5KL7A

Wilms tumor protein (wt1) znf2-4q369r in complex with carboxylated dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
87
structure length
87
Chain Sequence
EKPYQCDFKDCERRFSRSDRLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Denys-Drash syndrome associated WT1 glutamine 369 mutants have altered sequence-preferences and altered responses to epigenetic modifications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords Wilms tumor protein
total genus 29
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2016-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 5kl7A00
2EPXA 2EOSA 1JK1A 2EN3A 4R2PA 2A25A 2VRDA 2HGHA 2ELZA 2EMFA 2YRMA 2J7JA 2WBTA 2EMGA 2EOEA 2EMKA 2EMAA 2EE8A 5KL3A 2EJ4A 2ELYA 1ZAAC 2EOYA 2EOHA 2R1FA 2YTDA 2EL6A 2EN1A 4M9VC 2EM9A 3EPJA 2EMHA 1A1HA 5KL7A 1YUJA 4R2RA 2YU8A 1MEYC 2CT1A 4R2AA 2EM6A 1A1LA 2EM5A 2EL5A 2WBUA 2EM0A 2EMCA 2EP3A 2EN2A 2MDGA 4R2EA 2EMZA 1X6EA 2EPZA 2EOFA 2LO3A 2RSIA 4WSGA 2EOJA 2EOMA 1JK2A 2MKNA 2GLIA 2DLKA 5KL2A 4X9JA 2PRTA 2EN8A 2EMIA 3MHHC 2EQ3A 2EMYA 1BB8A 1X5WA 2GHFA 2LCEA 1TN9A 2YRKA 3M99B 2YTGA 2YRHA 3VHTB 2EL4A 2YTEA 1A1JA 1ZR9A 2NABA 4GZNC 2EN6A 1KJKA 2YU5A 2EPPA 2JP9A 4R2SA 3EPLA 2M9AA 2YTIA 3EPKA 2DGCA 1X3CA 1P47A 2DRPA 2EN7A 1TF3A 2EN4A 4F6MA 1F2IG 2WCC3 2EOZA 2I13A 1YSAC 2EQ1A 1NCSA 2ADRA 1A1GA 2EQ0A 5KL4A 2YTFA 4F6NA 2EM4A 2YSPA 2EPAA 3UK3C 2WBSA 2EOIA 2EMBA 2RPCA 2EMLA 1A1IA 4IJDA 2D9HA 2LVHA 3MHSC 2YTJA 1A1FA 1YUIA 2LT7A 2YTOA 1G2DC 1UBDC 4F2JC 1WJPA 2ENAA 2EPRA 2DMIA 2EM2A 2EM7A 4R2CA 1BBOA 2CSHA 2MKDA 2DLQA 1X6HA 2EPUA 2YTQA 1LLMC 1G2FC 4R2QA 2EM3A 2EMWA 1ZU1A 4R2DA 1B69A 1AAYA 3EPHA 2ENHA 2JPAA 1TF6A 2EM8A 2YSOA 2BB8A 5KL5A 1X6FA 2LV2A 1Z1BA 2E72A 2YTNA 2CTDA 2EOQA 2EORA 4IS1C 2EPCA 5KL6A 1A1KA 2ENCA 2YTPA 2EOXA 2EMXA 1RMDA 1UN6B 1DGCA 2EOOA 4FK5C
chains in the Genus database with same CATH superfamily
