2JP9A

Structure of the wilms tumor suppressor protein zinc finger domain bound to dna
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
119
structure length
119
Chain Sequence
ASEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(P*DCP*DGP*DCP*DGP*DGP*DGP*DGP*DGP*DCP*DGP*DTP*DCP*
publication title Structure of the wilms tumor suppressor protein zinc finger domain bound to DNA
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 42
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2jp9A01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2jp9A03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2jp9A02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2jp9A04
4IJDA 2WCC3 2YRKA 2YTGA 1Z1BA 1LLMC 4R2SA 2EMZA 2EMHA 4R2AA 2EMFA 1F2IG 2CSHA 1A1LA 2EQ1A 2MKDA 2PRTA 2EMLA 1B69A 2YTDA 2I13A 2JPAA 1A1IA 2EOOA 5KL5A 2LT7A 2EOXA 2DLQA 4WSGA 2WBTA 1YUJA 2EOYA 1MEYC 2LO3A 2YRHA 2D9HA 2YSPA 1UBDC 2EM0A 2ELZA 1TF3A 1X6EA 2EMIA 1UN6B 1A1JA 1ZU1A 2YTEA 2WBUA 2EPPA 3MHSC 1X6FA 2ENHA 2YTQA 1A1KA 1BB8A 2A25A 4IS1C 5KL4A 2YTOA 2EMYA 5KL6A 2GHFA 4X9JA 4R2RA 2JP9A 1X3CA 2ELYA 2EPZA 4F2JC 1ZAAC 3UK3C 1ZR9A 2EL6A 4R2CA 4R2DA 4R2PA 2EN6A 2MDGA 3EPLA 2EP3A 1JK2A 1BBOA 4M9VC 4GZNC 1A1HA 2EM8A 2YU8A 2EE8A 2EOJA 2EJ4A 4F6NA 2ENAA 1YSAC 2YTFA 1X5WA 2DGCA 5KL3A 2EOIA 2EMBA 2EOSA 1YUIA 2EL4A 2LCEA 1X6HA 2DRPA 2EPAA 2EPUA 3VHTB 1JK1A 1A1GA 3M99B 2EMGA 2EN7A 1TN9A 2EPCA 2YTPA 1KJKA 2EM4A 2NABA 2EMKA 2EM9A 2EQ3A 2EQ0A 1TF6A 5KL7A 2EN8A 2BB8A 2LVHA 2EL5A 1A1FA 1WJPA 2EMAA 2ADRA 1G2DC 2EOQA 2EM2A 2EN4A 2EPXA 4R2EA 2EN1A 1DGCA 2EOHA 2EM6A 2ENCA 2EOZA 2EOEA 1P47A 3EPHA 1RMDA 4FK5C 2VRDA 2MKNA 2YTJA 4F6MA 2LV2A 2YU5A 2DMIA 2R1FA 2EORA 2CT1A 2EMXA 2YTIA 2YRMA 2EOMA 2E72A 2RPCA 1G2FC 2EM7A 2J7JA 2RSIA 5KL2A 2EPRA 2M9AA 3EPKA 2CTDA 2EM3A 1AAYA 1NCSA 2WBSA 2EN3A 4R2QA 3EPJA 2YTNA 2DLKA 2EOFA 2GLIA 2EMWA 3MHHC 2EMCA 2EN2A 2HGHA 2EM5A 2YSOA
chains in the Genus database with same CATH superfamily
