2EJ4A

Functional and structural basis of nuclear localization signal in zic3 zinc finger domain: a role of conserved tryptophan residue in the zinc finger domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
95
structure length
95
Chain Sequence
GSSGSSGQPIKQELSCKWIDEAQLSRPKKSCDRTFSTMHELVTHVTMEHVGGPEQNNHVCYWEECPREGKSFKAKYKLVNHIRVHTGEKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein ZIC 3
publication title Functional and structural basis of nuclear localization signal in ZIC3 zinc finger domain: a role of conserved tryptophan residue in the zinc finger domain
rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 11
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ej4A01
1A1GA 2DMIA 2EQ0A 2EMCA 2EMLA 2EM3A 2EMZA 2YTEA 2YSOA 2EM0A 4GZNC 1BB8A 1YSAC 2EPZA 2EN6A 2DLQA 2EN2A 2MDGA 2YTQA 2YTPA 2YRMA 1ZR9A 2LV2A 2YU8A 1MEYC 3MHSC 3M99B 2I13A 2EN1A 2MKDA 2MKNA 2EM5A 2YSPA 2JP9A 2EOFA 3EPKA 1ZAAC 1RMDA 1JK2A 2EMWA 2EOXA 1UBDC 2LO3A 2HGHA 4M9VC 1KJKA 4F2JC 2ELZA 2EOZA 4F6MA 2YTOA 1Z1BA 2EPUA 2EMBA 2EN8A 2LCEA 2CSHA 2EQ1A 4R2DA 2YU5A 2PRTA 4R2EA 2EM4A 2RPCA 2WBTA 1F2IG 1A1JA 2EMKA 1A1FA 3VHTB 1G2DC 2EOJA 2GLIA 2YTNA 2ENHA 2EOOA 2EM7A 1X6HA 2WCC3 1BBOA 4R2CA 2EL4A 2R1FA 1TF3A 2ADRA 1LLMC 2J7JA 1B69A 2EOYA 2BB8A 1DGCA 2YRKA 4R2AA 1X6EA 2EMIA 2YTJA 5KL5A 4R2RA 1G2FC 1WJPA 3UK3C 2DRPA 1A1KA 3EPJA 1X3CA 2CT1A 4F6NA 4IJDA 2CTDA 4R2QA 1AAYA 2D9HA 2EMXA 2EM6A 2YTIA 2EMAA 1JK1A 2VRDA 2DLKA 1X6FA 2YTDA 2EJ4A 2EMYA 2E72A 2RSIA 2NABA 2EN4A 2YTGA 2EPRA 2EORA 2JPAA 2ELYA 2LVHA 5KL4A 3EPHA 1NCSA 2DGCA 2EPXA 1YUJA 2EM8A 5KL2A 2EOMA 1TF6A 2EN3A 2M9AA 2YRHA 2EE8A 2EQ3A 2YTFA 2EN7A 2EP3A 2GHFA 4IS1C 2EOSA 1A1IA 1X5WA 2EPPA 1UN6B 4WSGA 2LT7A 2EMGA 1ZU1A 5KL7A 2ENCA 1YUIA 1P47A 2EOHA 4R2PA 2EM9A 1A1LA 4FK5C 2A25A 1TN9A 4R2SA 2EPCA 2WBUA 2EPAA 4X9JA 2EOEA 2WBSA 2EMHA 2EL6A 5KL6A 2ENAA 2EOQA 2EOIA 2EMFA 3MHHC 5KL3A 2EL5A 1A1HA 2EM2A 3EPLA
chains in the Genus database with same CATH superfamily