2EPXA 4YY3E 1IQOA 2VE7C 2VRDA 5LLQA 3DJWA 2YRMA 3HPSA 2L33A 4DV3E 4X64E 4DR5E 2EMKA 4WFTA 4B3TE 4JI6E 4O4KA 1ZAAC 4N4RB 1PJSA 2YTDA 1AH5A 4LF7E 2M1SA 1A1HA 1IBLE 1XNRE 4LFCE 3HPZA 1I94E 1J5EE 3VK6A 1YUJA 1QU6A 2EPKX 1X47A 4R2RA 2JYAA 1GQEA 4R2AA 5A6AA 2EM6A 1PKPA 4P78A 2LMZA 2EMCA 3FIGA 2MDGA 3J81C 4R03A 2G7HA 4DR4E 4DV5E 4WSGA 2EOMA 2GLIA 2DLKA 4LF8E 3JTZA 3C4BA 2F4VE 2EPMX 4F9AB 1HNXE 5ADZA 4GKJE 5IV8B 3EPLA 2YTIA 1X3CA 5BR8E 2WCC3 2JOXA 2GPIA 1YYKA 2L6MA 2ADRA 1YFHA 4NZVA 2RPCA 4LF9E 2EMLA 4KHPE 2HHHE 1A1FA 1YUIA 1T4LB 2ZM6E 2EPRA 2DMIA 4R2CA 2VF1A 4BC9A 2MKDA 2YTQA 4HEIA 1G2FC 4R2QA 2EM3A 2L8TA 4JI7E 1AAYA 2EPOA 3ZOQB 4BCAA 3IWCA 4ZYEA 1EKZA 2JPAA 1TF6A 2UXBE 1ZBQA 3L00A 2YTNA 2NUFA 2EOQA 2EORA 4WPYA 4DUYE 4DR3E 1A1KA 2YTPA 4LTYA 4LF4E 2EOXA 2L2KB 4Q35B 4O5GA 4JI8E 3J7Yp 2EN3A 2LUQA 4R2PA 2HGHA 2JVAA 3TQMA 2ELZA 4DMIA 3THNA 5CFFE 2RS6A 1N34E 2RS7A 2WBTA 2E1MA 4B3ME 2MC5A 4L5NC 2ELYA 2EWLA 4BS9A 2EOHA 4X66E 2EN1A 1N32E 1N3GA 2L2MA 4M9VC 3EPJA 4LF5E 4F9CB 3LMLA 5A6JA 3EQ1A 4DV6E 5LL6R 2YPNA 1GZ6A 4R8OA 4P7DA 2HJJA 4R2EA 2EMZA 2EPZA 1JK2A 1HNWE 2EOJA 3BIDA 4DR7E 4X9JA 2PRTA 2JY9A 2EMIA 2JXPA 2EMYA 2GHFA 2CPNA 2FV4B 1YPNA 2LCEA 1L4SA 3M99B 1SFEA 3C4TA 3VHTB 2YTEA 2YT4A 4BC7A 4M30A 4TUGA 3EPKA 1XMOE 2DGCA 1P47A 5A69A 3ADLA 2DB2A 1IBKE 1QNTA 1F2IG 5AE3A 4BHCA 1WXRA 1T38A 2EQ1A 5AE2A 4WXCA 4L8NA 4LU9A 4DV4E 2EPAA 4JI2E 3JU0A 2WBSA 2EOIA 3ADIA 2IHR1 3MSWA 2E5LE 2K4VA 1HR0E 4X65E 2YTJA 5FLXC 2RTXA 2LT7A 2V8QB 4JI4E 1YYOA 1WJPA 4LFAE 2NA2A 3H09A 1RQ0A 2EM7A 2UXCE 2RQLA 1UHZA 1LLMC 1X49A 2EMWA 1ZU1A 4R2DA 1B69A 1DQ3A 2EM8A 2YSOA 3VYYA 1Z1BA 1KYQA 2DIXA 1O0WA 1EH6A 2EPCA 5KL6A 4BHBA 2ENCA 4WSPA 4ZYGA 1UN6B 2VQEE 1EH8A 2ODRD 2BBGA 2FGGA 4FK5C 4K0KE 2EOSA 3IWBA 2A25A 3HQ1A 4DV1E 4DV7E 5LMUE 1XMQE 2V83A 4DV0E 2V89A 3THOB 2NUGA 5AC5A 2EMAA 2EJ4A 2V88A 3HXLA 3F6GA 4MLQA 3T1YE 4WXDA 1RC7A 4NXME 2EOYA 2FTXB 1YZ9A 2EMHA 5KL7A 2LBSB 4ZYHA 3AUZA 5IXMB 1WHNA 4DV2E 1DI2A 2DMYA 2CT1A 3ADJA 1FJGE 2V87A 4BBYA 3VYXA 1A1LA 2EM5A 2EL5A 2EM0A 5LMNE 2I9IA 1PJTA 4O43A 3LLHA 1X6EA 4B3SE 2LO3A 2KHXA 1T39A 2M7QA 1N36E 2WZOA 5A6BD 2EN8A 