2EJ4A

Functional and structural basis of nuclear localization signal in zic3 zinc finger domain: a role of conserved tryptophan residue in the zinc finger domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
95
structure length
95
Chain Sequence
GSSGSSGQPIKQELSCKWIDEAQLSRPKKSCDRTFSTMHELVTHVTMEHVGGPEQNNHVCYWEECPREGKSFKAKYKLVNHIRVHTGEKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords Zinc finger protein ZIC 3
publication title Functional and structural basis of nuclear localization signal in ZIC3 zinc finger domain: a role of conserved tryptophan residue in the zinc finger domain
rcsb
source organism Homo sapiens
total genus 11
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ej4A01
2WCC3 2WBTA 2YTFA 2YSOA 2CSHA 2JP9A 2EJ4A 1LLMC 2EN2A 1BB8A 2MDGA 2GHFA 1JK2A 2YTDA 2EMXA 2EMAA 2EPZA 2EOJA 1X6EA 1YSAC 2JPAA 2PRTA 4R2DA 4R2AA 2ENAA 2LV2A 2YRHA 2GLIA 2A25A 4R2SA 2ELYA 1X3CA 2EM9A 1ZR9A 2EE8A 2EMLA 2EMWA 2LVHA 3UK3C 1NCSA 2ADRA 2DLKA 3EPJA 2EMYA 2RSIA 5KL2A 2YTNA 3MHSC 1UBDC 1P47A 1F2IG 2EM8A 1RMDA 1A1JA 2WBUA 4FK5C 2EMZA 2BB8A 2EOZA 3MHHC 1TN9A 2EM7A 4F6NA 3M99B 5KL4A 1X6FA 4R2RA 2D9HA 2EN7A 2YU8A 2CTDA 2EQ0A 1A1LA 2EM5A 1JK1A 2EL4A 2EMFA 4R2EA 1WJPA 2EM0A 5KL3A 2EMKA 2EOYA 2YTJA 2EOFA 2DMIA 2YTIA 1DGCA 2EMIA 1B69A 2YTGA 2DGCA 1YUJA 1TF6A 2LCEA 3VHTB 2MKNA 2CT1A 2LT7A 2EOOA 1Z1BA 2J7JA 2EOMA 2YRKA 2YTOA 1UN6B 2DRPA 1A1GA 4R2QA 2EL6A 4IJDA 2EPPA 2M9AA 5KL6A 2EM4A 2MKDA 4IS1C 2EQ1A 2EMCA 2DLQA 2EMGA 1ZU1A 2EM3A 1A1KA 2ELZA 2EOSA 2EQ3A 2YSPA 2YTQA 2EPRA 2VRDA 1ZAAC 2EN1A 2YTEA 2YRMA 2I13A 1A1FA 1YUIA 2RPCA 1X5WA 2NABA 4M9VC 2YTPA 5KL5A 2EORA 1BBOA 2EN3A 2EPXA 2EN8A 4WSGA 1KJKA 2EM6A 5KL7A 1TF3A 4F6MA 2EOIA 3EPLA 2E72A 2LO3A 2EN4A 2EMHA 2EL5A 2EP3A 2EMBA 2EOQA 1X6HA 4R2CA 1AAYA 2HGHA 2R1FA 2EPCA 2EPAA 2EOEA 2EOHA 2WBSA 4GZNC 1MEYC 4X9JA 3EPKA 1A1IA 2EOXA 4F2JC 2ENCA 2ENHA 1G2DC 2EPUA 3EPHA 2YU5A 4R2PA 2EN6A 1G2FC 2EM2A 1A1HA
chains in the Genus database with same CATH superfamily
