2JP9A

Structure of the wilms tumor suppressor protein zinc finger domain bound to dna
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
119
structure length
119
Chain Sequence
b'ASEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(P*DCP*DGP*DCP*DGP*DGP*DGP*DGP*DGP*DCP*DGP*DTP*DCP*
publication title Structure of the wilms tumor suppressor protein zinc finger domain bound to DNA
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 42
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2jp9A01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2jp9A03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2jp9A02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2jp9A04
2EN6A 1BB8A 2YSOA 2CT1A 2D9HA 2ENHA 2MDGA 3VHTB 2ENCA 2EL6A 2EP3A 2M9AA 4M9VC 3EPHA 2LCEA 2YTPA 2WCC3 2A25A 2EOFA 2LT7A 1A1JA 2EPAA 2GHFA 1TF6A 2YRMA 1JK1A 2LVHA 1X5WA 1X6FA 4R2PA 2MKNA 1YSAC 2EMAA 2EOXA 4IS1C 2EM3A 2EMWA 1JK2A 2EM0A 2DGCA 5KL2A 2YTFA 2EMKA 2ENAA 4X9JA 1LLMC 3MHHC 2I13A 2DMIA 2EM9A 4R2DA 2LV2A 2YSPA 2EPCA 2EMHA 2R1FA 2VRDA 2YRHA 1YUJA 1B69A 2EORA 2YTOA 2EMIA 1G2DC 2YTJA 2EM5A 3EPJA 1WJPA 2EMCA 1MEYC 2DLKA 2BB8A 4R2CA 1NCSA 3UK3C 2HGHA 2EPXA 1DGCA 5KL4A 4FK5C 2DLQA 2EOJA 5KL5A 2PRTA 1A1IA 4F2JC 2EM4A 4R2QA 2YRKA 2EOIA 2EQ0A 2EM6A 1TF3A 2EMBA 2EPZA 2DRPA 2WBSA 2GLIA 2LO3A 1TN9A 1ZU1A 2EOOA 2EMLA 2YTGA 2EOEA 3M99B 2EOSA 2RPCA 2CTDA 2EN8A 2EL4A 2EOMA 4R2AA 2YTQA 2EPPA 2JP9A 1BBOA 1UN6B 2EN1A 2EN7A 1X6EA 2EM2A 2EMYA 2ADRA 1AAYA 2YTDA 2EOQA 2EQ1A 4GZNC 4WSGA 2EMFA 2EMZA 1X3CA 2EN3A 2EPUA 1P47A 2EJ4A 1A1LA 5KL3A 2YTEA 1Z1BA 2EOZA 1KJKA 2YTIA 2EOYA 2CSHA 1F2IG 1ZAAC 2EOHA 5KL6A 3EPLA 2YU8A 3MHSC 4IJDA 1A1FA 2E72A 2EL5A 4R2SA 2MKDA 2YTNA 1G2FC 2EMXA 1A1HA 2J7JA 4R2EA 4F6NA 2EPRA 2WBTA 2EQ3A 2YU5A 2ELZA 4F6MA 2EN2A 2EM8A 1UBDC 2RSIA 2EE8A 2WBUA 5KL7A 2NABA 2EN4A 1X6HA 2EMGA 1ZR9A 2JPAA 4R2RA 1A1GA 2ELYA 1A1KA 3EPKA 1RMDA 2EM7A 1YUIA
chains in the Genus database with same CATH superfamily