1A1GA 2NUFA 3VK6A 2EMZA 4GZNC 1AH5A 2DLQA 2YTQA 2MDGA 1GZ6A 2YTPA 2ZM6E 4X64E 3JAMC 2EN1A 4WSPA 2MKNA 2VQEE 4JV5E 1KYQA 2EOFA 4O4KA 1BBGA 2EOXA 1UBDC 4YHHE 2UUAE 4F2JC 2V88A 1UHZA 1Z1BA 1T4LB 2EMBA 2EN8A 2LCEA 2YU5A 3HPSA 1WRJA 2RQLA 2V8QB 3LMLA 1F2IG 3HXLA 3F6HA 2UU9E 2L2NA 5AE2A 2ENHA 4DR3E 1YFHA 2EM7A 5AE1A 2MC6A 2M1SA 4M30A 1BBOA 1WHQA 2EL4A 4O24A 1YZ9A 2M7QA 5AASA 3VYYA 2YRKA 3KWRA 4BBYA 1WJPA 4NXME 1A1KA 3EPJA 4JI3E 4ZYEA 5A69A 1I94E 3FIGA 4KHPE 4DV3E 5DNYA 4IJDA 2CTDA 4R2QA 2D9HA 5A6BD 5T6JA 2YTIA 2VRDA 2DLKA 2EPNA 2YTDA 4F9CB 4ZYDA 2LBSB 2RS7A 2YTGA 2LJHA 4DR2E 2JPAA 2L8TA 2N3GA 3EPHA 4JI7E 5A6AA 5TSEA 3AUZA 3EQ1A 5KL2A 2V86A 2K7IA 4DKKA 2EN3A 2M9AA 5IXMB 4LFBE 2EE8A 4JI5E 2YTFA 2LE2A 1GQEA 4GEQB 1RQ0A 1UN6B 5KL7A 2MDRA 2UUCE 4RHBB 4B3SE 4WYQB 3MSWA 4JI4E 2LMZA 1PJQA 2EOEA 5BR8E 2JVAA 2IHR1 5F3WA 3MHHC 4BS9A 2B9DA 1O0WA 2DIXA 3EPLA 2LTSA 2DMIA 3DJWA 2KONA 2EMCA 2EMLA 2YTEA 2EM0A 2LJUA 1PDAA 2EPZA 2EPKX 2EN2A 3L00A 1FJGE 4DUYE 2EM5A 4DUZE 5AC4A 2L3JA 1RMDA 3C6KA 2EMWA 2Q8UA 2HGHA 4WXDA 1EKZA 4K0KE 4Q35B 2L6MA 1IQSA 2L92A 2EQ1A 3C4BA 1SFEA 2V83A 4RH8A 4R2EA 2EM4A 2EMKA 1A1FA 3VHTB 4X66E 1G2DC 2YPNA 2EOJA 2L2MA 2GLIA 4GKJE 2HJJA 1X6HA 5A2QC 1WXRA 4HTGA 2J7JA 2BB8A 1L4SA 2DB2A 3KZYA 4R2AA 4AQYE 2EPMX 2FTXB 1G2FC 4JI2E 4L8NA 1T38A 4DV4E 4LF6E 3H09A 4F6NA 2LUPB 1N36E 1AAYA 2EMXA 2B3TB 4ZYGA 2E72A 2RSIA 2NABA 5IWAE 1N32E 5FLXC 4NHRA 4MLQA 1NCSA 2DGCA 4WX9A 1J5EE 1N33E 2EM8A 2V85A 4ZYHA 4LF8E 4B3RE 1RC7A 4BHBA 3HPZA 2KHXA 3BF2A 2EN7A 2EP3A 3JU0A 4P78A 2FV4B 2G7HA 3THNA 4WSGA 2RSMA 2LT7A 5ADZA 1ZU1A 1YUIA 4NXNE 3TQMA 4F9AB 2F8BA 4WFTA 2EPCA 3OMLA 4LFAE 1HNWE 4X9JA 2K4VA 4TUGA 2M4IA 4O43A 4JYAE 3ZOQB 3P1XA 2RTXA 2V89A 2N8XA 2UXCE 2EOIA 2EMFA 2ODRD 5KL3A 4R2RA 1A1HA 1QNTA 4DR4E 1HNZE 1SR9A 1GTKA 4BCAA 2YSOA 4LF9E 4WXCA 1YSAC 2EN6A 4M9VC 2JY9A 3HQ1A 3AV0A 1ZBQA 3MHSC 4Q28A 1MEYC 2MKDA 4F54A 2DSYA 2HHHE 1T39A 2JP9A 3EPKA 1ZAAC 1JK2A 4DMIA 2LO3A 1KJKA 2UXBE 2EOZA 2JOBA 3F6GA 4DR7E 3OTOE 5LL6R 4F6MA 2EPUA 3T1HE 4F9BB 5CFFE 2CSHA 4HEIA 2RPCA 