4BC9A 2WBTA 4Q28A 2LMZA 4X66E 1T39A 1DI2A 2EN2A 1YPNA 4KWYA 4DUZE 2LTRA 4KHPE 4DR5E 3ADIA 3OMLA 2EOJA 3J7Yp 4R2AA 2GLIA 4R2SA 2EE8A 1NCSA 2YTNA 1HNZE 4DV4E 3L00A 1GQEA 5A6AA 4DV6E 5TSEA 2L8TA 2WBUA 4JI1E 2EOZA 1WRJA 1IQOA 4YHHE 4I8OA 2FTXB 5LMNE 3KWRA 4DV1E 2HC5A 1A1LA 1JK1A 2EL4A 4R2EA 2EPMX 1I94E 2JY9A 2VE7C 4LF4E 2EM0A 4JI2E 4X65E 2YTJA 4WXDA 2EOFA 2UUCE 1DGCA 3MSWA 3ADGA 1X48A 1YUJA 5T6JA 4ZYDA 1TF6A 2LCEA 3VHTB 2EPLX 3AUZA 2DSYA 4WPYA 2KONA 4BCAA 4GEQB 3HXLA 2MKDA 4MLQA 4IS1C 2EMCA 1GTKA 2NUEA 1ZU1A 4JI6E 2UXDE 4X62E 2RS7A 2EOSA 3VYYA 1AH5A 1A1FA 3J7AG 2NABA 2UU9E 2RSMA 3F6HA 4R8OA 4O24A 2N3GA 3JAMC 4DR3E 2EM6A 4RHBB 2EZ6A 2B7TA 4ZYEA 2EN4A 2EMHA 2EP3A 2EMBA 1EH7A 2HGHA 2R1FA 2V8QB 2EPAA 2EOEA 2V83A 3K6QA 2EOHA 1HNWE 4LF9E 4X9JA 1T4NA 5LLQA 2EOXA 4BBYA 4F2JC 2ENHA 3EPHA 3FIGA 2YU5A 4R2PA 3OTOE 2JYAA 3ADJA 4F9AB 3M99B 2EN6A 1G2FC 4LFAE 5A6BA 2YSOA 2JXPA 2CSHA 2VF1A 2EPKX 1LLMC 5LL6R 2GHFA 2YTDA 3ECRA 4P7DA 1N3GA 2EPZA 1X6EA 4B3TE 2YWQA 2JPAA 2ODRC 2HJJA 2LE2A 4DR4E 4B3RE 2FGGA 3H09A 3J81C 4O4KA 2ENAA 2LV2A 2ELYA 1ZR9A 2EMWA 2LVHA 3UK3C 1O0WA 5DNYA 5A6BD 3MHSC 3BGHA 1UBDC 3IWCA 1PKPA 5AE2A 2K7IA 4DKKA 1RMDA 2VQFE 1J26A 4X64E 2EMZA 5A6JA 1X49A 2EM7A 4WXCA 5ADZA 4F6NA 2LJHA 4R2RA 2EN7A 2CTDA 1PJTA 2UUAE 3HPZA 4YY3E 2L33A 4DR2E 3IWDA 4OX9E 4JI7E 5AE3A 2FV4B 3THNA 1B69A 5LMUE 1YYOA 2EPOA 3KZYA 2MDRA 1UHZA 2CT1A 4WYQB 2B7VA 2EOOA 2J7JA 2YRKA 1Z1BA 2NUGA 3VK6A 2HHHE 4R2QA 1XNQE 2M9AA 4ZYGA 1T4LB 4JYAE 2DLQA 2M7QA 2L92A 1A1KA 1EH8A 2YTQA 2EPRA 2VRDA 4F9BB 2YRMA 2I13A 2M1SA 4JI8E 2YTPA 5KL5A 2KOUA 5IXMB 1BBOA 2EN3A 4X8WA 2EPXA 4O43A 3HPSA 3J80C 1T38A 3EPLA 2LO3A 2V89A 3DF6A 2EPNA 4DV5E 2EOQA 4DV7E 3BF2A 1PDAA 1MGTA 2CPNA 1T4OA 1STUA 2WBSA 2YPNA 1MEYC 3T1YE 1N36E 2R76A 4HTGA 3BIDA 4WX9A 4N4RB 4WSPA 4BMJA 3KZZA 1EKZA 4M30A 1SR9A 2EJ4A 1IBKE 1BB8A 2YT4A 2UXCE 1QNTA 4DMIA 2N8XA 2EMXA 1IQSA 2RTXA 1YSAC 3ADLA 4JI5E 2PRTA 2B3TB 2WZOA 4BHCA 4GKKE 4ZYHA 4O5GA 2YRHA 3AV0A 2A25A 2EM9A 2LUQA 2H36X 2M4IA 2V87A 2ADRA 2EMYA 5CFFE 1P47A 1EH6A 