4LU9A 3J81C 2YSOA 3JAMC 4P78A 2N8XA 4DV0E 2Q8UA 2ENCA 2EP3A 4Q35B 4JYAE 2UXBE 4M9VC 5IV8B 2KOUA 4GEQB 2EOFA 4DKKA 1A1JA 2EPOA 2LMZA 2LE2A 4X62E 4LTYA 2VF1A 4DR5E 5F3WA 1SFEA 2MKNA 4HTGA 1YSAC 5T6JA 2FTXB 4NHRA 2BBGA 2KONA 2YTFA 4MLQA 4O24A 4X9JA 5ADZA 2I13A 3VK6A 2LV2A 2YSPA 2JVAA 1HNXE 4JI4E 2G7HA 5CFFE 3ADIA 1STUA 4AQYE 3KZYA 1XMOE 4JI7E 2BB8A 4R2CA 3UK3C 2HGHA 1DGCA 5KL4A 4DR1E 2EOJA 1N36E 1A1IA 4F2JC 5AASA 4O5GA 2LJUA 5A6AA 2LO3A 1TN9A 1IQOA 3M99B 3F6GA 1GZ6A 1WHQA 4L8NA 2EN8A 2EPPA 1UN6B 1XMQE 1WRJA 2EM2A 4DMIA 2ADRA 1AAYA 3HPZA 1EKZA 2EMFA 4JI8E 5A6BA 2EPUA 2LTSA 2RS7A 4TUGA 4DV1E 3OMLA 1XNRE 5LL6R 2M7QA 4BC9A 2YTIA 1N3GA 2EZ6A 4JI0E 3J7AG 2UXCE 1N34E 2YZTA 1RC7A 2F4VE 2E1MA 2NUFA 4LF6E 2EL5A 3HTXA 4M30A 1A1HA 1N32E 3QG5C 2L8TA 2UUBE 4B3ME 4GKJE 4DV7E 2EQ3A 4Q28A 4F6MA 2RSIA 3HXLA 5KL7A 5AE2A 2EPKX 2EMGA 1A1GA 4YY3E 2MC6A 1J26A 5A6JA 1X49A 1AH5A 2DIXA 2CPNA 3ECRA 4F9AB 1BB8A 2K7IA 3IWBA 2ENHA 4ZYDA 2L3JA 3EPHA 5A6KA 2JR1A 2WZOA 1T4NA 2YTPA 2WCC3 4DV6E 2LT7A 1MGTA 2YRMA 1X5WA 3ADGA 1UHZA 3BIDA 3THOB 5A6BD 4IS1C 4ZYEA 2EM0A 5TSEA 2VQFE 4DUZE 3IWDA 1LLMC 3C6KA 2DMIA 4R2DA 2YT4A 2EMHA 4YHHE 1FKAE 1YUJA 1B69A 1IMUA 4DR7E 2YTOA 2MDRA 2EMIA 2M4IA 5DNYA 2IHR1 1G2DC 2JWOA 1MEYC 2DLKA 3HQ1A 4DR3E 4N4RB 5BR8E 1ZBQA 2YRKA 4BHCA 2EQ0A 4BC7A 2NUEA 2YWQA 4LF4E 1HNWE 2GLIA 2UUAE 5IWAE 2MC5A 4L5NC 4JI3E 2RPCA 4R2AA 4LFAE 2JP9A 1BBOA 4BMJA 1EH8A 1X6EA 2EMYA 4DV2E 4B3TE 3BBGA 4MLVA 2EQ1A 4WSGA 3KWRA 4R03A 2EMZA 2H36X 2L33A 4LF8E 2EPMX 4JI5E 5KL3A 2HHHE 1Z1BA 2EOZA 1KJKA 1PJQA 2M1SA 1NEIA 1ZAAC 1GQEA 2EOHA 3RMPA 3ADLA 2V8QB 4M2ZA 1X47A 1A1FA 2E72A 2N3HA 5LLQA 1G2FC 3BF2A 2JYAA 4WPYA 2HJJA 2RS6A 2WBTA 2NUGA 1UBDC 1PJTA 2EE8A 1QNTA 4JI2E 4BCAA 2FGGA 2DMYA 4DR2E 3C4TA 4R2RA 4DV5E 2L2MA 4B3RE 3LMLA 3KZZA 2JXPA 2V87A 4J8ZA 1A1KA 4R8OA 2EM7A 1PJSA 4LFBE 2EN6A 3T1YE 2V83A 2CT1A 2D9HA 4ZYHA 1PKPA 4BS9A 3EQ1A 3VHTB 2EPNA 2KHXA 2V88A 4OOGC 2GHFA 4KZSA 1JK1A 2LVHA 1X6FA 1XNQE 2K4VA 1L4SA 2EM3A 2VQEE 2LTRA 1YYKA 1FJGE 2EMKA 4HEIA 4LFCE 3MHHC 5LMNE 2EM9A 2EPCA 2EWLA 