1X49A 2WBTA 1A1JA 4YY3E 2N3HA 4DV1E 4I8OA 2YTNA 4N4RB 1XMQE 1IMUA 1ZBTA 2EOOA 3IWDA 2E5LE 4M0VA 2WCC3 2R1FA 3QG5C 1TF3A 2EOYA 1X6EA 2EMIA 2YTJA 4O5GA 2NUGA 5KL5A 1IBME 4DR1E 2I9IA 3IWBA 3BIDA 4X8WA 2EZ6A 2EPLX 1N3GA 4L5NC 2CT1A 3C4TA 4KZSA 2EM6A 2YWQA 2EMAA 2L3CA 5IT9C 4P7DA 1X6FA 4R8OA 4DV6E 2F4VE 2VQFE 4BHCA 2NUEA 2LRSA 2LUQA 3ADJA 1EH7A 2YT4A 2NA2A 2EPXA 1HR0E 1YUJA 4X62E 4OOGC 3ECRA 4TUIA 1UILA 4BC7A 4DV0E 2YRHA 5IV8B 2LTRA 1EH8A 2EQ3A 2WZOA 3K6QA 2GPIA 2L2KB 2R76A 4IS1C 2EOSA 4DV5E 5AE3A 2KOUA 3BBGA 2ENCA 1P47A 2EM9A 4BC9A 1A1LA 4FK5C 3J81C 5LMUE 2EPAA 2L33A 4JI0E 5A6BA 2EMHA 2EL6A 4LU9A 5KL6A 2ENAA 4B3TE 1PJSA 2FGGA 2B7TA 2PRTA 2EL5A 2EM2A 3JTZA 2YZTA 3T1YE 2EQ0A 4JI1E 2EM3A 4DR6E 2H36X 4NZVA 2B7VA 2VF1A 1BB8A 3VYXA 2YRMA 4DV2E 1ZR9A 2LV2A 1PKPA 2YU8A 1X48A 3M99B 5A6JA 2I13A 1IBLE 1X47A 3C6MA 4LFCE 2YSPA 4LF4E 1STUA 1FKAE 3DF6A 2EWLA 3IWCA 4JI8E 3HTXA 2ELZA 1NEIA 2ODRC 3J7AG 2YTOA 4OX9E 3ADLA 3ADGA 4R2DA 5LMNE 2V87A 4BMJA 2JXPA 1DQ3A 4WPYA 2UUBE 1MGTA 4JI6E 3ADIA 2RS6A 4R2CA 5A6KA 2ADRA 2JWOA 1LLMC 1B69A 1T4NA 1DGCA 2DMYA 1IBKE 2E1MA 3J7Yp 2DRPA 3UK3C 1QU6A 1X3CA 4X65E 2EPOA 3BGHA 1WHNA 1J26A 1YYOA 3J80C 2HC5A 4B3ME 2JYAA 4KWYA 1JK1A 1IQOA 2EJ4A 2EMYA 2EN4A 4M2ZA 1EH6A 2EPRA 2EORA 2ELYA 4GKKE 2LVHA 5KL4A 2JR1A 1XMOE 4DV7E 1HNXE 1T4OA 1PJTA 3LLHA 2EOMA 4J8ZA 1XNQE 1TF6A 1YYWA 5LLQA 5AC5A 3KZZA 1N34E 2GHFA 1YYKA 1A1IA 1X5WA 2EPPA 4DR5E 2EMGA 2EOHA 1DI2A 4R2PA 1XNRE 4LF5E 2A25A 1TN9A 1YPNA 4R2SA 3THOB 2BBGA 2WBUA 2WBSA 4R03A 4LF7E 2UXDE 2CPNA 2VE7C 2JOXA 2EOQA 3RMPA 2MC5A 4LTYA 4MLVA
chains in the Genus database with same CATH topology
1A1GA 2DMIA 2EQ0A 2EMCA 2EMLA 2EM3A 2EMZA 2YTEA 2YSOA 2EM0A 4GZNC 1BB8A 1YSAC 2EPZA 2EN6A 2DLQA 2EN2A 2MDGA 2YTQA 2YTPA 2YRMA 1ZR9A 2LV2A 2YU8A 1MEYC 3MHSC 3M99B 2I13A 2EN1A 2MKDA 2MKNA 2EM5A 2YSPA 2JP9A 2EOFA 3EPKA 1ZAAC 1RMDA 1JK2A 2EMWA 2EOXA 1UBDC 2LO3A 2HGHA 4M9VC 1KJKA 4F2JC 2ELZA 2EOZA 4F6MA 2YTOA 1Z1BA 2EPUA 2EMBA 2EN8A 2LCEA 2CSHA 2EQ1A 4R2DA 2YU5A 2PRTA 4R2EA 