2L3JA 3MHHC 1BB8A 3KWRA 1TN9A 2YRKA 2YTGA 2EL4A 1A1JA 5A2QC 2L2NA 2NABA 2JR1A 2EN6A 2RSMA 2JP9A 5DNYA 2M9AA 4BMJA 3KZZA 2DRPA 2EN7A 1IBME 3QG5C 2N3GA 2N8XA 1YSAC 1NCSA 5KL4A 3HTXA 2H36X 2F8BA 4F6NA 2YSPA 4TUIA 2LJUA 2EMBA 3OMLA 2MC6A 3DF6A 1A1IA 2R76A 2KOUA 2Q8UA 2YZTA 1G2DC 4O24A 3JAMC 4MLVA 4RH8A 2CSHA 4OOGC 2DLQA 5TSEA 2JWOA 2EPUA 2EPLX 4YHHE 1PDAA 3EPHA 1IMUA 2MDRA 1FKAE 3BBGA 2UXDE 2B7VA 5KL5A 2BB8A 1X6FA 2LV2A 2V85A 2E72A 1T4NA 3BGHA 4JI3E 3J80C 2EMXA 1RMDA 2ODRC 4RHBB 2UUCE 2EOOA 1ZBTA 4JI0E 1JK1A 1NEIA 3T1HE 1N33E 1X48A 5AC4A 4B3RE 3C6MA 4GEQB 2VQFE 2EMFA 4HTGA 2J7JA 2EMGA 4F54A 5A6BA 4DKKA 2DSYA 2EOEA 1GTKA 4AQYE 1SR9A 2EE8A 5KL3A 2UUAE 1UILA 2UU9E 3AV0A 2R1FA 2EL6A 4JI5E 2B9DA 2EM9A 4JV5E 2EZ6A 2UUBE 1PJQA 2NUEA 2YU8A 2M4IA 4JI1E 1MEYC 1XNQE 4JYAE 3C6KA 1EH7A 2LRSA 2WBUA 2LJHA 4Q28A 2EP3A 1BBGA 2EN2A 2N3HA 2YWQA 3F6HA 4M0VA 1J26A 3KZYA 2LE2A 4X8WA 2RSIA 2EOFA 2MKNA 1WHQA 5KL2A 4KWYA 5F3WA 2EQ3A 5IWAE 1X5WA 1IQSA 2KONA 2YRHA 4NHRA 4M2ZA 2L92A 4WX9A 4X62E 1STUA 1WRJA 1ZR9A 4GZNC 3ADGA 2K7IA 2YU5A 2EPPA 4F9BB 2HC5A 4R2SA 4LFBE 1KJKA 4OX9E 3K6QA 1TF3A 1MGTA 2EN4A 4F6MA 1HNZE 2B7TA 2LTSA 2EOZA 2I13A 5AE1A 4DUZE 3J7AG 1A1GA 2EQ0A 4ZYDA 2LTRA 2EPNA 2YTFA 2EM4A 3UK3C 2B3TB 3ECRA 4NXNE 5AASA 4IJDA 2D9HA 1T4OA 2LVHA 2LUPB 3MHSC 4GKKE 2YTOA 5A6KA 1UBDC 4F2JC 1YYWA 2ENAA 2EM2A 2V86A 1BBOA 2JOBA 1X6HA 3BF2A 4DR2E 4DR1E 2ENHA 4KZSA 3P1XA 5T6JA 4DR6E 4LF6E 4J8ZA 4WYQB 5IT9C 2CTDA 3OTOE 4IS1C 2L3CA 3RMPA 1DGCA 4I8OA 3IWDA
chains in the Genus database with same CATH topology
2EPXA 2EOSA 1JK1A 2EN3A 4R2PA 2A25A 2VRDA 2HGHA 2ELZA 2EMFA 2YRMA 2J7JA 2WBTA 2EMGA 2EOEA 2EMKA 2EMAA 2EE8A 5KL3A 2EJ4A 2ELYA 1ZAAC 2EOYA 2EOHA 2R1FA 2YTDA 2EL6A 2EN1A 4M9VC 2EM9A 3EPJA 2EMHA 1A1HA 5KL7A 1YUJA 4R2RA 2YU8A 1MEYC 2CT1A 4R2AA 2EM6A 1A1LA 2EM5A 2EL5A 2WBUA 2EM0A 2EMCA 2EP3A 2EN2A 2MDGA 4R2EA 2EMZA 1X6EA 2EPZA 2EOFA 2LO3A 2RSIA 4WSGA 2EOJA 2EOMA 1JK2A 2MKNA 2GLIA 2DLKA 5KL2A 4X9JA 2PRTA 2EN8A 2EMIA 3MHHC 2EQ3A 2EMYA 