CTD A;  2EE8 A;  5KL4 A;  2EOE A;  4F2J C;  2VRD A;  1A1K A;  1ZU1 A;  2YRM A;  1Z1B A;  2JPA A;  2EM0 A;  2EOR A;  2EM7 A;  3EPL A;  3MHH C;  2EMG A;  2J7J A;  3MHS C;  1TN9 A;  2EMA A;  1JK2 A;  1NCS A;  2EN8 A;  2YTJ A;  4R2A A;  1ZR9 A;  2EMF A;  2EPX A;  2R1F A;  1UBD C;  1JK1 A;  2EMB A;  2YTE A;  5KL2 A;  2EOX A;  4M9V C;  2YRH A;  2EOY A;  1TF3 A;  4R2C A;  1AAY A;  3EPH A;  2HGH A;  2EMY A;  4R2E A;  2RSI A;  2EOQ A;  2EMI A;  2DLQ A;  2EOO A;  2EMX A;  2RPC A;  2MKD A;  4F6M A;  3VHT B;  2ENC A;  2EL6 A;  2EJ4 A;  2YTQ A;  2JP9 A;  2EPZ A;  2ENA A;  4WSG A;  2EMW A;  4R2S A;  3M99 B;  1A1L A;  1A1J A;  1F2I G;  2YRK A;  2PRT A;  2EPC A;  2YTD A;  2YTO A;  5KL6 A;  4R2Q A;  1MEY C;  1DGC A;  1X6F A;  2EMC A;  2EOI A;  2EOJ A;  4R2P A;  2EP3 A;  2YTN A;  1YSA C;  2EOZ A;  2EMH A;  2A25 A;  2EQ3 A;  1X5W A;  4R2R A;  2EQ0 A;  2LT7 A;  2LO3 A;  2LV2 A;  2ADR A;  2M9A A;  4IJD A;  2EN2 A;  2EPP A;  1A1F A;  2YTP A;  2NAB A;  2DGC A;  2EPU A;  1A1G A;  1YUJ A;  2ELZ A;  2YTF A;  5KL5 A;  2EL5 A;  2EMK A;  2EOH A;  2EN6 A;  1X6E A;  4F6N A;  2LVH A;  2D9H A;  2YTG A;  2EOS A;  3EPK A;  2EM6 A;  2EOF A;  1TF6 A;  2MDG A;  2EM2 A;  1BB8 A;  2E72 A;  1BBO A;  2EPA A;  2GHF A;  1UN6 B;  1KJK A;  2WBS A;  2CSH A;  5KL7 A;  1RMD A;  2EN3 A;  2GLI A;  2EM4 A;  1P47 A;  4FK5 C;  2EML A;  2MKN A;  1LLM C;  2DLK A;  4X9J A;  2WBU A;  2EOM A;  2EM3 A;  2EM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...