2EM4A 2RPCA 2WBTA 1F2IG 1A1JA 2EMKA 1A1FA 3VHTB 1G2DC 2EOJA 2GLIA 2YTNA 2ENHA 2EOOA 2EM7A 1X6HA 2WCC3 1BBOA 4R2CA 2EL4A 2R1FA 1TF3A 2ADRA 1LLMC 2J7JA 1B69A 2EOYA 2BB8A 1DGCA 2YRKA 4R2AA 1X6EA 2EMIA 2YTJA 5KL5A 4R2RA 1G2FC 1WJPA 3UK3C 2DRPA 1A1KA 3EPJA 1X3CA 2CT1A 4F6NA 4IJDA 2CTDA 4R2QA 1AAYA 2D9HA 2EMXA 2EM6A 2YTIA 2EMAA 1JK1A 2VRDA 2DLKA 1X6FA 2YTDA 2EJ4A 2EMYA 2E72A 2RSIA 2NABA 2EN4A 2YTGA 2EPRA 2EORA 2JPAA 2ELYA 2LVHA 5KL4A 3EPHA 1NCSA 2DGCA 2EPXA 1YUJA 2EM8A 5KL2A 2EOMA 1TF6A 2EN3A 2M9AA 2YRHA 2EE8A 2EQ3A 2YTFA 2EN7A 2EP3A 2GHFA 4IS1C 2EOSA 1A1IA 1X5WA 2EPPA 1UN6B 4WSGA 2LT7A 2EMGA 1ZU1A 5KL7A 2ENCA 1YUIA 1P47A 2EOHA 4R2PA 2EM9A 1A1LA 4FK5C 2A25A 1TN9A 4R2SA 2EPCA 2WBUA 2EPAA 4X9JA 2EOEA 2WBSA 2EMHA 2EL6A 5KL6A 2ENAA 2EOQA 2EOIA 2EMFA 3MHHC 5KL3A 2EL5A 1A1HA 2EM2A 3EPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A1G A;  2DMI A;  2EQ0 A;  2EMC A;  2EML A;  2EM3 A;  2EMZ A;  2YTE A;  2YSO A;  2EM0 A;  4GZN C;  1BB8 A;  1YSA C;  2EPZ A;  2EN6 A;  2DLQ A;  2EN2 A;  2MDG A;  2YTQ A;  2YTP A;  2YRM A;  1ZR9 A;  2LV2 A;  2YU8 A;  1MEY C;  3MHS C;  3M99 B;  2I13 A;  2EN1 A;  2MKD A;  2MKN A;  2EM5 A;  2YSP A;  2JP9 A;  2EOF A;  3EPK A;  1ZAA C;  1RMD A;  1JK2 A;  2EMW A;  2EOX A;  1UBD C;  2LO3 A;  2HGH A;  4M9V C;  1KJK A;  4F2J C;  2ELZ A;  2EOZ A;  4F6M A;  2YTO A;  1Z1B A;  2EPU A;  2EMB A;  2EN8 A;  2LCE A;  2CSH A;  2EQ1 A;  4R2D A;  2YU5 A;  2PRT A;  4R2E A;  2EM4 A;  2RPC A;  2WBT A;  1F2I G;  1A1J A;  2EMK A;  1A1F A;  3VHT B;  1G2D C;  2EOJ A;  2GLI A;  2YTN A;  2ENH A;  2EOO A;  2EM7 A;  1X6H A;  2WCC 3;  1BBO A;  4R2C A;  2EL4 A;  2R1F A;  1TF3 A;  2ADR A;  1LLM C;  2J7J A;  1B69 A;  2EOY A;  2BB8 A;  1DGC A;  2YRK A;  4R2A A;  1X6E A;  2EMI A;  2YTJ A;  5KL5 A;  4R2R A;  1G2F C;  1WJP A;  3UK3 C;  2DRP A;  1A1K A;  3EPJ A;  1X3C A;  2CT1 A;  4F6N A;  4IJD A;  2CTD A;  4R2Q A;  1AAY A;  2D9H A;  2EMX A;  2EM6 A;  2YTI A;  2EMA A;  1JK1 A;  2VRD A;  2DLK A;  1X6F A;  2YTD A;  2EJ4 A;  2EMY