2R1FA 3DF6A 4B3SE 4NZVA 4X8WA 2YTJA 2EM5A 3EPJA 1WJPA 1T4LB 1WHNA 2JOBA 2ODRC 4M0VA 2LJHA 4FK5C 4BHBA 2DLQA 2PRTA 1HR0E 2V85A 2GPIA 2LUQA 2EOIA 2B7VA 2EM6A 2R76A 2EPZA 4X64E 1IBKE 2WBSA 2DRPA 2VE7C 3C6MA 2EMLA 2YTGA 2LRSA 4DV3E 2UU9E 3FIGA 2EOEA 4WXDA 3BGHA 1YYWA 4JV5E 3JU0A 2ODRD 2YTQA 4RH8A 3THNA 2V89A 5AE1A 3AUZA 1I94E 4GZNC 2FV4B 1DQ3A 1EH6A 1X3CA 2EN3A 1P47A 1A1LA 3AV0A 2YTEA 1T39A 2LUPB 4KHPE 2V86A 1EH7A 4OX9E 2CSHA 1F2IG 3K6QA 3ADJA 5KL6A 4IJDA 2L6MA 4DR4E 1RQ0A 4R2SA 2MKDA 3HPSA 1DI2A 4F6NA 1YFHA 2EN2A 2EM8A 1PDAA 2RSMA 3P1XA 3OTOE 4WX9A 2EN4A 4O4KA 4LF9E 1X6HA 5AC5A 3F6HA 1X48A 4F9CB 1IBLE 1RMDA 4NXNE 1YUIA 4RHBB 5AE3A 2DSYA 1N33E 3MSWA 4GKKE 2L2NA 2ZM6E 3VYYA 2MDGA 2EL6A 1WXRA 2LCEA 5A69A 4X65E 3T1HE 4JI6E 2A25A 2RQLA 2EPAA 2B3TB 4P7DA 1TF6A 2EPLX 4R2PA 2I9IA 1O0WA 2EMAA 2EOXA 2F8BA 2JOXA 2EMWA 1JK2A 4WFTA 2DGCA 2B9DA 5KL2A 2N3GA 1T4OA 2YPNA 3J7Yp 2ENAA 4TUIA 4DV4E 5LMUE 4K0KE 4NXME 2VRDA 2YRHA 2EORA 1J5EE 2B7TA 1YZ9A 2EMCA 2L92A 3DJWA 1NCSA 2EPXA 2RTXA 5KL5A 2EM4A 4R2QA 1TF3A 4WYQB 3L00A 2EMBA 4ZYGA 5A2QC 4WSPA 2LBSB 1YYOA 1KYQA 1HNZE 1ZU1A 2EOOA 3JTZA 4O43A 4LF7E 3LLHA 4WXCA 1IQSA 2EOSA 2CTDA 2EL4A 2EOMA 2EN1A 3C4BA 2EN7A 2E5LE 4F54A 2L2KB 2YTDA 2EOQA 5IT9C 4LF5E 4KWYA 2EJ4A 4DR6E 2NA2A 4I8OA 4F9BB 2EOYA 2UUCE 1SR9A 1GTKA 2L3CA 1IBME 3EPLA 2YU8A 1ZBTA 3J80C 3MHSC 1QU6A 2YTNA 1UILA 5IXMB 2UXDE 3ZOQB 5AC4A 2EMXA 2J7JA 4R2EA 5FLXC 1YPNA 1BBGA 2DB2A 2EPRA 3H09A 2YU5A 2ELZA 3VYXA 4JI1E 2JY9A 1T38A 4DUYE 4X66E 2WBUA 3TQMA 2NABA 2JPAA 1ZR9A 4BBYA 2ELYA 2HC5A 3EPKA 3IWCA 2M9AA
chains in the Genus database with same CATH topology
2EN6A 1BB8A 2YSOA 2CT1A 2D9HA 2ENHA 2MDGA 3VHTB 2ENCA 2EL6A 2EP3A 2M9AA 4M9VC 3EPHA 2LCEA 2YTPA 2WCC3 2A25A 2EOFA 2LT7A 1A1JA 2EPAA 2GHFA 1TF6A 2YRMA 1JK1A 2LVHA 1X5WA 1X6FA 4R2PA 2MKNA 1YSAC 2EMAA 2EOXA 4IS1C 2EM3A 2EMWA 1JK2A 2EM0A 2DGCA 5KL2A 2YTFA 2EMKA 2ENAA 4X9JA 1LLMC 3MHHC 2I13A 2DMIA 2EM9A 4R2DA 2LV2A 2YSPA 2EPCA 2EMHA 2R1FA 2VRDA 2YRHA 1YUJA 1B69A 2EORA 2YTOA 2EMIA 