1BB8A 1X5WA 2GHFA 2LCEA 1TN9A 2YRKA 3M99B 2YTGA 2YRHA 3VHTB 2EL4A 2YTEA 1A1JA 1ZR9A 2NABA 4GZNC 2EN6A 1KJKA 2YU5A 2EPPA 2JP9A 4R2SA 3EPLA 2M9AA 2YTIA 3EPKA 2DGCA 1X3CA 1P47A 2DRPA 2EN7A 1TF3A 2EN4A 4F6MA 1F2IG 2WCC3 2EOZA 2I13A 1YSAC 2EQ1A 1NCSA 2ADRA 1A1GA 2EQ0A 5KL4A 2YTFA 4F6NA 2EM4A 2YSPA 2EPAA 3UK3C 2WBSA 2EOIA 2EMBA 2RPCA 2EMLA 1A1IA 4IJDA 2D9HA 2LVHA 3MHSC 2YTJA 1A1FA 1YUIA 2LT7A 2YTOA 1G2DC 1UBDC 4F2JC 1WJPA 2ENAA 2EPRA 2DMIA 2EM2A 2EM7A 4R2CA 1BBOA 2CSHA 2MKDA 2DLQA 1X6HA 2EPUA 2YTQA 1LLMC 1G2FC 4R2QA 2EM3A 2EMWA 1ZU1A 4R2DA 1B69A 1AAYA 3EPHA 2ENHA 2JPAA 1TF6A 2EM8A 2YSOA 2BB8A 5KL5A 1X6FA 2LV2A 1Z1BA 2E72A 2YTNA 2CTDA 2EOQA 2EORA 4IS1C 2EPCA 5KL6A 1A1KA 2ENCA 2YTPA 2EOXA 2EMXA 1RMDA 1UN6B 1DGCA 2EOOA 4FK5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EPX A;  2EOS A;  1JK1 A;  2EN3 A;  4R2P A;  2A25 A;  2VRD A;  2HGH A;  2ELZ A;  2EMF A;  2YRM A;  2J7J A;  2WBT A;  2EMG A;  2EOE A;  2EMK A;  2EMA A;  2EE8 A;  5KL3 A;  2EJ4 A;  2ELY A;  1ZAA C;  2EOY A;  2EOH A;  2R1F A;  2YTD A;  2EL6 A;  2EN1 A;  4M9V C;  2EM9 A;  3EPJ A;  2EMH A;  1A1H A;  5KL7 A;  1YUJ A;  4R2R A;  2YU8 A;  1MEY C;  2CT1 A;  4R2A A;  2EM6 A;  1A1L A;  2EM5 A;  2EL5 A;  2WBU A;  2EM0 A;  2EMC A;  2EP3 A;  2EN2 A;  2MDG A;  4R2E A;  2EMZ A;  1X6E A;  2EPZ A;  2EOF A;  2LO3 A;  2RSI A;  4WSG A;  2EOJ A;  2EOM A;  1JK2 A;  2MKN A;  2GLI A;  2DLK A;  5KL2 A;  4X9J A;  2PRT A;  2EN8 A;  2EMI A;  3MHH C;  2EQ3 A;  2EMY A;  1BB8 A;  1X5W A;  2GHF A;  2LCE A;  1TN9 A;  2YRK A;  3M99 B;  2YTG A;  2YRH A;  3VHT B;  2EL4 A;  2YTE A;  1A1J A;  1ZR9 A;  2NAB A;  4GZN C;  2EN6 A;  1KJK A;  2YU5 A;  2EPP A;  2JP9 A;  4R2S A;  3EPL A;  2M9A A;  2YTI A;  3EPK A;  2DGC A;  1X3C A;  1P47 A;  2DRP A;  2EN7 A;  1TF3 A;  2EN4 A;  4F6M A;  1F2I G;  2WCC 3;  2EOZ A;  2I13 A;  1YSA C;  2EQ1 A;  1NCS A;  2ADR A;  1A1G A;  2EQ0 A;  5KL4 A;  2YTF A;  4F6N A;  2EM4 A;  2YSP A;  2EPA A;  3UK3 C;  2WBS A;  2EOI A;  2EMB A;  2RPC A;  2EML A;  