1F2IG 4LU9A 1FJGE 1HR0E 2EM8A 1A1JA 4FK5C 2V88A 3LLHA 2L2NA 1DQ3A 5BR8E 1L4SA 5KL4A 5IT9C 5AASA 1X6FA 1N32E 2D9HA 2EQ0A 3QG5C 2EM5A 5AC5A 4J8ZA 3T1HE 3HQ1A 1WJPA 5KL3A 1ZBQA 2EOYA 2EMIA 2RS6A 1WXRA 2DGCA 3THOB 4DR1E 4GKJE 2MKNA 4BHBA 1ZBTA 2LTSA 2L2MA 1SFEA 2YTOA 1UN6B 2DRPA 4L5NC 1A1GA 2F4VE 3RMPA 3LMLA 5KL6A 4NXNE 4DV0E 2EQ1A 2EM2A 2EMGA 4MLVA 2G7HA 1XNRE 2DMYA 2E1MA 1ZAAC 1YYWA 4WFTA 3JTZA 2YTEA 2E5LE 4B3SE 4BC7A 4TUIA 3F6GA 2EWLA 2L6MA 4NXME 2EN8A 4WSGA 1KJKA 4F6MA 1RC7A 3C4BA 4LFCE 2E72A 1PJQA 1IBME 2DIXA 2LBSB 4R2CA 1AAYA 1FKAE 3C4TA 3P1XA 2EPCA 2YZTA 1KYQA 3HTXA 5AE1A 3EPKA 1A1IA 3BBGA 4TUGA 3IWBA 3TQMA 4P78A 4NZVA 2MC6A 1IMUA 4F54A 4DR6E 4KZSA 2WCC3 2YTFA 2JP9A 4HEIA 4DR7E 2MDGA 1JK2A 2GPIA 2EMAA 3DJWA 1WHNA 4LF5E 2RQLA 1J5EE 4R2DA 2LUPB 5IV8B 2L3CA 4LF7E 4B3ME 2NUFA 1X3CA 2L2KB 2EMLA 2DLKA 3EPJA 2RSIA 5KL2A 3EQ1A 2V85A 4DV2E 1X47A 1GZ6A 5A2QC 2ZM6E 2BB8A 4RH8A 3MHHC 4BS9A 1TN9A 2IHR1 1PJSA 5A6KA 1RQ0A 2YU8A 1XMQE 2ODRD 1N33E 5F3WA 3ZOQB 2EMFA 3C6MA 2EMKA 4M0VA 2L3JA 5A69A 2VQEE 2DMIA 2YTIA 1QU6A 4F9CB 2JVAA 2YTGA 4R03A 4JI0E 1XMOE 2LT7A 2EOMA 1YZ9A 1IBLE 2EL6A 2JR1A 2EPPA 2I9IA 4IJDA 4DUYE 2EM4A 4JI3E 4Q35B 1N34E 2MC5A 2EM3A 2ELZA 2JWOA 4AQYE 2UUBE 2YSPA 2EQ3A 4LTYA 2EN1A 1BBGA 2F8BA 2K4VA 5AC4A 1YUIA 1WHQA 2LJUA 2RPCA 1HNXE 1X5WA 4M9VC 4K0KE 3C6KA 4LF6E 4OOGC 4JV5E 2EORA 1UILA 4LF8E 1NEIA 5KL7A 1TF3A 4NHRA 1YFHA 3VYXA 2EOIA 4M2ZA 2V86A 2JOXA 2EL5A 2NA2A 1X6HA 2UXBE 4LFBE 5IWAE 2JOBA 5FLXC 4GZNC 1YYKA 2B9DA 2ENCA 3JU0A 2N3HA 4JI4E 2Q8UA 1G2DC 2EPUA 2DB2A 2BBGA 2KHXA 4DV3E 4L8NA 2LRSA 1A1HA
chains in the Genus database with same CATH topology
2WCC3 2WBTA 2YTFA 2YSOA 2CSHA 2JP9A 2EJ4A 1LLMC 2EN2A 1BB8A 2MDGA 2GHFA 1JK2A 2YTDA 2EMXA 2EMAA 2EPZA 2EOJA 1X6EA 1YSAC 2JPAA 2PRTA 4R2DA 4R2AA 2ENAA 2LV2A 2YRHA 2GLIA 2A25A 4R2SA 2ELYA 1X3CA 2EM9A 1ZR9A 2EE8A 2EMLA 2EMWA 2LVHA 3UK3C 1NCSA 2ADRA 2DLKA 3EPJA 2EMYA 2RSIA 5KL2A 2YTNA 3MHSC 1UBDC 1P47A 1F2IG 2EM8A 1RMDA 1A1JA 2WBUA 4FK5C 2EMZA 2BB8A 2EOZA 3MHHC 1TN9A 