1G2DC 2YTJA 2EM5A 3EPJA 1WJPA 2EMCA 1MEYC 2DLKA 2BB8A 4R2CA 1NCSA 3UK3C 2HGHA 2EPXA 1DGCA 5KL4A 4FK5C 2DLQA 2EOJA 5KL5A 2PRTA 1A1IA 4F2JC 2EM4A 4R2QA 2YRKA 2EOIA 2EQ0A 2EM6A 1TF3A 2EMBA 2EPZA 2DRPA 2WBSA 2GLIA 2LO3A 1TN9A 1ZU1A 2EOOA 2EMLA 2YTGA 2EOEA 3M99B 2EOSA 2RPCA 2CTDA 2EN8A 2EL4A 2EOMA 4R2AA 2YTQA 2EPPA 2JP9A 1BBOA 1UN6B 2EN1A 2EN7A 1X6EA 2EM2A 2EMYA 2ADRA 1AAYA 2YTDA 2EOQA 2EQ1A 4GZNC 4WSGA 2EMFA 2EMZA 1X3CA 2EN3A 2EPUA 1P47A 2EJ4A 1A1LA 5KL3A 2YTEA 1Z1BA 2EOZA 1KJKA 2YTIA 2EOYA 2CSHA 1F2IG 1ZAAC 2EOHA 5KL6A 3EPLA 2YU8A 3MHSC 4IJDA 1A1FA 2E72A 2EL5A 4R2SA 2MKDA 2YTNA 1G2FC 2EMXA 1A1HA 2J7JA 4R2EA 4F6NA 2EPRA 2WBTA 2EQ3A 2YU5A 2ELZA 4F6MA 2EN2A 2EM8A 1UBDC 2RSIA 2EE8A 2WBUA 5KL7A 2NABA 2EN4A 1X6HA 2EMGA 1ZR9A 2JPAA 4R2RA 1A1GA 2ELYA 1A1KA 3EPKA 1RMDA 2EM7A 1YUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EN6 A;  1BB8 A;  2YSO A;  2CT1 A;  2D9H A;  2ENH A;  2MDG A;  3VHT B;  2ENC A;  2EL6 A;  2EP3 A;  2M9A A;  4M9V C;  3EPH A;  2LCE A;  2YTP A;  2WCC 3;  2A25 A;  2EOF A;  2LT7 A;  1A1J A;  2EPA A;  2GHF A;  1TF6 A;  2YRM A;  1JK1 A;  2LVH A;  1X5W A;  1X6F A;  4R2P A;  2MKN A;  1YSA C;  2EMA A;  2EOX A;  4IS1 C;  2EM3 A;  2EMW A;  1JK2 A;  2EM0 A;  2DGC A;  5KL2 A;  2YTF A;  2EMK A;  2ENA A;  4X9J A;  1LLM C;  3MHH C;  2I13 A;  2DMI A;  2EM9 A;  4R2D A;  2LV2 A;  2YSP A;  2EPC A;  2EMH A;  2R1F A;  2VRD A;  2YRH A;  1YUJ A;  1B69 A;  2EOR A;  2YTO A;  2EMI A;  1G2D C;  2YTJ A;  2EM5 A;  3EPJ A;  1WJP A;  2EMC A;  1MEY C;  2DLK A;  2BB8 A;  4R2C A;  1NCS A;  3UK3 C;  2HGH A;  2EPX A;  1DGC A;  5KL4 A;  4FK5 C;  2DLQ A;  2EOJ A;  5KL5 A;  2PRT A;  1A1I A;  4F2J C;  2EM4 A;  4R2Q A;  2YRK A;  2EOI A;  2EQ0 A;  2EM6 A;  1TF3 A;  2EMB A;  2EPZ A;  2DRP A;  2WBS A;  2GLI A;  2LO3 A;  1TN9 A;  1ZU1 A;  2EOO A;  2EML A;  2YTG A;  2EOE A;  3M99 B;  2EOS A;  2RPC A;  2CTD A;  2EN8 A;  2EL4 A;  2EOM A;  4R2A A;  2YTQ A;  2EPP A;  2JP9 A;  1BBO A;  1UN6 B;  2EN1 A;  2EN7 A;  1X6E A;  2EM2 A;  2EMY A;  