A;  2E72 A;  2RSI A;  2NAB A;  2EN4 A;  2YTG A;  2EPR A;  2EOR A;  2JPA A;  2ELY A;  2LVH A;  5KL4 A;  3EPH A;  1NCS A;  2DGC A;  2EPX A;  1YUJ A;  2EM8 A;  5KL2 A;  2EOM A;  1TF6 A;  2EN3 A;  2M9A A;  2YRH A;  2EE8 A;  2EQ3 A;  2YTF A;  2EN7 A;  2EP3 A;  2GHF A;  4IS1 C;  2EOS A;  1A1I A;  1X5W A;  2EPP A;  1UN6 B;  4WSG A;  2LT7 A;  2EMG A;  1ZU1 A;  5KL7 A;  2ENC A;  1YUI A;  1P47 A;  2EOH A;  4R2P A;  2EM9 A;  1A1L A;  4FK5 C;  2A25 A;  1TN9 A;  4R2S A;  2EPC A;  2WBU A;  2EPA A;  4X9J A;  2EOE A;  2WBS A;  2EMH A;  2EL6 A;  5KL6 A;  2ENA A;  2EOQ A;  2EOI A;  2EMF A;  3MHH C;  5KL3 A;  2EL5 A;  1A1H A;  2EM2 A;  3EPL A; 
#chains in the Genus database with same CATH topology
 1A1G A;  2NUF A;  3VK6 A;  2EMZ A;  4GZN C;  1AH5 A;  2DLQ A;  2YTQ A;  2MDG A;  1GZ6 A;  2YTP A;  2ZM6 E;  4X64 E;  3JAM C;  2EN1 A;  4WSP A;  2MKN A;  2VQE E;  4JV5 E;  1KYQ A;  2EOF A;  4O4K A;  1BBG A;  2EOX A;  1UBD C;  4YHH E;  2UUA E;  4F2J C;  2V88 A;  1UHZ A;  1Z1B A;  1T4L B;  2EMB A;  2EN8 A;  2LCE A;  2YU5 A;  3HPS A;  1WRJ A;  2RQL A;  2V8Q B;  3LML A;  1F2I G;  3HXL A;  3F6H A;  2UU9 E;  2L2N A;  5AE2 A;  2ENH A;  4DR3 E;  1YFH A;  2EM7 A;  5AE1 A;  2MC6 A;  2M1S A;  4M30 A;  1BBO A;  1WHQ A;  2EL4 A;  4O24 A;  1YZ9 A;  2M7Q A;  5AAS A;  3VYY A;  2YRK A;  3KWR A;  4BBY A;  1WJP A;  4NXM E;  1A1K A;  3EPJ A;  4JI3 E;  4ZYE A;  5A69 A;  1I94 E;  3FIG A;  4KHP E;  4DV3 E;  5DNY A;  4IJD A;  2CTD A;  4R2Q A;  2D9H A;  5A6B D;  5T6J A;  2YTI A;  2VRD A;  2DLK A;  2EPN A;  2YTD A;  4F9C B;  4ZYD A;  2LBS B;  2RS7 A;  2YTG A;  2LJH A;  4DR2 E;  2JPA A;  2L8T A;  2N3G A;  3EPH A;  4JI7 E;  5A6A A;  5TSE A;  3AUZ A;  3EQ1 A;  5KL2 A;  2V86 A;  2K7I A;  4DKK A;  2EN3 A;  2M9A A;  5IXM B;  4LFB E;  2EE8 A;  4JI5 E;  2YTF A;  2LE2 A;  1GQE A;  4GEQ B;  1RQ0 A;  1UN6 B;  5KL7 A;  2MDR A;  2UUC E;  4RHB B;  4B3S E;  4WYQ B;  3MSW A;  4JI4 E;  2LMZ A;  1PJQ A;  2EOE A;  5BR8 E;  2JVA A;  2IHR 1;  5F3W A;  3MHH C;  4BS9 A;  2B9D