2EM7A 4F6NA 3M99B 5KL4A 1X6FA 4R2RA 2D9HA 2EN7A 2YU8A 2CTDA 2EQ0A 1A1LA 2EM5A 1JK1A 2EL4A 2EMFA 4R2EA 1WJPA 2EM0A 5KL3A 2EMKA 2EOYA 2YTJA 2EOFA 2DMIA 2YTIA 1DGCA 2EMIA 1B69A 2YTGA 2DGCA 1YUJA 1TF6A 2LCEA 3VHTB 2MKNA 2CT1A 2LT7A 2EOOA 1Z1BA 2J7JA 2EOMA 2YRKA 2YTOA 1UN6B 2DRPA 1A1GA 4R2QA 2EL6A 4IJDA 2EPPA 2M9AA 5KL6A 2EM4A 2MKDA 4IS1C 2EQ1A 2EMCA 2DLQA 2EMGA 1ZU1A 2EM3A 1A1KA 2ELZA 2EOSA 2EQ3A 2YSPA 2YTQA 2EPRA 2VRDA 1ZAAC 2EN1A 2YTEA 2YRMA 2I13A 1A1FA 1YUIA 2RPCA 1X5WA 2NABA 4M9VC 2YTPA 5KL5A 2EORA 1BBOA 2EN3A 2EPXA 2EN8A 4WSGA 1KJKA 2EM6A 5KL7A 1TF3A 4F6MA 2EOIA 3EPLA 2E72A 2LO3A 2EN4A 2EMHA 2EL5A 2EP3A 2EMBA 2EOQA 1X6HA 4R2CA 1AAYA 2HGHA 2R1FA 2EPCA 2EPAA 2EOEA 2EOHA 2WBSA 4GZNC 1MEYC 4X9JA 3EPKA 1A1IA 2EOXA 4F2JC 2ENCA 2ENHA 1G2DC 2EPUA 3EPHA 2YU5A 4R2PA 2EN6A 1G2FC 2EM2A 1A1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WCC 3;  2WBT A;  2YTF A;  2YSO A;  2CSH A;  2JP9 A;  2EJ4 A;  1LLM C;  2EN2 A;  1BB8 A;  2MDG A;  2GHF A;  1JK2 A;  2YTD A;  2EMX A;  2EMA A;  2EPZ A;  2EOJ A;  1X6E A;  1YSA C;  2JPA A;  2PRT A;  4R2D A;  4R2A A;  2ENA A;  2LV2 A;  2YRH A;  2GLI A;  2A25 A;  4R2S A;  2ELY A;  1X3C A;  2EM9 A;  1ZR9 A;  2EE8 A;  2EML A;  2EMW A;  2LVH A;  3UK3 C;  1NCS A;  2ADR A;  2DLK A;  3EPJ A;  2EMY A;  2RSI A;  5KL2 A;  2YTN A;  3MHS C;  1UBD C;  1P47 A;  1F2I G;  2EM8 A;  1RMD A;  1A1J A;  2WBU A;  4FK5 C;  2EMZ A;  2BB8 A;  2EOZ A;  3MHH C;  1TN9 A;  2EM7 A;  4F6N A;  3M99 B;  5KL4 A;  1X6F A;  4R2R A;  2D9H A;  2EN7 A;  2YU8 A;  2CTD A;  2EQ0 A;  1A1L A;  2EM5 A;  1JK1 A;  2EL4 A;  2EMF A;  4R2E A;  1WJP A;  2EM0 A;  5KL3 A;  2EMK A;  2EOY A;  2YTJ A;  2EOF A;  2DMI A;  2YTI A;  1DGC A;  2EMI A;  1B69 A;  2YTG A;  2DGC A;  1YUJ A;  1TF6 A;  2LCE A;  3VHT B;  2MKN A;  2CT1 A;  2LT7 A;  2EOO A;  1Z1B A;  2J7J A;  2EOM A;  2YRK A;  2YTO A;  1UN6 B;  2DRP A;  1A1G A;  4R2Q A;  2EL6 A;  4IJD A;  2EPP A;  2M9A A;  5KL6 A;  2EM4 A;  2MKD A;  4IS1 C;  2EQ1 A;  2EMC A;  2DLQ A;  2EMG A;  1ZU1 A;  