4YHHE 4DMIA 4BC7A 2UUAE 4IJDA 4AQYE 2K7IA 4DV4E 2EMHA 5AC5A 2G7HA 1F2IG 4RHBB 4O5GA 2VF1A 2PRTA 5AE3A 2YTDA 4Q28A 2JPAA 2DIXA 2MC5A 1UILA 4NXNE 2N8XA 2EOXA 2DLQA 2EOYA 2B3TB 1EH6A 2LO3A 3J81C 3T1HE 2UXDE 2V89A 2WBUA 2EPPA 4LFBE 2ENHA 2F4VE 2A25A 4IS1C 3VYXA 4BCAA 1N3GA 2ZM6E 2JP9A 1X3CA 4F2JC 3UK3C 3HPZA 3JU0A 4R2DA 2MDGA 1JK2A 2EP3A 2FGGA 4WSPA 1YYWA 3FIGA 4F6NA 3F6HA 5LL6R 1YSAC 5A6JA 1X5WA 3LLHA 1PDAA 2EOSA 2DRPA 2YZTA 2VE7C 2EPUA 5T6JA 3VHTB 2LRSA 1JK1A 1EKZA 2EMGA 2EN7A 4LTYA 2LJUA 1N36E 4JI1E 3KZYA 5KL7A 1DQ3A 1PJTA 2LVHA 4TUIA 1A1FA 1XMQE 2M7QA 2RSMA 1WRJA 4LFAE 1NEIA 2LE2A 1DGCA 2EPLX 2YPNA 2UUCE 2EM6A 2ENCA 2EOEA 4MLVA 3EPHA 2JR1A 5AASA 2YTJA 4ZYEA 4F6MA 2R1FA 4DV7E 2EMXA 2F8BA 1MGTA 4ZYHA 2RPCA 2EPNA 3C4TA 2EM7A 1PKPA 4JI8E 1YZ9A 4R03A 3EPKA 4X8WA 2UXCE 2EM3A 1GQEA 3IWCA 3VK6A 1NCSA 3ADLA 4LF4E 2DLKA 4YY3E 2CPNA 1T4LB 2EMCA 5LLQA 4JI2E 2RS7A 4DR1E 2GPIA 2JY9A 2WCC3 2DB2A 5A6AA 2KOUA 4DV3E 3IWBA 4KWYA 5A6KA 1WHNA 2JOBA 2CSHA 1FJGE 3J80C 1A1LA 5IWAE 2I13A 3EQ1A 3BBGA 1HNWE 2EOOA 1HR0E 2LT7A 2B7VA 3J7AG 2WBTA 1YUJA 5A6BD 4RH8A 4GKJE 3KZZA 1N34E 2D9HA 2YSPA 4LF5E 2EM0A 2ELZA 2V86A 2EMIA 2R76A 1ZU1A 4ZYDA 4B3SE 1XNRE 4B3ME 1A1KA 5BR8E 4BHBA 4X9JA 4DV6E 2EPZA 1QNTA 4L8NA 1ZAAC 2B7TA 4R2CA 2EN6A 3EPLA 1I94E 4JI7E 5A6BA 4GZNC 4K0KE 2I9IA 2EE8A 3ADJA 2E1MA 1J5EE 1ZBQA 1IQSA 2ENAA 2M4IA 2YTFA 2E5LE 1IBME 2DGCA 2L92A 2EOIA 5KL3A 3OTOE 4LF6E 3P1XA 1SFEA 2L8TA 2JYAA 2L2NA 4DR7E 1TN9A 3AV0A 2EPCA 2YTPA 2YT4A 4I8OA 2NABA 2EMKA 5IV8B 2M1SA 2V83A 4DR2E 3IWDA 1IMUA 2EMAA 1T4NA 2ADRA 4WPYA 1HNZE 1RQ0A 2EOQA 4F9AB 2UUBE 2EPXA 4R2EA 2V87A 2EN1A 3RMPA 2EOZA 1YYKA 4M0VA 3ECRA 2JOXA 2MKNA 3TQMA 2K4VA 2YU5A 2L3CA 2Q8UA 3C6KA 2EORA 2CT1A 4X62E 4F54A 4JI4E 5AE1A 1ZBTA 2YRMA 4JI5E 2RTXA 5IXMB 1AH5A 5KL2A 2J7JA 2L33A 4F9BB 3BIDA 2CTDA 4DR3E 2LBSB 4WXCA 4KHPE 4R2QA 1KYQA 4L5NC 1O0WA 4JI6E 1WXRA 2GLIA 4M30A 4DR4E 5FLXC 2L3JA 2LTSA 2YRKA 3ADGA 4OX9E 3THNA 4R2SA 2LTRA 2EMFA 2MKDA 4NXME 1PJSA 1YYOA 4M2ZA 1WHQA 1A1IA 2H36X 5KL5A 1FKAE 2LMZA 4X66E 4GEQB 2KONA 2MC6A 