2JP9A

Structure of the wilms tumor suppressor protein zinc finger domain bound to dna
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
119
structure length
119
Chain Sequence
ASEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA (5'-D(P*DCP*DGP*DCP*DGP*DGP*DGP*DGP*DGP*DCP*DGP*DTP*DCP*
publication title Structure of the wilms tumor suppressor protein zinc finger domain bound to DNA
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2jp9A01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2jp9A03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2jp9A02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2jp9A04
5KL3A 2EJ4A 2EN8A 4IJDA 1YUJA 1YUIA 2BB8A 2EMHA 3EPJA 2EOSA 2YRKA 4R2CA 2EL4A 1A1GA 2MKNA 2EMXA 2JP9A 3VHTB 2YRMA 4R2RA 2GLIA 2HGHA 2EN6A 2GHFA 2EOMA 1BBOA 2EN3A 2RSIA 1TF3A 2EPCA 2D9HA 2EM2A 2EOYA 2YTNA 2EOZA 2YTJA 2EOIA 2JPAA 1JK1A 2WBSA 2YTGA 2ENHA 1F2IG 5KL6A 2EQ1A 2EPXA 1A1KA 1X6FA 1X6EA 4R2QA 2YTEA 1ZU1A 2CTDA 2EM0A 2EOFA 2DLKA 2DGCA 2LO3A 4X9JA 2M9AA 2DRPA 2YTFA 2EOHA 1G2DC 1RMDA 4R2DA 3EPLA 2EM5A 1A1LA 2EMWA 1JK2A 2EPRA 2ENCA 1X5WA 3MHHC 4F2JC 4M9VC 2EQ0A 1A1JA 1A1IA 2YSOA 2R1FA 2EOQA 3EPHA 4R2PA 2E72A 2EOEA 2LT7A 2EN7A 2WCC3 2I13A 5KL7A 2EMBA 1DGCA 4R2EA 1MEYC 2YTPA 2MKDA 1AAYA 2J7JA 2LCEA 2EE8A 1B69A 2YU8A 5KL4A 1ZAAC 2EPZA 1ZR9A 2EMGA 4GZNC 2MDGA 1TN9A 2EM7A 2ADRA 2LVHA 4F6NA 2ELYA 1UBDC 1A1FA 1UN6B 1P47A 2EM9A 2PRTA 2EL5A 2NABA 4R2SA 1X3CA 2EMCA 2EMZA 2DMIA 4F6MA 2EPUA 1YSAC 2EOOA 2LV2A 1NCSA 3MHSC 3UK3C 2EOXA 2DLQA 1TF6A 2EN2A 2RPCA 1WJPA 4WSGA 4FK5C 1Z1BA 2EM6A 2ENAA 2EMKA 2EN1A 2WBTA 2VRDA 3EPKA 2EMAA 2A25A 2EMYA 2EPPA 2YSPA 2EOJA 2WBUA 2YTQA 2EL6A 5KL5A 2EM4A 2EMLA 2EM8A 2EM3A 1A1HA 1BB8A 1G2FC 1KJKA 2EMIA 2EP3A 3M99B 1X6HA 2EPAA 2EORA 2YU5A 5KL2A 2YTDA 2CT1A 2YTOA 4IS1C 2YTIA 2ELZA 2CSHA 2EN4A 2YRHA 2EQ3A 2EMFA 4R2AA 1LLMC