A;  1O0W A;  2DIX A;  3EPL A;  2LTS A;  2DMI A;  3DJW A;  2KON A;  2EMC A;  2EML A;  2YTE A;  2EM0 A;  2LJU A;  1PDA A;  2EPZ A;  2EPK X;  2EN2 A;  3L00 A;  1FJG E;  4DUY E;  2EM5 A;  4DUZ E;  5AC4 A;  2L3J A;  1RMD A;  3C6K A;  2EMW A;  2Q8U A;  2HGH A;  4WXD A;  1EKZ A;  4K0K E;  4Q35 B;  2L6M A;  1IQS A;  2L92 A;  2EQ1 A;  3C4B A;  1SFE A;  2V83 A;  4RH8 A;  4R2E A;  2EM4 A;  2EMK A;  1A1F A;  3VHT B;  4X66 E;  1G2D C;  2YPN A;  2EOJ A;  2L2M A;  2GLI A;  4GKJ E;  2HJJ A;  1X6H A;  5A2Q C;  1WXR A;  4HTG A;  2J7J A;  2BB8 A;  1L4S A;  2DB2 A;  3KZY A;  4R2A A;  4AQY E;  2EPM X;  2FTX B;  1G2F C;  4JI2 E;  4L8N A;  1T38 A;  4DV4 E;  4LF6 E;  3H09 A;  4F6N A;  2LUP B;  1N36 E;  1AAY A;  2EMX A;  2B3T B;  4ZYG A;  2E72 A;  2RSI A;  2NAB A;  5IWA E;  1N32 E;  5FLX C;  4NHR A;  4MLQ A;  1NCS A;  2DGC A;  4WX9 A;  1J5E E;  1N33 E;  2EM8 A;  2V85 A;  4ZYH A;  4LF8 E;  4B3R E;  1RC7 A;  4BHB A;  3HPZ A;  2KHX A;  3BF2 A;  2EN7 A;  2EP3 A;  3JU0 A;  4P78 A;  2FV4 B;  2G7H A;  3THN A;  4WSG A;  2RSM A;  2LT7 A;  5ADZ A;  1ZU1 A;  1YUI A;  4NXN E;  3TQM A;  4F9A B;  2F8B A;  4WFT A;  2EPC A;  3OML A;  4LFA E;  1HNW E;  4X9J A;  2K4V A;  4TUG A;  2M4I A;  4O43 A;  4JYA E;  3ZOQ B;  3P1X A;  2RTX A;  2V89 A;  2N8X A;  2UXC E;  2EOI A;  2EMF A;  2ODR D;  5KL3 A;  4R2R A;  1A1H A;  1QNT A;  4DR4 E;  1HNZ E;  1SR9 A;  1GTK A;  4BCA A;  2YSO A;  4LF9 E;  4WXC A;  1YSA C;  2EN6 A;  4M9V C;  2JY9 A;  3HQ1 A;  3AV0 A;  1ZBQ A;  3MHS C;  4Q28 A;  1MEY C;  2MKD A;  4F54 A;  2DSY A;  2HHH E;  1T39 A;  2JP9 A;  3EPK A;  1ZAA C;  1JK2 A;  4DMI A;  2LO3 A;  1KJK A;  2UXB E;  2EOZ A;  2JOB A;  3F6G A;  4DR7 E;  3OTO E;  5LL6 R;  4F6M A;  2EPU A;  3T1H E;  4F9B B;  5CFF E;  2CSH A;  4HEI A;  2RPC A;  1X49 A;  2WBT A;  1A1J A;  4YY3 E;  2N3H A;  4DV1 E;  4I8O A;  2YTN A;  4N4R B;  1XMQ E;  1IMU A;  1ZBT A;  2EOO A;  3IWD A;  2E5L E;  4M0V A;  2WCC 3;  2R1F A;  3QG5 C;  1TF3 A;  2EOY A;  1X6E A;  2EMI A;  2YTJ A;  4O5G A;  2NUG A;  