4WSGA 2KHXA 2L2KB 1X48A 1MEYC 5IT9C 2YRHA 1UBDC 2UXBE 4JI3E 1UN6B 2EZ6A 2YTEA 5A69A 2NUFA 2YTQA 1GTKA 2FTXB 4DUZE 4WYQB 5KL4A 5KL6A 4R2RA 2EL6A 1J26A 3QG5C 4LU9A 2L6MA 4R2PA 4J8ZA 5CFFE 2VQFE 4GKKE 1BBOA 4BMJA 1A1HA 2BBGA 3HXLA 2YU8A 2N3HA 1GZ6A 1XMOE 1YFHA 3KWRA 1YUIA 2EL4A 2LCEA 2N3GA 3H09A 2EPAA 1A1GA 2HJJA 2MDRA 3JTZA 2DMYA 3DF6A 2ODRD 2EQ3A 4DR5E 2EN8A 4JYAE 4O43A 1WJPA 3J7Yp 5LMNE 1G2DC 1EH8A 3MSWA 2EM2A 3L00A 4WFTA 4JI0E 2EOHA 3THOB 2JXPA 1L4SA 1P47A 2JWOA 2VRDA 1EH7A 2DMIA 4LF8E 2V8QB 4O4KA 2EOMA 4N4RB 4HTGA 2E72A 5DNYA 3DJWA 2EPOA 1G2FC 2RSIA 2V85A 2EPRA 4P7DA 4DV5E 1AAYA 2WBSA 1IQOA 1PJQA 5TSEA 4BBYA 3EPJA 2YTNA 2NUEA 1YPNA 1UHZA 4LF9E 3BGHA 3MHHC 4WXDA 2YSOA 2LJHA 5A2QC 2JVAA 1IBKE 4NHRA 1DI2A 2YTGA 3OMLA 1Z1BA 1LLMC 2EMZA 2IHR1 5F3WA 4R2AA 3C4BA 4DV0E 2DSYA 2FV4B 2EQ1A 2EMLA 2LUPB 1B69A 1BBGA 4LF7E 3VYYA 1X49A 3HPSA 1N33E 3HQ1A 4DV2E 2EWLA 2ODRC 2NUGA 4KZSA 3K6QA 1TF3A 1X6EA 5ADZA 3JAMC 1RC7A 1A1JA 4ZYGA 2RS6A 3MHSC 4B3TE 2UU9E 3AUZA 1X6FA 1BB8A 1SR9A 3ADIA 4F9CB 2YTOA 2EMYA 1N32E 2GHFA 4DUYE 2ELYA 1ZR9A 1T4OA 3C6MA 2B9DA 5AC4A 5LMUE 4M9VC 2EM8A 2NA2A 4BHCA 2EOJA 2EJ4A 3T1YE 4DV1E 4MLQA 3HTXA 4R8OA 4DR6E 2EMBA 3F6GA 1X6HA 4BS9A 2L2MA 3LMLA 3M99B 4X65E 1KJKA 2WZOA 2EM4A 1TF6A 2EM9A 4Q35B 2EQ0A 2BB8A 2EL5A 2HC5A 1X47A 2HHHE 1IBLE 2YWQA 2EPMX 1QU6A 2EN4A 4JV5E 4O24A 5AE2A 1RMDA 4FK5C 4DKKA 2V88A 1XNQE 1T39A 2LV2A 4WX9A 4BC9A 2YTIA 4TUGA 2VQEE 4LFCE 3ZOQB 2M9AA 1STUA 2RQLA 2LUQA 4HEIA 2EN3A 3BF2A 4P78A 2EPKX 4B3RE 2EOFA 1T38A 4NZVA 4OOGC 2EMWA 2EN2A 2HGHA 4X64E 2EM5A 1HNXE
chains in the Genus database with same CATH topology
4IJDA 2WCC3 2YRKA 2YTGA 1Z1BA 1LLMC 4R2SA 2EMZA 2EMHA 4R2AA 2EMFA 1F2IG 2CSHA 1A1LA 2EQ1A 2MKDA 2PRTA 2EMLA 1B69A 2YTDA 2I13A 2JPAA 1A1IA 2EOOA 5KL5A 2LT7A 2EOXA 2DLQA 4WSGA 2WBTA 1YUJA 2EOYA 1MEYC 2LO3A 2YRHA 2D9HA 2YSPA 1UBDC 2EM0A 2ELZA 1TF3A 1X6EA 2EMIA 1UN6B 1A1JA 1ZU1A 2YTEA 2WBUA 2EPPA 3MHSC 1X6FA 2ENHA 2YTQA 1A1KA 1BB8A 2A25A 4IS1C 5KL4A 2YTOA 2EMYA 5KL6A 2GHFA 4X9JA 