chains in the Genus database with same CATH superfamily
2JOBA 2EN8A 1YUJA 1J5EE 1RQ0A 2EPOA 4R2CA 5A6KA 3KZYA 2YRMA 2L3JA 2HGHA 4RHBB 3JTZA 4DV0E 2EOYA 2EOZA 1O0WA 4F9AB 2EOIA 2JPAA 1JK1A 5TSEA 2YTGA 2L2MA 1F2IG 2CPNA 5KL6A 5AASA 4LF6E 2EPXA 2CTDA 2EM0A 1YPNA 2DGCA 2LO3A 4JI1E 2DRPA 2B3TB 5T6JA 4O5GA 4R2DA 2LBSB 2UUBE 1WHQA 2Q8UA 4MLVA 4WX9A 4KHPE 1A1JA 1A1IA 2UXCE 3J81C 4M2ZA 1GZ6A 2G7HA 3THNA 1J26A 2UU9E 2WCC3 3RMPA 1DGCA 4NXME 4KZSA 2MKDA 1AAYA 4OX9E 3P1XA 4LF4E 1B69A 3C4BA 2LE2A 2EPZA 4B3RE 2MDGA 4R03A 4DV2E 1TN9A 2EM7A 2B7VA 3KWRA 3ECRA 3AV0A 2DSYA 3BGHA 4HTGA 2KHXA 1X3CA 2EWLA 5FLXC 4DUYE 1HR0E 4F6MA 1GQEA 1UILA 3FIGA 4X64E 3MHSC 2JR1A 1TF6A 1L4SA 4Q28A 5A6AA 2EN1A 2ODRC 1PKPA 1IQSA 3HQ1A 4DV1E 5CFFE 2YTQA 2IHR1 1ZBQA 2UUCE 4GKJE 2EM8A 2EM3A 2KONA 5KL2A 4LF8E 3L00A 1N36E 2UXBE 2YT4A 4IS1C 2ELZA 1STUA 2EN4A 2EQ3A 1SFEA 2EMFA 1QU6A 4L5NC 4WXCA 3ADJA 1YUIA 2EPMX 1X48A 1YYOA 4X62E 1FJGE 4BHCA 2V89A 2V83A 4MLQA 1N33E 1DQ3A 4LTYA 1WXRA 4WPYA 1I94E 4F9CB 2DMYA 3OTOE 2E1MA 5AC5A 2EPCA 2EM2A 2L3CA 4LF7E 2EQ1A 1PDAA 4R2QA 2YTEA 2EOFA 3JU0A 1IBKE 4RH8A 2M9AA 4B3SE 2M1SA 3H09A 3MSWA 3HPZA 1RMDA 2LMZA 2EM5A 4JYAE 2EMWA 5AE3A 4NHRA 2MC6A 4JV5E 2HHHE 2MC5A 3BIDA 4DV3E 4M9VC 2YSOA 4LF5E 1IBME 3DF6A 2EOQA 4DR7E 3EPHA 5LLQA 5AE2A 3T1HE 5IWAE 2LT7A 5KL7A 2NUFA 4DUZE 4YHHE 2YTPA 2J7JA 4L8NA 5A6BA 1N34E 2YU8A 4DR3E 4NXNE 3ADLA 1GTKA 4X8WA 2EMGA 2JOXA 4B3ME 2UUAE 2ADRA 2LVHA 1IBLE 2F4VE 1NEIA 4YY3E 4F6NA 4I8OA 1XMOE 2FGGA 1UN6B 2L8TA 2PRTA 2ODRD 1PJSA 2MDRA 1QNTA 1X47A 4Q35B 1YSAC 4LF9E 1NCSA 3VYXA 3LLHA 1FKAE 2EN2A 5A69A 1YZ9A 4DKKA 4WSGA 4FK5C 2EM6A 2ENAA 2EMKA 2WBTA 2EPPA 3IWCA 4JI3E 2B9DA 2EPNA 4O24A 2L33A 5KL5A 2VQFE 2EM4A 3JAMC 1ZBTA 2K4VA 1A1HA 2FTXB 1G2FC 2I9IA 2RTXA 3IWBA 3HXLA 2EP3A 5F3WA 3C6KA 1HNWE 2EORA 3BBGA 2CT1A 1IQOA 3ADIA 2CSHA 4R2AA 2L92A 2JY9A 2EJ4A 4NZVA 2RS7A 3BF2A 2EMHA 