2EM3 A;  1A1K A;  2ELZ A;  2EOS A;  2EQ3 A;  2YSP A;  2YTQ A;  2EPR A;  2VRD A;  1ZAA C;  2EN1 A;  2YTE A;  2YRM A;  2I13 A;  1A1F A;  1YUI A;  2RPC A;  1X5W A;  2NAB A;  4M9V C;  2YTP A;  5KL5 A;  2EOR A;  1BBO A;  2EN3 A;  2EPX A;  2EN8 A;  4WSG A;  1KJK A;  2EM6 A;  5KL7 A;  1TF3 A;  4F6M A;  2EOI A;  3EPL A;  2E72 A;  2LO3 A;  2EN4 A;  2EMH A;  2EL5 A;  2EP3 A;  2EMB A;  2EOQ A;  1X6H A;  4R2C A;  1AAY A;  2HGH A;  2R1F A;  2EPC A;  2EPA A;  2EOE A;  2EOH A;  2WBS A;  4GZN C;  1MEY C;  4X9J A;  3EPK A;  1A1I A;  2EOX A;  4F2J C;  2ENC A;  2ENH A;  1G2D C;  2EPU A;  3EPH A;  2YU5 A;  4R2P A;  2EN6 A;  1G2F C;  2EM2 A;  1A1H A; 
#chains in the Genus database with same CATH topology
 4BC9 A;  2WBT A;  4Q28 A;  2LMZ A;  4X66 E;  1T39 A;  1DI2 A;  2EN2 A;  1YPN A;  4KWY A;  4DUZ E;  2LTR A;  4KHP E;  4DR5 E;  3ADI A;  3OML A;  2EOJ A;  3J7Y p;  4R2A A;  2GLI A;  4R2S A;  2EE8 A;  1NCS A;  2YTN A;  1HNZ E;  4DV4 E;  3L00 A;  1GQE A;  5A6A A;  4DV6 E;  5TSE A;  2L8T A;  2WBU A;  4JI1 E;  2EOZ A;  1WRJ A;  1IQO A;  4YHH E;  4I8O A;  2FTX B;  5LMN E;  3KWR A;  4DV1 E;  2HC5 A;  1A1L A;  1JK1 A;  2EL4 A;  4R2E A;  2EPM X;  1I94 E;  2JY9 A;  2VE7 C;  4LF4 E;  2EM0 A;  4JI2 E;  4X65 E;  2YTJ A;  4WXD A;  2EOF A;  2UUC E;  1DGC A;  3MSW A;  3ADG A;  1X48 A;  1YUJ A;  5T6J A;  4ZYD A;  1TF6 A;  2LCE A;  3VHT B;  2EPL X;  3AUZ A;  2DSY A;  4WPY A;  2KON A;  4BCA A;  4GEQ B;  3HXL A;  2MKD A;  4MLQ A;  4IS1 C;  2EMC A;  1GTK A;  2NUE A;  1ZU1 A;  4JI6 E;  2UXD E;  4X62 E;  2RS7 A;  2EOS A;  3VYY A;  1AH5 A;  1A1F A;  3J7A G;  2NAB A;  2UU9 E;  2RSM A;  3F6H A;  4R8O A;  4O24 A;  2N3G A;  3JAM C;  4DR3 E;  2EM6 A;  4RHB B;  2EZ6 A;  2B7T A;  4ZYE A;  2EN4 A;  2EMH A;  2EP3 A;  2EMB A;  1EH7 A;  2HGH A;  2R1F A;  2V8Q B;  2EPA A;  2EOE A;  2V83 A;  3K6Q A;  2EOH A;  1HNW E;  4LF9 E;  4X9J A;  1T4N A;  5LLQ A;  2EOX A;  4BBY A;  4F2J C;  2ENH A;  3EPH A;  3FIG A;  2YU5 A;  4R2P A;  3OTO E;  2JYA A;  3ADJ A;  4F9A B;  