4R2RA 2JP9A 1X3CA 2ELYA 2EPZA 4F2JC 1ZAAC 3UK3C 1ZR9A 2EL6A 4R2CA 4R2DA 4R2PA 2EN6A 2MDGA 3EPLA 2EP3A 1JK2A 1BBOA 4M9VC 4GZNC 1A1HA 2EM8A 2YU8A 2EE8A 2EOJA 2EJ4A 4F6NA 2ENAA 1YSAC 2YTFA 1X5WA 2DGCA 5KL3A 2EOIA 2EMBA 2EOSA 1YUIA 2EL4A 2LCEA 1X6HA 2DRPA 2EPAA 2EPUA 3VHTB 1JK1A 1A1GA 3M99B 2EMGA 2EN7A 1TN9A 2EPCA 2YTPA 1KJKA 2EM4A 2NABA 2EMKA 2EM9A 2EQ3A 2EQ0A 1TF6A 5KL7A 2EN8A 2BB8A 2LVHA 2EL5A 1A1FA 1WJPA 2EMAA 2ADRA 1G2DC 2EOQA 2EM2A 2EN4A 2EPXA 4R2EA 2EN1A 1DGCA 2EOHA 2EM6A 2ENCA 2EOZA 2EOEA 1P47A 3EPHA 1RMDA 4FK5C 2VRDA 2MKNA 2YTJA 4F6MA 2LV2A 2YU5A 2DMIA 2R1FA 2EORA 2CT1A 2EMXA 2YTIA 2YRMA 2EOMA 2E72A 2RPCA 1G2FC 2EM7A 2J7JA 2RSIA 5KL2A 2EPRA 2M9AA 3EPKA 2CTDA 2EM3A 1AAYA 1NCSA 2WBSA 2EN3A 4R2QA 3EPJA 2YTNA 2DLKA 2EOFA 2GLIA 2EMWA 3MHHC 2EMCA 2EN2A 2HGHA 2EM5A 2YSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJD A;  2WCC 3;  2YRK A;  2YTG A;  1Z1B A;  1LLM C;  4R2S A;  2EMZ A;  2EMH A;  4R2A A;  2EMF A;  1F2I G;  2CSH A;  1A1L A;  2EQ1 A;  2MKD A;  2PRT A;  2EML A;  1B69 A;  2YTD A;  2I13 A;  2JPA A;  1A1I A;  2EOO A;  5KL5 A;  2LT7 A;  2EOX A;  2DLQ A;  4WSG A;  2WBT A;  1YUJ A;  2EOY A;  1MEY C;  2LO3 A;  2YRH A;  2D9H A;  2YSP A;  1UBD C;  2EM0 A;  2ELZ A;  1TF3 A;  1X6E A;  2EMI A;  1UN6 B;  1A1J A;  1ZU1 A;  2YTE A;  2WBU A;  2EPP A;  3MHS C;  1X6F A;  2ENH A;  2YTQ A;  1A1K A;  1BB8 A;  2A25 A;  4IS1 C;  5KL4 A;  2YTO A;  2EMY A;  5KL6 A;  2GHF A;  4X9J A;  4R2R A;  2JP9 A;  1X3C A;  2ELY A;  2EPZ A;  4F2J C;  1ZAA C;  3UK3 C;  1ZR9 A;  2EL6 A;  4R2C A;  4R2D A;  4R2P A;  2EN6 A;  2MDG A;  3EPL A;  2EP3 A;  1JK2 A;  1BBO A;  4M9V C;  4GZN C;  1A1H A;  2EM8 A;  2YU8 A;  2EE8 A;  2EOJ A;  2EJ4 A;  4F6N A;  2ENA A;  1YSA C;  2YTF A;  1X5W A;  2DGC A;  5KL3 A;  2EOI A;  2EMB A;  2EOS A;  1YUI A;  2EL4 A;  2LCE A;  1X6H A;  2DRP A;  2EPA A;  2EPU A;  3VHT B;  1JK1 A;  1A1G A;  3M99 B;  2EMG A;  2EN7 A;  1TN9 A;  2EPC A;  2YTP A;  1KJK A;  2EM4 A;  2NAB A;  2EMK A;  2EM9 A;  2EQ3 A;  2EQ0 A;  