1A1I A;  4IJD A;  2D9H A;  2LVH A;  3MHS C;  2YTJ A;  1A1F A;  1YUI A;  2LT7 A;  2YTO A;  1G2D C;  1UBD C;  4F2J C;  1WJP A;  2ENA A;  2EPR A;  2DMI A;  2EM2 A;  2EM7 A;  4R2C A;  1BBO A;  2CSH A;  2MKD A;  2DLQ A;  1X6H A;  2EPU A;  2YTQ A;  1LLM C;  1G2F C;  4R2Q A;  2EM3 A;  2EMW A;  1ZU1 A;  4R2D A;  1B69 A;  1AAY A;  3EPH A;  2ENH A;  2JPA A;  1TF6 A;  2EM8 A;  2YSO A;  2BB8 A;  5KL5 A;  1X6F A;  2LV2 A;  1Z1B A;  2E72 A;  2YTN A;  2CTD A;  2EOQ A;  2EOR A;  4IS1 C;  2EPC A;  5KL6 A;  1A1K A;  2ENC A;  2YTP A;  2EOX A;  2EMX A;  1RMD A;  1UN6 B;  1DGC A;  2EOO A;  4FK5 C; 
#chains in the Genus database with same CATH topology
 2EPX A;  4YY3 E;  1IQO A;  2VE7 C;  2VRD A;  5LLQ A;  3DJW A;  2YRM A;  3HPS A;  2L33 A;  4DV3 E;  4X64 E;  4DR5 E;  2EMK A;  4WFT A;  4B3T E;  4JI6 E;  4O4K A;  1ZAA C;  4N4R B;  1PJS A;  2YTD A;  1AH5 A;  4LF7 E;  2M1S A;  1A1H A;  1IBL E;  1XNR E;  4LFC E;  3HPZ A;  1I94 E;  1J5E E;  3VK6 A;  1YUJ A;  1QU6 A;  2EPK X;  1X47 A;  4R2R A;  2JYA A;  1GQE A;  4R2A A;  5A6A A;  2EM6 A;  1PKP A;  4P78 A;  2LMZ A;  2EMC A;  3FIG A;  2MDG A;  3J81 C;  4R03 A;  2G7H A;  4DR4 E;  4DV5 E;  4WSG A;  2EOM A;  2GLI A;  2DLK A;  4LF8 E;  3JTZ A;  3C4B A;  2F4V E;  2EPM X;  4F9A B;  1HNX E;  5ADZ A;  4GKJ E;  5IV8 B;  3EPL A;  2YTI A;  1X3C A;  5BR8 E;  2WCC 3;  2JOX A;  2GPI A;  1YYK A;  2L6M A;  2ADR A;  1YFH A;  4NZV A;  2RPC A;  4LF9 E;  2EML A;  4KHP E;  2HHH E;  1A1F A;  1YUI A;  1T4L B;  2ZM6 E;  2EPR A;  2DMI A;  4R2C A;  2VF1 A;  4BC9 A;  2MKD A;  2YTQ A;  4HEI A;  1G2F C;  4R2Q A;  2EM3 A;  2L8T A;  4JI7 E;  1AAY A;  2EPO A;  3ZOQ B;  4BCA A;  3IWC A;  4ZYE A;  1EKZ A;  2JPA A;  1TF6 A;  2UXB E;  1ZBQ A;  3L00 A;  2YTN A;  2NUF A;  2EOQ A;  2EOR A;  4WPY A;  4DUY E;  4DR3 E;  1A1K A;  2YTP A;  4LTY A;  4LF4 E;  2EOX A;  2L2K B;  4Q35 B;  4O5G A;  4JI8 E;  3J7Y p;  2EN3 A;  2LUQ A;  4R2P A;  2HGH A;  2JVA A;  3TQM A;  2ELZ A;  4DMI A;  3THN A;  5CFF E;  2RS6 A;  1N34 E;  