2ADR A;  1AAY A;  2YTD A;  2EOQ A;  2EQ1 A;  4GZN C;  4WSG A;  2EMF A;  2EMZ A;  1X3C A;  2EN3 A;  2EPU A;  1P47 A;  2EJ4 A;  1A1L A;  5KL3 A;  2YTE A;  1Z1B A;  2EOZ A;  1KJK A;  2YTI A;  2EOY A;  2CSH A;  1F2I G;  1ZAA C;  2EOH A;  5KL6 A;  3EPL A;  2YU8 A;  3MHS C;  4IJD A;  1A1F A;  2E72 A;  2EL5 A;  4R2S A;  2MKD A;  2YTN A;  1G2F C;  2EMX A;  1A1H A;  2J7J A;  4R2E A;  4F6N A;  2EPR A;  2WBT A;  2EQ3 A;  2YU5 A;  2ELZ A;  4F6M A;  2EN2 A;  2EM8 A;  1UBD C;  2RSI A;  2EE8 A;  2WBU A;  5KL7 A;  2NAB A;  2EN4 A;  1X6H A;  2EMG A;  1ZR9 A;  2JPA A;  4R2R A;  1A1G A;  2ELY A;  1A1K A;  3EPK A;  1RMD A;  2EM7 A;  1YUI A; 
#chains in the Genus database with same CATH topology
 4LU9 A;  3J81 C;  2YSO A;  3JAM C;  4P78 A;  2N8X A;  4DV0 E;  2Q8U A;  2ENC A;  2EP3 A;  4Q35 B;  4JYA E;  2UXB E;  4M9V C;  5IV8 B;  2KOU A;  4GEQ B;  2EOF A;  4DKK A;  1A1J A;  2EPO A;  2LMZ A;  2LE2 A;  4X62 E;  4LTY A;  2VF1 A;  4DR5 E;  5F3W A;  1SFE A;  2MKN A;  4HTG A;  1YSA C;  5T6J A;  2FTX B;  4NHR A;  2BBG A;  2KON A;  2YTF A;  4MLQ A;  4O24 A;  4X9J A;  5ADZ A;  2I13 A;  3VK6 A;  2LV2 A;  2YSP A;  2JVA A;  1HNX E;  4JI4 E;  2G7H A;  5CFF E;  3ADI A;  1STU A;  4AQY E;  3KZY A;  1XMO E;  4JI7 E;  2BB8 A;  4R2C A;  3UK3 C;  2HGH A;  1DGC A;  5KL4 A;  4DR1 E;  2EOJ A;  1N36 E;  1A1I A;  4F2J C;  5AAS A;  4O5G A;  2LJU A;  5A6A A;  2LO3 A;  1TN9 A;  1IQO A;  3M99 B;  3F6G A;  1GZ6 A;  1WHQ A;  4L8N A;  2EN8 A;  2EPP A;  1UN6 B;  1XMQ E;  1WRJ A;  2EM2 A;  4DMI A;  2ADR A;  1AAY A;  3HPZ A;  1EKZ A;  2EMF A;  4JI8 E;  5A6B A;  2EPU A;  2LTS A;  2RS7 A;  4TUG A;  4DV1 E;  3OML A;  1XNR E;  5LL6 R;  2M7Q A;  4BC9 A;  2YTI A;  1N3G A;  2EZ6 A;  4JI0 E;  3J7A G;  2UXC E;  1N34 E;  2YZT A;  1RC7 A;  2F4V E;  2E1M A;  2NUF A;  4LF6 E;  2EL5 A;  3HTX A;  4M30 A;  1A1H A;  1N32 E;  3QG5 C;  2L8T A;  2UUB E;  4B3M E;  4GKJ E;  4DV7 E;  2EQ3 A;  4Q28 A;  4F6M A;  2RSI A;  3HXL A;  5KL7 A;  5AE2 A;  2EPK X;  2EMG A;  1A1G A;  4YY3 E;  