1TF6 A;  5KL7 A;  2EN8 A;  2BB8 A;  2LVH A;  2EL5 A;  1A1F A;  1WJP A;  2EMA A;  2ADR A;  1G2D C;  2EOQ A;  2EM2 A;  2EN4 A;  2EPX A;  4R2E A;  2EN1 A;  1DGC A;  2EOH A;  2EM6 A;  2ENC A;  2EOZ A;  2EOE A;  1P47 A;  3EPH A;  1RMD A;  4FK5 C;  2VRD A;  2MKN A;  2YTJ A;  4F6M A;  2LV2 A;  2YU5 A;  2DMI A;  2R1F A;  2EOR A;  2CT1 A;  2EMX A;  2YTI A;  2YRM A;  2EOM A;  2E72 A;  2RPC A;  1G2F C;  2EM7 A;  2J7J A;  2RSI A;  5KL2 A;  2EPR A;  2M9A A;  3EPK A;  2CTD A;  2EM3 A;  1AAY A;  1NCS A;  2WBS A;  2EN3 A;  4R2Q A;  3EPJ A;  2YTN A;  2DLK A;  2EOF A;  2GLI A;  2EMW A;  3MHH C;  2EMC A;  2EN2 A;  2HGH A;  2EM5 A;  2YSO A; 
#chains in the Genus database with same CATH topology
 4YHH E;  4DMI A;  4BC7 A;  2UUA E;  4IJD A;  4AQY E;  2K7I A;  4DV4 E;  2EMH A;  5AC5 A;  2G7H A;  1F2I G;  4RHB B;  4O5G A;  2VF1 A;  2PRT A;  5AE3 A;  2YTD A;  4Q28 A;  2JPA A;  2DIX A;  2MC5 A;  1UIL A;  4NXN E;  2N8X A;  2EOX A;  2DLQ A;  2EOY A;  2B3T B;  1EH6 A;  2LO3 A;  3J81 C;  3T1H E;  2UXD E;  2V89 A;  2WBU A;  2EPP A;  4LFB E;  2ENH A;  2F4V E;  2A25 A;  4IS1 C;  3VYX A;  4BCA A;  1N3G A;  2ZM6 E;  2JP9 A;  1X3C A;  4F2J C;  3UK3 C;  3HPZ A;  3JU0 A;  4R2D A;  2MDG A;  1JK2 A;  2EP3 A;  2FGG A;  4WSP A;  1YYW A;  3FIG A;  4F6N A;  3F6H A;  5LL6 R;  1YSA C;  5A6J A;  1X5W A;  3LLH A;  1PDA A;  2EOS A;  2DRP A;  2YZT A;  2VE7 C;  2EPU A;  5T6J A;  3VHT B;  2LRS A;  1JK1 A;  1EKZ A;  2EMG A;  2EN7 A;  4LTY A;  2LJU A;  1N36 E;  4JI1 E;  3KZY A;  5KL7 A;  1DQ3 A;  1PJT A;  2LVH A;  4TUI A;  1A1F A;  1XMQ E;  2M7Q A;  2RSM A;  1WRJ A;  4LFA E;  1NEI A;  2LE2 A;  1DGC A;  2EPL X;  2YPN A;  2UUC E;  2EM6 A;  2ENC A;  2EOE A;  4MLV A;  3EPH A;  2JR1 A;  5AAS A;  2YTJ A;  4ZYE A;  4F6M A;  2R1F A;  4DV7 E;  2EMX A;  2F8B A;  1MGT A;  4ZYH A;  2RPC A;  2EPN A;  3C4T A;  2EM7 A;  1PKP A;  4JI8 E;  1YZ9 A;  4R03 A;  3EPK A;  4X8W A;  2UXC E;  2EM3 A;  1GQE A;  3IWC A;  3VK6 A;  1NCS A;  3ADL A;  4LF4 E;  2DLK A;  4YY3 E;  2CPN A;  