2RS7 A;  2WBT A;  2E1M A;  4B3M E;  2MC5 A;  4L5N C;  2ELY A;  2EWL A;  4BS9 A;  2EOH A;  4X66 E;  2EN1 A;  1N32 E;  1N3G A;  2L2M A;  4M9V C;  3EPJ A;  4LF5 E;  4F9C B;  3LML A;  5A6J A;  3EQ1 A;  4DV6 E;  5LL6 R;  2YPN A;  1GZ6 A;  4R8O A;  4P7D A;  2HJJ A;  4R2E A;  2EMZ A;  2EPZ A;  1JK2 A;  1HNW E;  2EOJ A;  3BID A;  4DR7 E;  4X9J A;  2PRT A;  2JY9 A;  2EMI A;  2JXP A;  2EMY A;  2GHF A;  2CPN A;  2FV4 B;  1YPN A;  2LCE A;  1L4S A;  3M99 B;  1SFE A;  3C4T A;  3VHT B;  2YTE A;  2YT4 A;  4BC7 A;  4M30 A;  4TUG A;  3EPK A;  1XMO E;  2DGC A;  1P47 A;  5A69 A;  3ADL A;  2DB2 A;  1IBK E;  1QNT A;  1F2I G;  5AE3 A;  4BHC A;  1WXR A;  1T38 A;  2EQ1 A;  5AE2 A;  4WXC A;  4L8N A;  4LU9 A;  4DV4 E;  2EPA A;  4JI2 E;  3JU0 A;  2WBS A;  2EOI A;  3ADI A;  2IHR 1;  3MSW A;  2E5L E;  2K4V A;  1HR0 E;  4X65 E;  2YTJ A;  5FLX C;  2RTX A;  2LT7 A;  2V8Q B;  4JI4 E;  1YYO A;  1WJP A;  4LFA E;  2NA2 A;  3H09 A;  1RQ0 A;  2EM7 A;  2UXC E;  2RQL A;  1UHZ A;  1LLM C;  1X49 A;  2EMW A;  1ZU1 A;  4R2D A;  1B69 A;  1DQ3 A;  2EM8 A;  2YSO A;  3VYY A;  1Z1B A;  1KYQ A;  2DIX A;  1O0W A;  1EH6 A;  2EPC A;  5KL6 A;  4BHB A;  2ENC A;  4WSP A;  4ZYG A;  1UN6 B;  2VQE E;  1EH8 A;  2ODR D;  2BBG A;  2FGG A;  4FK5 C;  4K0K E;  2EOS A;  3IWB A;  2A25 A;  3HQ1 A;  4DV1 E;  4DV7 E;  5LMU E;  1XMQ E;  2V83 A;  4DV0 E;  2V89 A;  3THO B;  2NUG A;  5AC5 A;  2EMA A;  2EJ4 A;  2V88 A;  3HXL A;  3F6G A;  4MLQ A;  3T1Y E;  4WXD A;  1RC7 A;  4NXM E;  2EOY A;  2FTX B;  1YZ9 A;  2EMH A;  5KL7 A;  2LBS B;  4ZYH A;  3AUZ A;  5IXM B;  1WHN A;  4DV2 E;  1DI2 A;  2DMY A;  2CT1 A;  3ADJ A;  1FJG E;  2V87 A;  4BBY A;  3VYX A;  1A1L A;  2EM5 A;  2EL5 A;  2EM0 A;  5LMN E;  2I9I A;  1PJT A;  4O43 A;  3LLH A;  1X6E A;  4B3S E;  2LO3 A;  2KHX A;  1T39 A;  2M7Q A;  1N36 E;  2WZO A;  5A6B D;  2EN8 A;  2L3J A;  3MHH C;  1BB8 A;  3KWR A;  1TN9 A;  2YRK A;  2YTG A;  2EL4 A;  1A1J A;  5A2Q C;  2L2N A;  2NAB A;  2JR1 A;  2EN6 A;  2RSM A;  2JP9 A;  5DNY A;  