5KL5 A;  1IBM E;  4DR1 E;  2I9I A;  3IWB A;  3BID A;  4X8W A;  2EZ6 A;  2EPL X;  1N3G A;  4L5N C;  2CT1 A;  3C4T A;  4KZS A;  2EM6 A;  2YWQ A;  2EMA A;  2L3C A;  5IT9 C;  4P7D A;  1X6F A;  4R8O A;  4DV6 E;  2F4V E;  2VQF E;  4BHC A;  2NUE A;  2LRS A;  2LUQ A;  3ADJ A;  1EH7 A;  2YT4 A;  2NA2 A;  2EPX A;  1HR0 E;  1YUJ A;  4X62 E;  4OOG C;  3ECR A;  4TUI A;  1UIL A;  4BC7 A;  4DV0 E;  2YRH A;  5IV8 B;  2LTR A;  1EH8 A;  2EQ3 A;  2WZO A;  3K6Q A;  2GPI A;  2L2K B;  2R76 A;  4IS1 C;  2EOS A;  4DV5 E;  5AE3 A;  2KOU A;  3BBG A;  2ENC A;  1P47 A;  2EM9 A;  4BC9 A;  1A1L A;  4FK5 C;  3J81 C;  5LMU E;  2EPA A;  2L33 A;  4JI0 E;  5A6B A;  2EMH A;  2EL6 A;  4LU9 A;  5KL6 A;  2ENA A;  4B3T E;  1PJS A;  2FGG A;  2B7T A;  2PRT A;  2EL5 A;  2EM2 A;  3JTZ A;  2YZT A;  3T1Y E;  2EQ0 A;  4JI1 E;  2EM3 A;  4DR6 E;  2H36 X;  4NZV A;  2B7V A;  2VF1 A;  1BB8 A;  3VYX A;  2YRM A;  4DV2 E;  1ZR9 A;  2LV2 A;  1PKP A;  2YU8 A;  1X48 A;  3M99 B;  5A6J A;  2I13 A;  1IBL E;  1X47 A;  3C6M A;  4LFC E;  2YSP A;  4LF4 E;  1STU A;  1FKA E;  3DF6 A;  2EWL A;  3IWC A;  4JI8 E;  3HTX A;  2ELZ A;  1NEI A;  2ODR C;  3J7A G;  2YTO A;  4OX9 E;  3ADL A;  3ADG A;  4R2D A;  5LMN E;  2V87 A;  4BMJ A;  2JXP A;  1DQ3 A;  4WPY A;  2UUB E;  1MGT A;  4JI6 E;  3ADI A;  2RS6 A;  4R2C A;  5A6K A;  2ADR A;  2JWO A;  1LLM C;  1B69 A;  1T4N A;  1DGC A;  2DMY A;  1IBK E;  2E1M A;  3J7Y p;  2DRP A;  3UK3 C;  1QU6 A;  1X3C A;  4X65 E;  2EPO A;  3BGH A;  1WHN A;  1J26 A;  1YYO A;  3J80 C;  2HC5 A;  4B3M E;  2JYA A;  4KWY A;  1JK1 A;  1IQO A;  2EJ4 A;  2EMY A;  2EN4 A;  4M2Z A;  1EH6 A;  2EPR A;  2EOR A;  2ELY A;  4GKK E;  2LVH A;  5KL4 A;  2JR1 A;  1XMO E;  4DV7 E;  1HNX E;  1T4O A;  1PJT A;  3LLH A;  2EOM A;  4J8Z A;  1XNQ E;  1TF6 A;  1YYW A;  5LLQ A;  5AC5 A;  3KZZ A;  1N34 E;  2GHF A;  1YYK A;  1A1I A;  1X5W A;  2EPP A;  4DR5 E;  2EMG A;  2EOH A;  1DI2 A;  4R2P A;  1XNR E;  4LF5 E;  2A25 A;  1TN9 A;  1YPN A;  4R2S A;  3THO B;  2BBG A;  2WBU A;  2WBS A;  4R03 A;  4LF7 E;  2UXD E;  2CPN A;  2VE7 C;  2JOX A;  2EOQ A;  3RMP A;  2MC5 A;  4LTY A;  4MLV A; 