1T4L B;  2EMC A;  5LLQ A;  4JI2 E;  2RS7 A;  4DR1 E;  2GPI A;  2JY9 A;  2WCC 3;  2DB2 A;  5A6A A;  2KOU A;  4DV3 E;  3IWB A;  4KWY A;  5A6K A;  1WHN A;  2JOB A;  2CSH A;  1FJG E;  3J80 C;  1A1L A;  5IWA E;  2I13 A;  3EQ1 A;  3BBG A;  1HNW E;  2EOO A;  1HR0 E;  2LT7 A;  2B7V A;  3J7A G;  2WBT A;  1YUJ A;  5A6B D;  4RH8 A;  4GKJ E;  3KZZ A;  1N34 E;  2D9H A;  2YSP A;  4LF5 E;  2EM0 A;  2ELZ A;  2V86 A;  2EMI A;  2R76 A;  1ZU1 A;  4ZYD A;  4B3S E;  1XNR E;  4B3M E;  1A1K A;  5BR8 E;  4BHB A;  4X9J A;  4DV6 E;  2EPZ A;  1QNT A;  4L8N A;  1ZAA C;  2B7T A;  4R2C A;  2EN6 A;  3EPL A;  1I94 E;  4JI7 E;  5A6B A;  4GZN C;  4K0K E;  2I9I A;  2EE8 A;  3ADJ A;  2E1M A;  1J5E E;  1ZBQ A;  1IQS A;  2ENA A;  2M4I A;  2YTF A;  2E5L E;  1IBM E;  2DGC A;  2L92 A;  2EOI A;  5KL3 A;  3OTO E;  4LF6 E;  3P1X A;  1SFE A;  2L8T A;  2JYA A;  2L2N A;  4DR7 E;  1TN9 A;  3AV0 A;  2EPC A;  2YTP A;  2YT4 A;  4I8O A;  2NAB A;  2EMK A;  5IV8 B;  2M1S A;  2V83 A;  4DR2 E;  3IWD A;  1IMU A;  2EMA A;  1T4N A;  2ADR A;  4WPY A;  1HNZ E;  1RQ0 A;  2EOQ A;  4F9A B;  2UUB E;  2EPX A;  4R2E A;  2V87 A;  2EN1 A;  3RMP A;  2EOZ A;  1YYK A;  4M0V A;  3ECR A;  2JOX A;  2MKN A;  3TQM A;  2K4V A;  2YU5 A;  2L3C A;  2Q8U A;  3C6K A;  2EOR A;  2CT1 A;  4X62 E;  4F54 A;  4JI4 E;  5AE1 A;  1ZBT A;  2YRM A;  4JI5 E;  2RTX A;  5IXM B;  1AH5 A;  5KL2 A;  2J7J A;  2L33 A;  4F9B B;  3BID A;  2CTD A;  4DR3 E;  2LBS B;  4WXC A;  4KHP E;  4R2Q A;  1KYQ A;  4L5N C;  1O0W A;  4JI6 E;  1WXR A;  2GLI A;  4M30 A;  4DR4 E;  5FLX C;  2L3J A;  2LTS A;  2YRK A;  3ADG A;  4OX9 E;  3THN A;  4R2S A;  2LTR A;  2EMF A;  2MKD A;  4NXM E;  1PJS A;  1YYO A;  4M2Z A;  1WHQ A;  1A1I A;  2H36 X;  5KL5 A;  1FKA E;  2LMZ A;  4X66 E;  4GEQ B;  2KON A;  2MC6 A;  4WSG A;  2KHX A;  2L2K B;  1X48 A;  1MEY C;  5IT9 C;  2YRH A;  1UBD C;  2UXB E;  4JI3 E;  1UN6 B;  2EZ6 A;  2YTE A;  5A69 A;  2NUF A;  2YTQ A;  1GTK A;  2FTX B;  4DUZ E;  4WYQ B;  5KL4 A;  5KL6 A;  4R2R A;  2EL6 A;  1J26 A;  3QG5 