3M99 B;  2EN6 A;  1G2F C;  4LFA E;  5A6B A;  2YSO A;  2JXP A;  2CSH A;  2VF1 A;  2EPK X;  1LLM C;  5LL6 R;  2GHF A;  2YTD A;  3ECR A;  4P7D A;  1N3G A;  2EPZ A;  1X6E A;  4B3T E;  2YWQ A;  2JPA A;  2ODR C;  2HJJ A;  2LE2 A;  4DR4 E;  4B3R E;  2FGG A;  3H09 A;  3J81 C;  4O4K A;  2ENA A;  2LV2 A;  2ELY A;  1ZR9 A;  2EMW A;  2LVH A;  3UK3 C;  1O0W A;  5DNY A;  5A6B D;  3MHS C;  3BGH A;  1UBD C;  3IWC A;  1PKP A;  5AE2 A;  2K7I A;  4DKK A;  1RMD A;  2VQF E;  1J26 A;  4X64 E;  2EMZ A;  5A6J A;  1X49 A;  2EM7 A;  4WXC A;  5ADZ A;  4F6N A;  2LJH A;  4R2R A;  2EN7 A;  2CTD A;  1PJT A;  2UUA E;  3HPZ A;  4YY3 E;  2L33 A;  4DR2 E;  3IWD A;  4OX9 E;  4JI7 E;  5AE3 A;  2FV4 B;  3THN A;  1B69 A;  5LMU E;  1YYO A;  2EPO A;  3KZY A;  2MDR A;  1UHZ A;  2CT1 A;  4WYQ B;  2B7V A;  2EOO A;  2J7J A;  2YRK A;  1Z1B A;  2NUG A;  3VK6 A;  2HHH E;  4R2Q A;  1XNQ E;  2M9A A;  4ZYG A;  1T4L B;  4JYA E;  2DLQ A;  2M7Q A;  2L92 A;  1A1K A;  1EH8 A;  2YTQ A;  2EPR A;  2VRD A;  4F9B B;  2YRM A;  2I13 A;  2M1S A;  4JI8 E;  2YTP A;  5KL5 A;  2KOU A;  5IXM B;  1BBO A;  2EN3 A;  4X8W A;  2EPX A;  4O43 A;  3HPS A;  3J80 C;  1T38 A;  3EPL A;  2LO3 A;  2V89 A;  3DF6 A;  2EPN A;  4DV5 E;  2EOQ A;  4DV7 E;  3BF2 A;  1PDA A;  1MGT A;  2CPN A;  1T4O A;  1STU A;  2WBS A;  2YPN A;  1MEY C;  3T1Y E;  1N36 E;  2R76 A;  4HTG A;  3BID A;  4WX9 A;  4N4R B;  4WSP A;  4BMJ A;  3KZZ A;  1EKZ A;  4M30 A;  1SR9 A;  2EJ4 A;  1IBK E;  1BB8 A;  2YT4 A;  2UXC E;  1QNT A;  4DMI A;  2N8X A;  2EMX A;  1IQS A;  2RTX A;  1YSA C;  3ADL A;  4JI5 E;  2PRT A;  2B3T B;  2WZO A;  4BHC A;  4GKK E;  4ZYH A;  4O5G A;  2YRH A;  3AV0 A;  2A25 A;  2EM9 A;  2LUQ A;  2H36 X;  2M4I A;  2V87 A;  2ADR A;  2EMY A;  5CFF E;  1P47 A;  1EH6 A;  1F2I G;  4LU9 A;  1FJG E;  1HR0 E;  2EM8 A;  1A1J A;  4FK5 C;  2V88 A;  3LLH A;  2L2N A;  1DQ3 A;  5BR8 E;  1L4S A;  5KL4 A;  5IT9 C;  5AAS A;  1X6F A;  1N32 E;  2D9H A;  2EQ0 A;  3QG5 C;  2EM5 A;  5AC5 A;  4J8Z A;  3T1H E;  3HQ1 A;  1WJP A;  5KL3 