2MC6 A;  1J26 A;  5A6J A;  1X49 A;  1AH5 A;  2DIX A;  2CPN A;  3ECR A;  4F9A B;  1BB8 A;  2K7I A;  3IWB A;  2ENH A;  4ZYD A;  2L3J A;  3EPH A;  5A6K A;  2JR1 A;  2WZO A;  1T4N A;  2YTP A;  2WCC 3;  4DV6 E;  2LT7 A;  1MGT A;  2YRM A;  1X5W A;  3ADG A;  1UHZ A;  3BID A;  3THO B;  5A6B D;  4IS1 C;  4ZYE A;  2EM0 A;  5TSE A;  2VQF E;  4DUZ E;  3IWD A;  1LLM C;  3C6K A;  2DMI A;  4R2D A;  2YT4 A;  2EMH A;  4YHH E;  1FKA E;  1YUJ A;  1B69 A;  1IMU A;  4DR7 E;  2YTO A;  2MDR A;  2EMI A;  2M4I A;  5DNY A;  2IHR 1;  1G2D C;  2JWO A;  1MEY C;  2DLK A;  3HQ1 A;  4DR3 E;  4N4R B;  5BR8 E;  1ZBQ A;  2YRK A;  4BHC A;  2EQ0 A;  4BC7 A;  2NUE A;  2YWQ A;  4LF4 E;  1HNW E;  2GLI A;  2UUA E;  5IWA E;  2MC5 A;  4L5N C;  4JI3 E;  2RPC A;  4R2A A;  4LFA E;  2JP9 A;  1BBO A;  4BMJ A;  1EH8 A;  1X6E A;  2EMY A;  4DV2 E;  4B3T E;  3BBG A;  4MLV A;  2EQ1 A;  4WSG A;  3KWR A;  4R03 A;  2EMZ A;  2H36 X;  2L33 A;  4LF8 E;  2EPM X;  4JI5 E;  5KL3 A;  2HHH E;  1Z1B A;  2EOZ A;  1KJK A;  1PJQ A;  2M1S A;  1NEI A;  1ZAA C;  1GQE A;  2EOH A;  3RMP A;  3ADL A;  2V8Q B;  4M2Z A;  1X47 A;  1A1F A;  2E72 A;  2N3H A;  5LLQ A;  1G2F C;  3BF2 A;  2JYA A;  4WPY A;  2HJJ A;  2RS6 A;  2WBT A;  2NUG A;  1UBD C;  1PJT A;  2EE8 A;  1QNT A;  4JI2 E;  4BCA A;  2FGG A;  2DMY A;  4DR2 E;  3C4T A;  4R2R A;  4DV5 E;  2L2M A;  4B3R E;  3LML A;  3KZZ A;  2JXP A;  2V87 A;  4J8Z A;  1A1K A;  4R8O A;  2EM7 A;  1PJS A;  4LFB E;  2EN6 A;  3T1Y E;  2V83 A;  2CT1 A;  2D9H A;  4ZYH A;  1PKP A;  4BS9 A;  3EQ1 A;  3VHT B;  2EPN A;  2KHX A;  2V88 A;  4OOG C;  2GHF A;  4KZS A;  1JK1 A;  2LVH A;  1X6F A;  1XNQ E;  2K4V A;  1L4S A;  2EM3 A;  2VQE E;  2LTR A;  1YYK A;  1FJG E;  2EMK A;  4HEI A;  4LFC E;  3MHH C;  5LMN E;  2EM9 A;  2EPC A;  2EWL A;  2R1F A;  3DF6 A;  4B3S E;  4NZV A;  4X8W A;  2YTJ A;  2EM5 A;  3EPJ A;  1WJP A;  1T4L B;  1WHN A;  2JOB A;  2ODR C;  4M0V A;  2LJH A;  4FK5 C;  4BHB A;  2DLQ A;  2PRT A;  1HR0 E;  2V85 A;  2GPI A;  2LUQ A;  2EOI A;  2B7V A;  