C;  4LU9 A;  2L6M A;  4R2P A;  4J8Z A;  5CFF E;  2VQF E;  4GKK E;  1BBO A;  4BMJ A;  1A1H A;  2BBG A;  3HXL A;  2YU8 A;  2N3H A;  1GZ6 A;  1XMO E;  1YFH A;  3KWR A;  1YUI A;  2EL4 A;  2LCE A;  2N3G A;  3H09 A;  2EPA A;  1A1G A;  2HJJ A;  2MDR A;  3JTZ A;  2DMY A;  3DF6 A;  2ODR D;  2EQ3 A;  4DR5 E;  2EN8 A;  4JYA E;  4O43 A;  1WJP A;  3J7Y p;  5LMN E;  1G2D C;  1EH8 A;  3MSW A;  2EM2 A;  3L00 A;  4WFT A;  4JI0 E;  2EOH A;  3THO B;  2JXP A;  1L4S A;  1P47 A;  2JWO A;  2VRD A;  1EH7 A;  2DMI A;  4LF8 E;  2V8Q B;  4O4K A;  2EOM A;  4N4R B;  4HTG A;  2E72 A;  5DNY A;  3DJW A;  2EPO A;  1G2F C;  2RSI A;  2V85 A;  2EPR A;  4P7D A;  4DV5 E;  1AAY A;  2WBS A;  1IQO A;  1PJQ A;  5TSE A;  4BBY A;  3EPJ A;  2YTN A;  2NUE A;  1YPN A;  1UHZ A;  4LF9 E;  3BGH A;  3MHH C;  4WXD A;  2YSO A;  2LJH A;  5A2Q C;  2JVA A;  1IBK E;  4NHR A;  1DI2 A;  2YTG A;  3OML A;  1Z1B A;  1LLM C;  2EMZ A;  2IHR 1;  5F3W A;  4R2A A;  3C4B A;  4DV0 E;  2DSY A;  2FV4 B;  2EQ1 A;  2EML A;  2LUP B;  1B69 A;  1BBG A;  4LF7 E;  3VYY A;  1X49 A;  3HPS A;  1N33 E;  3HQ1 A;  4DV2 E;  2EWL A;  2ODR C;  2NUG A;  4KZS A;  3K6Q A;  1TF3 A;  1X6E A;  5ADZ A;  3JAM C;  1RC7 A;  1A1J A;  4ZYG A;  2RS6 A;  3MHS C;  4B3T E;  2UU9 E;  3AUZ A;  1X6F A;  1BB8 A;  1SR9 A;  3ADI A;  4F9C B;  2YTO A;  2EMY A;  1N32 E;  2GHF A;  4DUY E;  2ELY A;  1ZR9 A;  1T4O A;  3C6M A;  2B9D A;  5AC4 A;  5LMU E;  4M9V C;  2EM8 A;  2NA2 A;  4BHC A;  2EOJ A;  2EJ4 A;  3T1Y E;  4DV1 E;  4MLQ A;  3HTX A;  4R8O A;  4DR6 E;  2EMB A;  3F6G A;  1X6H A;  4BS9 A;  2L2M A;  3LML A;  3M99 B;  4X65 E;  1KJK A;  2WZO A;  2EM4 A;  1TF6 A;  2EM9 A;  4Q35 B;  2EQ0 A;  2BB8 A;  2EL5 A;  2HC5 A;  1X47 A;  2HHH E;  1IBL E;  2YWQ A;  2EPM X;  1QU6 A;  2EN4 A;  4JV5 E;  4O24 A;  5AE2 A;  1RMD A;  4FK5 C;  4DKK A;  2V88 A;  1XNQ E;  1T39 A;  2LV2 A;  4WX9 A;  4BC9 A;  2YTI A;  4TUG A;  2VQE E;  4LFC E;  3ZOQ B;  2M9A A;  1STU A;  2RQL A;  2LUQ A;  4HEI A;  2EN3 A;  3BF2 A;  4P78 A;  2EPK X;  4B3R E;  2EOF A;  1T38 A;  4NZV A;  4OOG C;  2EMW A;  2EN2 A;  2HGH A;  4X64 E;  2EM5 A;  1HNX E; 