A;  1ZBQ A;  2EOY A;  2EMI A;  2RS6 A;  1WXR A;  2DGC A;  3THO B;  4DR1 E;  4GKJ E;  2MKN A;  4BHB A;  1ZBT A;  2LTS A;  2L2M A;  1SFE A;  2YTO A;  1UN6 B;  2DRP A;  4L5N C;  1A1G A;  2F4V E;  3RMP A;  3LML A;  5KL6 A;  4NXN E;  4DV0 E;  2EQ1 A;  2EM2 A;  2EMG A;  4MLV A;  2G7H A;  1XNR E;  2DMY A;  2E1M A;  1ZAA C;  1YYW A;  4WFT A;  3JTZ A;  2YTE A;  2E5L E;  4B3S E;  4BC7 A;  4TUI A;  3F6G A;  2EWL A;  2L6M A;  4NXM E;  2EN8 A;  4WSG A;  1KJK A;  4F6M A;  1RC7 A;  3C4B A;  4LFC E;  2E72 A;  1PJQ A;  1IBM E;  2DIX A;  2LBS B;  4R2C A;  1AAY A;  1FKA E;  3C4T A;  3P1X A;  2EPC A;  2YZT A;  1KYQ A;  3HTX A;  5AE1 A;  3EPK A;  1A1I A;  3BBG A;  4TUG A;  3IWB A;  3TQM A;  4P78 A;  4NZV A;  2MC6 A;  1IMU A;  4F54 A;  4DR6 E;  4KZS A;  2WCC 3;  2YTF A;  2JP9 A;  4HEI A;  4DR7 E;  2MDG A;  1JK2 A;  2GPI A;  2EMA A;  3DJW A;  1WHN A;  4LF5 E;  2RQL A;  1J5E E;  4R2D A;  2LUP B;  5IV8 B;  2L3C A;  4LF7 E;  4B3M E;  2NUF A;  1X3C A;  2L2K B;  2EML A;  2DLK A;  3EPJ A;  2RSI A;  5KL2 A;  3EQ1 A;  2V85 A;  4DV2 E;  1X47 A;  1GZ6 A;  5A2Q C;  2ZM6 E;  2BB8 A;  4RH8 A;  3MHH C;  4BS9 A;  1TN9 A;  2IHR 1;  1PJS A;  5A6K A;  1RQ0 A;  2YU8 A;  1XMQ E;  2ODR D;  1N33 E;  5F3W A;  3ZOQ B;  2EMF A;  3C6M A;  2EMK A;  4M0V A;  2L3J A;  5A69 A;  2VQE E;  2DMI A;  2YTI A;  1QU6 A;  4F9C B;  2JVA A;  2YTG A;  4R03 A;  4JI0 E;  1XMO E;  2LT7 A;  2EOM A;  1YZ9 A;  1IBL E;  2EL6 A;  2JR1 A;  2EPP A;  2I9I A;  4IJD A;  4DUY E;  2EM4 A;  4JI3 E;  4Q35 B;  1N34 E;  2MC5 A;  2EM3 A;  2ELZ A;  2JWO A;  4AQY E;  2UUB E;  2YSP A;  2EQ3 A;  4LTY A;  2EN1 A;  1BBG A;  2F8B A;  2K4V A;  5AC4 A;  1YUI A;  1WHQ A;  2LJU A;  2RPC A;  1HNX E;  1X5W A;  4M9V C;  4K0K E;  3C6K A;  4LF6 E;  4OOG C;  4JV5 E;  2EOR A;  1UIL A;  4LF8 E;  1NEI A;  5KL7 A;  1TF3 A;  4NHR A;  1YFH A;  3VYX A;  2EOI A;  4M2Z A;  2V86 A;  2JOX A;  2EL5 A;  2NA2 A;  1X6H A;  2UXB E;  4LFB E;  5IWA E;  2JOB A;  5FLX C;  4GZN C;  1YYK A;  2B9D A;  2ENC A;  3JU0 A;  2N3H A;  4JI4 E;  2Q8U A;  1G2D C;  2EPU A;  2DB2 A;  2BBG A;  2KHX A;  4DV3 E;  4L8N A;  2LRS A;  1A1H A; 