2EM6 A;  2R76 A;  2EPZ A;  4X64 E;  1IBK E;  2WBS A;  2DRP A;  2VE7 C;  3C6M A;  2EML A;  2YTG A;  2LRS A;  4DV3 E;  2UU9 E;  3FIG A;  2EOE A;  4WXD A;  3BGH A;  1YYW A;  4JV5 E;  3JU0 A;  2ODR D;  2YTQ A;  4RH8 A;  3THN A;  2V89 A;  5AE1 A;  3AUZ A;  1I94 E;  4GZN C;  2FV4 B;  1DQ3 A;  1EH6 A;  1X3C A;  2EN3 A;  1P47 A;  1A1L A;  3AV0 A;  2YTE A;  1T39 A;  2LUP B;  4KHP E;  2V86 A;  1EH7 A;  4OX9 E;  2CSH A;  1F2I G;  3K6Q A;  3ADJ A;  5KL6 A;  4IJD A;  2L6M A;  4DR4 E;  1RQ0 A;  4R2S A;  2MKD A;  3HPS A;  1DI2 A;  4F6N A;  1YFH A;  2EN2 A;  2EM8 A;  1PDA A;  2RSM A;  3P1X A;  3OTO E;  4WX9 A;  2EN4 A;  4O4K A;  4LF9 E;  1X6H A;  5AC5 A;  3F6H A;  1X48 A;  4F9C B;  1IBL E;  1RMD A;  4NXN E;  1YUI A;  4RHB B;  5AE3 A;  2DSY A;  1N33 E;  3MSW A;  4GKK E;  2L2N A;  2ZM6 E;  3VYY A;  2MDG A;  2EL6 A;  1WXR A;  2LCE A;  5A69 A;  4X65 E;  3T1H E;  4JI6 E;  2A25 A;  2RQL A;  2EPA A;  2B3T B;  4P7D A;  1TF6 A;  2EPL X;  4R2P A;  2I9I A;  1O0W A;  2EMA A;  2EOX A;  2F8B A;  2JOX A;  2EMW A;  1JK2 A;  4WFT A;  2DGC A;  2B9D A;  5KL2 A;  2N3G A;  1T4O A;  2YPN A;  3J7Y p;  2ENA A;  4TUI A;  4DV4 E;  5LMU E;  4K0K E;  4NXM E;  2VRD A;  2YRH A;  2EOR A;  1J5E E;  2B7T A;  1YZ9 A;  2EMC A;  2L92 A;  3DJW A;  1NCS A;  2EPX A;  2RTX A;  5KL5 A;  2EM4 A;  4R2Q A;  1TF3 A;  4WYQ B;  3L00 A;  2EMB A;  4ZYG A;  5A2Q C;  4WSP A;  2LBS B;  1YYO A;  1KYQ A;  1HNZ E;  1ZU1 A;  2EOO A;  3JTZ A;  4O43 A;  4LF7 E;  3LLH A;  4WXC A;  1IQS A;  2EOS A;  2CTD A;  2EL4 A;  2EOM A;  2EN1 A;  3C4B A;  2EN7 A;  2E5L E;  4F54 A;  2L2K B;  2YTD A;  2EOQ A;  5IT9 C;  4LF5 E;  4KWY A;  2EJ4 A;  4DR6 E;  2NA2 A;  4I8O A;  4F9B B;  2EOY A;  2UUC E;  1SR9 A;  1GTK A;  2L3C A;  1IBM E;  3EPL A;  2YU8 A;  1ZBT A;  3J80 C;  3MHS C;  1QU6 A;  2YTN A;  1UIL A;  5IXM B;  2UXD E;  3ZOQ B;  5AC4 A;  2EMX A;  2J7J A;  4R2E A;  5FLX C;  1YPN A;  1BBG A;  2DB2 A;  2EPR A;  3H09 A;  2YU5 A;  2ELZ A;  3VYX A;  4JI1 E;  2JY9 A;  1T38 A;  4DUY E;  4X66 E;  2WBU A;  3TQM A;  2NAB A;  2JPA A;  1ZR9 A;  4BBY A;  2ELY A;  2HC5 A;  3EPK A;  3IWC A;  2M9A A; 