2M9A A;  4BMJ A;  3KZZ A;  2DRP A;  2EN7 A;  1IBM E;  3QG5 C;  2N3G A;  2N8X A;  1YSA C;  1NCS A;  5KL4 A;  3HTX A;  2H36 X;  2F8B A;  4F6N A;  2YSP A;  4TUI A;  2LJU A;  2EMB A;  3OML A;  2MC6 A;  3DF6 A;  1A1I A;  2R76 A;  2KOU A;  2Q8U A;  2YZT A;  1G2D C;  4O24 A;  3JAM C;  4MLV A;  4RH8 A;  2CSH A;  4OOG C;  2DLQ A;  5TSE A;  2JWO A;  2EPU A;  2EPL X;  4YHH E;  1PDA A;  3EPH A;  1IMU A;  2MDR A;  1FKA E;  3BBG A;  2UXD E;  2B7V A;  5KL5 A;  2BB8 A;  1X6F A;  2LV2 A;  2V85 A;  2E72 A;  1T4N A;  3BGH A;  4JI3 E;  3J80 C;  2EMX A;  1RMD A;  2ODR C;  4RHB B;  2UUC E;  2EOO A;  1ZBT A;  4JI0 E;  1JK1 A;  1NEI A;  3T1H E;  1N33 E;  1X48 A;  5AC4 A;  4B3R E;  3C6M A;  4GEQ B;  2VQF E;  2EMF A;  4HTG A;  2J7J A;  2EMG A;  4F54 A;  5A6B A;  4DKK A;  2DSY A;  2EOE A;  1GTK A;  4AQY E;  1SR9 A;  2EE8 A;  5KL3 A;  2UUA E;  1UIL A;  2UU9 E;  3AV0 A;  2R1F A;  2EL6 A;  4JI5 E;  2B9D A;  2EM9 A;  4JV5 E;  2EZ6 A;  2UUB E;  1PJQ A;  2NUE A;  2YU8 A;  2M4I A;  4JI1 E;  1MEY C;  1XNQ E;  4JYA E;  3C6K A;  1EH7 A;  2LRS A;  2WBU A;  2LJH A;  4Q28 A;  2EP3 A;  1BBG A;  2EN2 A;  2N3H A;  2YWQ A;  3F6H A;  4M0V A;  1J26 A;  3KZY A;  2LE2 A;  4X8W A;  2RSI A;  2EOF A;  2MKN A;  1WHQ A;  5KL2 A;  4KWY A;  5F3W A;  2EQ3 A;  5IWA E;  1X5W A;  1IQS A;  2KON A;  2YRH A;  4NHR A;  4M2Z A;  2L92 A;  4WX9 A;  4X62 E;  1STU A;  1WRJ A;  1ZR9 A;  4GZN C;  3ADG A;  2K7I A;  2YU5 A;  2EPP A;  4F9B B;  2HC5 A;  4R2S A;  4LFB E;  1KJK A;  4OX9 E;  3K6Q A;  1TF3 A;  1MGT A;  2EN4 A;  4F6M A;  1HNZ E;  2B7T A;  2LTS A;  2EOZ A;  2I13 A;  5AE1 A;  4DUZ E;  3J7A G;  1A1G A;  2EQ0 A;  4ZYD A;  2LTR A;  2EPN A;  2YTF A;  2EM4 A;  3UK3 C;  2B3T B;  3ECR A;  4NXN E;  5AAS A;  4IJD A;  2D9H A;  1T4O A;  2LVH A;  2LUP B;  3MHS C;  4GKK E;  2YTO A;  5A6K A;  1UBD C;  4F2J C;  1YYW A;  2ENA A;  2EM2 A;  2V86 A;  1BBO A;  2JOB A;  1X6H A;  3BF2 A;  4DR2 E;  4DR1 E;  2ENH A;  4KZS A;  3P1X A;  5T6J A;  4DR6 E;  4LF6 E;  4J8Z A;  4WYQ B;  5IT9 C;  2CTD A;  3OTO E;  4IS1 C;  2L3C A;  3RMP A;  1DGC A;  4I8O A;  3IWD A; 