#chains in the Genus database with same CATH homology
 2WCC 3;  2WBT A;  2YTF A;  2YSO A;  2CSH A;  2JP9 A;  2EJ4 A;  1LLM C;  2EN2 A;  1BB8 A;  2MDG A;  2GHF A;  1JK2 A;  2YTD A;  2EMX A;  2EMA A;  2EPZ A;  2EOJ A;  1X6E A;  1YSA C;  2JPA A;  2PRT A;  4R2D A;  4R2A A;  2ENA A;  2LV2 A;  2YRH A;  2GLI A;  2A25 A;  4R2S A;  2ELY A;  1X3C A;  2EM9 A;  1ZR9 A;  2EE8 A;  2EML A;  2EMW A;  2LVH A;  3UK3 C;  1NCS A;  2ADR A;  2DLK A;  3EPJ A;  2EMY A;  2RSI A;  5KL2 A;  2YTN A;  3MHS C;  1UBD C;  1P47 A;  1F2I G;  2EM8 A;  1RMD A;  1A1J A;  2WBU A;  4FK5 C;  2EMZ A;  2BB8 A;  2EOZ A;  3MHH C;  1TN9 A;  2EM7 A;  4F6N A;  3M99 B;  5KL4 A;  1X6F A;  4R2R A;  2D9H A;  2EN7 A;  2YU8 A;  2CTD A;  2EQ0 A;  1A1L A;  2EM5 A;  1JK1 A;  2EL4 A;  2EMF A;  4R2E A;  1WJP A;  2EM0 A;  5KL3 A;  2EMK A;  2EOY A;  2YTJ A;  2EOF A;  2DMI A;  2YTI A;  1DGC A;  2EMI A;  1B69 A;  2YTG A;  2DGC A;  1YUJ A;  1TF6 A;  2LCE A;  3VHT B;  2MKN A;  2CT1 A;  2LT7 A;  2EOO A;  1Z1B A;  2J7J A;  2EOM A;  2YRK A;  2YTO A;  1UN6 B;  2DRP A;  1A1G A;  4R2Q A;  2EL6 A;  4IJD A;  2EPP A;  2M9A A;  5KL6 A;  2EM4 A;  2MKD A;  4IS1 C;  2EQ1 A;  2EMC A;  2DLQ A;  2EMG A;  1ZU1 A;  2EM3 A;  1A1K A;  2ELZ A;  2EOS A;  2EQ3 A;  2YSP A;  2YTQ A;  2EPR A;  2VRD A;  1ZAA C;  2EN1 A;  2YTE A;  2YRM A;  2I13 A;  1A1F A;  1YUI A;  2RPC A;  1X5W A;  2NAB A;  4M9V C;  2YTP A;  5KL5 A;  2EOR A;  1BBO A;  2EN3 A;  2EPX A;  2EN8 A;  4WSG A;  1KJK A;  2EM6 A;  5KL7 A;  1TF3 A;  4F6M A;  2EOI A;  3EPL A;  2E72 A;  2LO3 A;  2EN4 A;  2EMH A;  2EL5 A;  2EP3 A;  2EMB A;  2EOQ A;  1X6H A;  4R2C A;  1AAY A;  2HGH A;  2R1F A;  2EPC A;  2EPA A;  2EOE A;  2EOH A;  2WBS A;  4GZN C;  1MEY C;  4X9J A;  3EPK A;  1A1I A;  2EOX A;  4F2J C;  2ENC A;  2ENH A;  1G2D C;  2EPU A;  3EPH A;  2YU5 A;  4R2P A;  2EN6 A;  1G2F C;  2EM2 A;  1A1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...