3EPJA 2ZM6E 1HNXE 2L2KB 2EL4A 2EMXA 2JP9A 2GLIA 4TUIA 2LJUA 1T4OA 2EOMA 3HTXA 2RSIA 1TF3A 2D9HA 2YTNA 2N3HA 1T39A 5A6JA 2LRSA 4N4RB 2NA2A 4BCAA 1X6EA 1X6FA 3THOB 1ZU1A 4X9JA 2EOHA 5LMUE 1X49A 1YFHA 4B3TE 2VE7C 2LUPB 2HJJA 5A6BD 2M4IA 1JK2A 2KOUA 2DB2A 4P78A 2ENCA 1EH8A 1X5WA 4F9BB 1N3GA 2DIXA 2EQ0A 3ZOQB 2EZ6A 2K7IA 2R1FA 2YPNA 2EOEA 2NUGA 4BMJA 2I13A 2EMBA 1MEYC 2RS6A 2V8QB 5AE1A 1EKZA 4JI0E 2N8XA 5KL4A 2N3GA 3OMLA 3DJWA 2H36X 1ZR9A 4WFTA 4WSPA 2VQEE 4LFBE 4DV7E 4DV5E 5ADZA 1UBDC 2ELYA 2L6MA 1A1FA 4M30A 4BHBA 3F6GA 1P47A 2UXDE 2LUQA 2EM9A 2V85A 2EL5A 4DR5E 4O4KA 2EMZA 1UHZA 2EPUA 4JI5E 3VYYA 2EOOA 2LV2A 4JI8E 3UK3C 3QG5C 2DLQA 4DR1E 2LTSA 4OOGC 4AQYE 1Z1BA 4DR2E 3EQ1A 2EMYA 2A25A 2WZOA 4DV6E 3VK6A 4WXDA 2EL6A 2L2NA 4ZYGA 2EMLA 1BB8A 2LTRA 1WRJA 1KJKA 4M0VA 4GEQB 3M99B 1X6HA 4ZYHA 2JVAA 3C4TA 2R76A 2YTIA 4LU9A 2YRHA 4BC7A 3EPLA 5KL3A 4IJDA 4KWYA 2BB8A 1PJQA 2EOSA 5IXMB 4WYQB 3C6MA 3IWDA 1PJTA 2BBGA 1EH6A 2YRKA 2MKNA 1A1GA 5AC4A 3VHTB 4BBYA 2VF1A 4R2RA 2EN6A 3AUZA 2GHFA 4JI6E 1BBOA 2EN3A 4BC9A 4JI4E 2E5LE 4J8ZA 2JXPA 2YTJA 2WBSA 5BR8E 4DR6E 4K0KE 2ENHA 4DV4E 1XMQE 1A1KA 1BBGA 4JI7E 2DLKA 1T38A 2RSMA 4LFCE 1T4LB 3J7AG 2EPLX 1AH5A 2M7QA 2YTFA 4BS9A 1G2DC 4GKKE 1YYKA 2JYAA 2YZTA 1A1LA 3KZZA 2EPRA 3J80C 1XNRE 3MHHC 4F2JC 3K6QA 2F8BA 2V87A 5A2QC 3F6HA 4O43A 2E72A 5LL6R 3TQMA 4R2PA 4ZYEA 3HPSA 2B7TA 2EN7A 4R8OA 4R2EA 2FV4B 2LCEA 2EE8A 3T1YE 5LMNE 4LFAE 1ZAAC 4P7DA 4GZNC 2EPKX 4X66E 3ADGA 4DR4E 3J7Yp 2RQLA 1HNZE 3LMLA 2V88A 2GPIA 1KYQA 1MGTA 2NABA 4R2SA 2JWOA 2EMCA 4HEIA 2DMIA 2LJHA 2NUEA 1WHNA 2HC5A 4TUGA 2EOXA 5DNYA 1XNQE 4X65E 5IV8B 2RPCA 1T4NA 1WJPA 4ZYDA 1IMUA 1N32E 2VRDA 3EPKA 2EMAA 2YSPA 1SR9A 2V86A 2EOJA 2WBUA 1DI2A 1RC7A 1YYWA 2YWQA 4DMIA 2EMIA 2YU5A 2EPAA 4F54A 2YTDA 5IT9C 4JI2E 1EH7A 2YTOA 1LLMC
chains in the Genus database with same CATH topology