#chains in the Genus database with same CATH homology
 2EPX A;  2EOS A;  1JK1 A;  2EN3 A;  4R2P A;  2A25 A;  2VRD A;  2HGH A;  2ELZ A;  2EMF A;  2YRM A;  2J7J A;  2WBT A;  2EMG A;  2EOE A;  2EMK A;  2EMA A;  2EE8 A;  5KL3 A;  2EJ4 A;  2ELY A;  1ZAA C;  2EOY A;  2EOH A;  2R1F A;  2YTD A;  2EL6 A;  2EN1 A;  4M9V C;  2EM9 A;  3EPJ A;  2EMH A;  1A1H A;  5KL7 A;  1YUJ A;  4R2R A;  2YU8 A;  1MEY C;  2CT1 A;  4R2A A;  2EM6 A;  1A1L A;  2EM5 A;  2EL5 A;  2WBU A;  2EM0 A;  2EMC A;  2EP3 A;  2EN2 A;  2MDG A;  4R2E A;  2EMZ A;  1X6E A;  2EPZ A;  2EOF A;  2LO3 A;  2RSI A;  4WSG A;  2EOJ A;  2EOM A;  1JK2 A;  2MKN A;  2GLI A;  2DLK A;  5KL2 A;  4X9J A;  2PRT A;  2EN8 A;  2EMI A;  3MHH C;  2EQ3 A;  2EMY A;  1BB8 A;  1X5W A;  2GHF A;  2LCE A;  1TN9 A;  2YRK A;  3M99 B;  2YTG A;  2YRH A;  3VHT B;  2EL4 A;  2YTE A;  1A1J A;  1ZR9 A;  2NAB A;  4GZN C;  2EN6 A;  1KJK A;  2YU5 A;  2EPP A;  2JP9 A;  4R2S A;  3EPL A;  2M9A A;  2YTI A;  3EPK A;  2DGC A;  1X3C A;  1P47 A;  2DRP A;  2EN7 A;  1TF3 A;  2EN4 A;  4F6M A;  1F2I G;  2WCC 3;  2EOZ A;  2I13 A;  1YSA C;  2EQ1 A;  1NCS A;  2ADR A;  1A1G A;  2EQ0 A;  5KL4 A;  2YTF A;  4F6N A;  2EM4 A;  2YSP A;  2EPA A;  3UK3 C;  2WBS A;  2EOI A;  2EMB A;  2RPC A;  2EML A;  1A1I A;  4IJD A;  2D9H A;  2LVH A;  3MHS C;  2YTJ A;  1A1F A;  1YUI A;  2LT7 A;  2YTO A;  1G2D C;  1UBD C;  4F2J C;  1WJP A;  2ENA A;  2EPR A;  2DMI A;  2EM2 A;  2EM7 A;  4R2C A;  1BBO A;  2CSH A;  2MKD A;  2DLQ A;  1X6H A;  2EPU A;  2YTQ A;  1LLM C;  1G2F C;  4R2Q A;  2EM3 A;  2EMW A;  1ZU1 A;  4R2D A;  1B69 A;  1AAY A;  3EPH A;  2ENH A;  2JPA A;  1TF6 A;  2EM8 A;  2YSO A;  2BB8 A;  5KL5 A;  1X6F A;  2LV2 A;  1Z1B A;  2E72 A;  2YTN A;  2CTD A;  2EOQ A;  2EOR A;  4IS1 C;  2EPC A;  5KL6 A;  1A1K A;  2ENC A;  2YTP A;  2EOX A;  2EMX A;  1RMD A;  1UN6 B;  1DGC A;  2EOO A;  4FK5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...