#chains in the Genus database with same CATH homology
 2EN6 A;  1BB8 A;  2YSO A;  2CT1 A;  2D9H A;  2ENH A;  2MDG A;  3VHT B;  2ENC A;  2EL6 A;  2EP3 A;  2M9A A;  4M9V C;  3EPH A;  2LCE A;  2YTP A;  2WCC 3;  2A25 A;  2EOF A;  2LT7 A;  1A1J A;  2EPA A;  2GHF A;  1TF6 A;  2YRM A;  1JK1 A;  2LVH A;  1X5W A;  1X6F A;  4R2P A;  2MKN A;  1YSA C;  2EMA A;  2EOX A;  4IS1 C;  2EM3 A;  2EMW A;  1JK2 A;  2EM0 A;  2DGC A;  5KL2 A;  2YTF A;  2EMK A;  2ENA A;  4X9J A;  1LLM C;  3MHH C;  2I13 A;  2DMI A;  2EM9 A;  4R2D A;  2LV2 A;  2YSP A;  2EPC A;  2EMH A;  2R1F A;  2VRD A;  2YRH A;  1YUJ A;  1B69 A;  2EOR A;  2YTO A;  2EMI A;  1G2D C;  2YTJ A;  2EM5 A;  3EPJ A;  1WJP A;  2EMC A;  1MEY C;  2DLK A;  2BB8 A;  4R2C A;  1NCS A;  3UK3 C;  2HGH A;  2EPX A;  1DGC A;  5KL4 A;  4FK5 C;  2DLQ A;  2EOJ A;  5KL5 A;  2PRT A;  1A1I A;  4F2J C;  2EM4 A;  4R2Q A;  2YRK A;  2EOI A;  2EQ0 A;  2EM6 A;  1TF3 A;  2EMB A;  2EPZ A;  2DRP A;  2WBS A;  2GLI A;  2LO3 A;  1TN9 A;  1ZU1 A;  2EOO A;  2EML A;  2YTG A;  2EOE A;  3M99 B;  2EOS A;  2RPC A;  2CTD A;  2EN8 A;  2EL4 A;  2EOM A;  4R2A A;  2YTQ A;  2EPP A;  2JP9 A;  1BBO A;  1UN6 B;  2EN1 A;  2EN7 A;  1X6E A;  2EM2 A;  2EMY A;  2ADR A;  1AAY A;  2YTD A;  2EOQ A;  2EQ1 A;  4GZN C;  4WSG A;  2EMF A;  2EMZ A;  1X3C A;  2EN3 A;  2EPU A;  1P47 A;  2EJ4 A;  1A1L A;  5KL3 A;  2YTE A;  1Z1B A;  2EOZ A;  1KJK A;  2YTI A;  2EOY A;  2CSH A;  1F2I G;  1ZAA C;  2EOH A;  5KL6 A;  3EPL A;  2YU8 A;  3MHS C;  4IJD A;  1A1F A;  2E72 A;  2EL5 A;  4R2S A;  2MKD A;  2YTN A;  1G2F C;  2EMX A;  1A1H A;  2J7J A;  4R2E A;  4F6N A;  2EPR A;  2WBT A;  2EQ3 A;  2YU5 A;  2ELZ A;  4F6M A;  2EN2 A;  2EM8 A;  1UBD C;  2RSI A;  2EE8 A;  2WBU A;  5KL7 A;  2NAB A;  2EN4 A;  1X6H A;  2EMG A;  1ZR9 A;  2JPA A;  4R2R A;  1A1G A;  2ELY A;  1A1K A;  3EPK A;  1RMD A;  2EM7 A;  1YUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...