5KL3A 2EJ4A 2EN8A 4IJDA 1YUJA 1YUIA 2BB8A 2EMHA 3EPJA 2EOSA 2YRKA 4R2CA 2EL4A 1A1GA 2MKNA 2EMXA 2JP9A 3VHTB 2YRMA 4R2RA 2GLIA 2HGHA 2EN6A 2GHFA 2EOMA 1BBOA 2EN3A 2RSIA 1TF3A 2EPCA 2D9HA 2EM2A 2EOYA 2YTNA 2EOZA 2YTJA 2EOIA 2JPAA 1JK1A 2WBSA 2YTGA 2ENHA 1F2IG 5KL6A 2EQ1A 2EPXA 1A1KA 1X6FA 1X6EA 4R2QA 2YTEA 1ZU1A 2CTDA 2EM0A 2EOFA 2DLKA 2DGCA 2LO3A 4X9JA 2M9AA 2DRPA 2YTFA 2EOHA 1G2DC 1RMDA 4R2DA 3EPLA 2EM5A 1A1LA 2EMWA 1JK2A 2EPRA 2ENCA 1X5WA 3MHHC 4F2JC 4M9VC 2EQ0A 1A1JA 1A1IA 2YSOA 2R1FA 2EOQA 3EPHA 4R2PA 2E72A 2EOEA 2LT7A 2EN7A 2WCC3 2I13A 5KL7A 2EMBA 1DGCA 4R2EA 1MEYC 2YTPA 2MKDA 1AAYA 2J7JA 2LCEA 2EE8A 1B69A 2YU8A 5KL4A 1ZAAC 2EPZA 1ZR9A 2EMGA 4GZNC 2MDGA 1TN9A 2EM7A 2ADRA 2LVHA 4F6NA 2ELYA 1UBDC 1A1FA 1UN6B 1P47A 2EM9A 2PRTA 2EL5A 2NABA 4R2SA 1X3CA 2EMCA 2EMZA 2DMIA 4F6MA 2EPUA 1YSAC 2EOOA 2LV2A 1NCSA 3MHSC 3UK3C 2EOXA 2DLQA 1TF6A 2EN2A 2RPCA 1WJPA 4WSGA 4FK5C 1Z1BA 2EM6A 2ENAA 2EMKA 2EN1A 2WBTA 2VRDA 3EPKA 2EMAA 2A25A 2EMYA 2EPPA 2YSPA 2EOJA 2WBUA 2YTQA 2EL6A 5KL5A 2EM4A 2EMLA 2EM8A 2EM3A 1A1HA 1BB8A 1G2FC 1KJKA 2EMIA 2EP3A 3M99B 1X6HA 2EPAA 2EORA 2YU5A 5KL2A 2YTDA 2CT1A 2YTOA 4IS1C 2YTIA 2ELZA 2CSHA 2EN4A 2YRHA 2EQ3A 2EMFA 4R2AA 1LLMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KL3 A;  2EJ4 A;  2EN8 A;  4IJD A;  1YUJ A;  1YUI A;  2BB8 A;  2EMH A;  3EPJ A;  2EOS A;  2YRK A;  4R2C A;  2EL4 A;  1A1G A;  2MKN A;  2EMX A;  2JP9 A;  3VHT B;  2YRM A;  4R2R A;  2GLI A;  2HGH A;  2EN6 A;  2GHF A;  2EOM A;  1BBO A;  2EN3 A;  2RSI A;  1TF3 A;  2EPC A;  2D9H A;  2EM2 A;  2EOY A;  2YTN A;  2EOZ A;  2YTJ A;  2EOI A;  2JPA A;  1JK1 A;  2WBS A;  2YTG A;  2ENH A;  1F2I G;  5KL6 A;  2EQ1 A;  2EPX A;  1A1K A;  1X6F A;  1X6E A;  4R2Q A;  2YTE A;  1ZU1 A;  2CTD A;  2EM0 A;  2EOF A;  2DLK A;  2DGC A;  2LO3 A;  4X9J A;  2M9A A;  2DRP A;  2YTF A;  2EOH A;  1G2D C;  1RMD A;  4R2D A;  3EPL A;  2EM5 A;  