#chains in the Genus database with same CATH homology
 4IJD A;  2WCC 3;  2YRK A;  2YTG A;  1Z1B A;  1LLM C;  4R2S A;  2EMZ A;  2EMH A;  4R2A A;  2EMF A;  1F2I G;  2CSH A;  1A1L A;  2EQ1 A;  2MKD A;  2PRT A;  2EML A;  1B69 A;  2YTD A;  2I13 A;  2JPA A;  1A1I A;  2EOO A;  5KL5 A;  2LT7 A;  2EOX A;  2DLQ A;  4WSG A;  2WBT A;  1YUJ A;  2EOY A;  1MEY C;  2LO3 A;  2YRH A;  2D9H A;  2YSP A;  1UBD C;  2EM0 A;  2ELZ A;  1TF3 A;  1X6E A;  2EMI A;  1UN6 B;  1A1J A;  1ZU1 A;  2YTE A;  2WBU A;  2EPP A;  3MHS C;  1X6F A;  2ENH A;  2YTQ A;  1A1K A;  1BB8 A;  2A25 A;  4IS1 C;  5KL4 A;  2YTO A;  2EMY A;  5KL6 A;  2GHF A;  4X9J A;  4R2R A;  2JP9 A;  1X3C A;  2ELY A;  2EPZ A;  4F2J C;  1ZAA C;  3UK3 C;  1ZR9 A;  2EL6 A;  4R2C A;  4R2D A;  4R2P A;  2EN6 A;  2MDG A;  3EPL A;  2EP3 A;  1JK2 A;  1BBO A;  4M9V C;  4GZN C;  1A1H A;  2EM8 A;  2YU8 A;  2EE8 A;  2EOJ A;  2EJ4 A;  4F6N A;  2ENA A;  1YSA C;  2YTF A;  1X5W A;  2DGC A;  5KL3 A;  2EOI A;  2EMB A;  2EOS A;  1YUI A;  2EL4 A;  2LCE A;  1X6H A;  2DRP A;  2EPA A;  2EPU A;  3VHT B;  1JK1 A;  1A1G A;  3M99 B;  2EMG A;  2EN7 A;  1TN9 A;  2EPC A;  2YTP A;  1KJK A;  2EM4 A;  2NAB A;  2EMK A;  2EM9 A;  2EQ3 A;  2EQ0 A;  1TF6 A;  5KL7 A;  2EN8 A;  2BB8 A;  2LVH A;  2EL5 A;  1A1F A;  1WJP A;  2EMA A;  2ADR A;  1G2D C;  2EOQ A;  2EM2 A;  2EN4 A;  2EPX A;  4R2E A;  2EN1 A;  1DGC A;  2EOH A;  2EM6 A;  2ENC A;  2EOZ A;  2EOE A;  1P47 A;  3EPH A;  1RMD A;  4FK5 C;  2VRD A;  2MKN A;  2YTJ A;  4F6M A;  2LV2 A;  2YU5 A;  2DMI A;  2R1F A;  2EOR A;  2CT1 A;  2EMX A;  2YTI A;  2YRM A;  2EOM A;  2E72 A;  2RPC A;  1G2F C;  2EM7 A;  2J7J A;  2RSI A;  5KL2 A;  2EPR A;  2M9A A;  3EPK A;  2CTD A;  2EM3 A;  1AAY A;  1NCS A;  2WBS A;  2EN3 A;  4R2Q A;  3EPJ A;  2YTN A;  2DLK A;  2EOF A;  2GLI A;  2EMW A;  3MHH C;  2EMC A;  2EN2 A;  2HGH A;  2EM5 A;  2YSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...