#chains in the Genus database with same CATH homology
 1A1G A;  2DMI A;  2EQ0 A;  2EMC A;  2EML A;  2EM3 A;  2EMZ A;  2YTE A;  2YSO A;  2EM0 A;  4GZN C;  1BB8 A;  1YSA C;  2EPZ A;  2EN6 A;  2DLQ A;  2EN2 A;  2MDG A;  2YTQ A;  2YTP A;  2YRM A;  1ZR9 A;  2LV2 A;  2YU8 A;  1MEY C;  3MHS C;  3M99 B;  2I13 A;  2EN1 A;  2MKD A;  2MKN A;  2EM5 A;  2YSP A;  2JP9 A;  2EOF A;  3EPK A;  1ZAA C;  1RMD A;  1JK2 A;  2EMW A;  2EOX A;  1UBD C;  2LO3 A;  2HGH A;  4M9V C;  1KJK A;  4F2J C;  2ELZ A;  2EOZ A;  4F6M A;  2YTO A;  1Z1B A;  2EPU A;  2EMB A;  2EN8 A;  2LCE A;  2CSH A;  2EQ1 A;  4R2D A;  2YU5 A;  2PRT A;  4R2E A;  2EM4 A;  2RPC A;  2WBT A;  1F2I G;  1A1J A;  2EMK A;  1A1F A;  3VHT B;  1G2D C;  2EOJ A;  2GLI A;  2YTN A;  2ENH A;  2EOO A;  2EM7 A;  1X6H A;  2WCC 3;  1BBO A;  4R2C A;  2EL4 A;  2R1F A;  1TF3 A;  2ADR A;  1LLM C;  2J7J A;  1B69 A;  2EOY A;  2BB8 A;  1DGC A;  2YRK A;  4R2A A;  1X6E A;  2EMI A;  2YTJ A;  5KL5 A;  4R2R A;  1G2F C;  1WJP A;  3UK3 C;  2DRP A;  1A1K A;  3EPJ A;  1X3C A;  2CT1 A;  4F6N A;  4IJD A;  2CTD A;  4R2Q A;  1AAY A;  2D9H A;  2EMX A;  2EM6 A;  2YTI A;  2EMA A;  1JK1 A;  2VRD A;  2DLK A;  1X6F A;  2YTD A;  2EJ4 A;  2EMY A;  2E72 A;  2RSI A;  2NAB A;  2EN4 A;  2YTG A;  2EPR A;  2EOR A;  2JPA A;  2ELY A;  2LVH A;  5KL4 A;  3EPH A;  1NCS A;  2DGC A;  2EPX A;  1YUJ A;  2EM8 A;  5KL2 A;  2EOM A;  1TF6 A;  2EN3 A;  2M9A A;  2YRH A;  2EE8 A;  2EQ3 A;  2YTF A;  2EN7 A;  2EP3 A;  2GHF A;  4IS1 C;  2EOS A;  1A1I A;  1X5W A;  2EPP A;  1UN6 B;  4WSG A;  2LT7 A;  2EMG A;  1ZU1 A;  5KL7 A;  2ENC A;  1YUI A;  1P47 A;  2EOH A;  4R2P A;  2EM9 A;  1A1L A;  4FK5 C;  2A25 A;  1TN9 A;  4R2S A;  2EPC A;  2WBU A;  2EPA A;  4X9J A;  2EOE A;  2WBS A;  2EMH A;  2EL6 A;  5KL6 A;  2ENA A;  2EOQ A;  2EOI A;  2EMF A;  3MHH C;  5KL3 A;  2EL5 A;  1A1H A;  2EM2 A;  3EPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...