1A1L A;  2EMW A;  1JK2 A;  2EPR A;  2ENC A;  1X5W A;  3MHH C;  4F2J C;  4M9V C;  2EQ0 A;  1A1J A;  1A1I A;  2YSO A;  2R1F A;  2EOQ A;  3EPH A;  4R2P A;  2E72 A;  2EOE A;  2LT7 A;  2EN7 A;  2WCC 3;  2I13 A;  5KL7 A;  2EMB A;  1DGC A;  4R2E A;  1MEY C;  2YTP A;  2MKD A;  1AAY A;  2J7J A;  2LCE A;  2EE8 A;  1B69 A;  2YU8 A;  5KL4 A;  1ZAA C;  2EPZ A;  1ZR9 A;  2EMG A;  4GZN C;  2MDG A;  1TN9 A;  2EM7 A;  2ADR A;  2LVH A;  4F6N A;  2ELY A;  1UBD C;  1A1F A;  1UN6 B;  1P47 A;  2EM9 A;  2PRT A;  2EL5 A;  2NAB A;  4R2S A;  1X3C A;  2EMC A;  2EMZ A;  2DMI A;  4F6M A;  2EPU A;  1YSA C;  2EOO A;  2LV2 A;  1NCS A;  3MHS C;  3UK3 C;  2EOX A;  2DLQ A;  1TF6 A;  2EN2 A;  2RPC A;  1WJP A;  4WSG A;  4FK5 C;  1Z1B A;  2EM6 A;  2ENA A;  2EMK A;  2EN1 A;  2WBT A;  2VRD A;  3EPK A;  2EMA A;  2A25 A;  2EMY A;  2EPP A;  2YSP A;  2EOJ A;  2WBU A;  2YTQ A;  2EL6 A;  5KL5 A;  2EM4 A;  2EML A;  2EM8 A;  2EM3 A;  1A1H A;  1BB8 A;  1G2F C;  1KJK A;  2EMI A;  2EP3 A;  3M99 B;  1X6H A;  2EPA A;  2EOR A;  2YU5 A;  5KL2 A;  2YTD A;  2CT1 A;  2YTO A;  4IS1 C;  2YTI A;  2ELZ A;  2CSH A;  2EN4 A;  2YRH A;  2EQ3 A;  2EMF A;  4R2A A;  1LLM C; 
#chains in the Genus database with same CATH topology
 2JOB A;  2EN8 A;  1YUJ A;  1J5E E;  1RQ0 A;  2EPO A;  4R2C A;  5A6K A;  3KZY A;  2YRM A;  2L3J A;  2HGH A;  4RHB B;  3JTZ A;  4DV0 E;  2EOY A;  2EOZ A;  1O0W A;  4F9A B;  2EOI A;  2JPA A;  1JK1 A;  5TSE A;  2YTG A;  2L2M A;  1F2I G;  2CPN A;  5KL6 A;  5AAS A;  4LF6 E;  2EPX A;  2CTD A;  2EM0 A;  1YPN A;  2DGC A;  2LO3 A;  4JI1 E;  2DRP A;  2B3T B;  5T6J A;  4O5G A;  4R2D A;  2LBS B;  2UUB E;  1WHQ A;  2Q8U A;  4MLV A;  4WX9 A;  4KHP E;  1A1J A;  1A1I A;  2UXC E;  3J81 C;  4M2Z A;  1GZ6 A;  2G7H A;  3THN A;  1J26 A;  2UU9 E;  2WCC 3;  3RMP A;  1DGC A;  4NXM E;  4KZS A;  2MKD A;  1AAY A;  4OX9 E;  3P1X A;  4LF4 E;  1B69 A;  3C4B A;  2LE2 A;  2EPZ A;  4B3R E;  2MDG A;  4R03 A;  4DV2 E;  1TN9 A;  2EM7 A;  2B7V A;  3KWR A;  3ECR A;  3AV0 A;  2DSY A;  3BGH A;  4HTG A;  2KHX A;  1X3C A;  2EWL A;  5FLX C;  4DUY E;  1HR0 E;  4F6M A;  1GQE A;  1UIL A;  3FIG A;  4X64 E;  3MHS C;  2JR1 A;  1TF6 A;  1L4S A;  4Q28 A;  5A6A A;  2EN1 A;  2ODR C;  1PKP A;  1IQS A;  3HQ1 A;  4DV1 E;  5CFF E;  2YTQ A;  2IHR 1;  1ZBQ A;  2UUC E;  4GKJ E;  2EM8 A;  2EM3 A;  2KON A;  5KL2 A;  4LF8 E;  3L00 A;  1N36 E;  2UXB E;  2YT4 A;  4IS1 C;  2ELZ A;  1STU A;  2EN4 A;  2EQ3 A;  1SFE A;  2EMF A;  1QU6 A;  4L5N C;  4WXC A;  3ADJ A;  1YUI A;  2EPM X;  1X48 A;  1YYO A;  4X62 E;  1FJG E;  4BHC A;  2V89 A;  2V83 A;  4MLQ A;  1N33 E;  1DQ3 A;  4LTY A;  1WXR A;  4WPY A;  1I94 E;  4F9C B;  2DMY A;  3OTO E;  2E1M A;  5AC5 A;  2EPC A;  2EM2 A;  2L3C A;  4LF7 E;  2EQ1 A;  1PDA A;  4R2Q A;  2YTE A;  2EOF A;  3JU0 A;  1IBK E;  4RH8 A;  2M9A A;  4B3S E;  2M1S A;  3H09 A;  3MSW A;  3HPZ A;  1RMD A;  2LMZ A;  2EM5 A;  4JYA E;  2EMW A;  5AE3 A;  4NHR A;  2MC6 A;  4JV5 E;  2HHH E;  2MC5 A;  3BID A;  4DV3 E;  4M9V C;  2YSO A;  4LF5 E;  1IBM E;  3DF6 A;  2EOQ A;  4DR7 E;  3EPH A;  5LLQ A;  5AE2 A;  3T1H E;  5IWA E;  2LT7 A;  5KL7 A;  2NUF A;  4DUZ E;  4YHH E;  2YTP A;  2J7J A;  4L8N A;  5A6B A;  1N34 E;  2YU8 A;  4DR3 E;  4NXN E;  3ADL A;  1GTK A;  4X8W A;  2EMG A;  2JOX A;  4B3M E;  2UUA E;  2ADR A;  2LVH A;  1IBL E;  2F4V E;  1NEI A;  4YY3 E;  4F6N A;  4I8O A;  1XMO E;  2FGG A;  1UN6 B;  2L8T A;  2PRT A;  2ODR D;  1PJS A;  2MDR A;  1QNT A;  1X47 A;  4Q35 B;  1YSA C;  4LF9 E;  1NCS A;  3VYX A;  3LLH A;  1FKA E;  2EN2 A;  5A69 A;  1YZ9 A;  4DKK A;  4WSG A;  4FK5 C;  2EM6 A;  2ENA A;  2EMK A;  2WBT A;  2EPP A;  3IWC A;  4JI3 E;  2B9D A;  2EPN A;  4O24 A;  2L33 A;  5KL5 A;  2VQF E;  2EM4 A;  3JAM C;  1ZBT A;  2K4V A;  1A1H A;  2FTX B;  1G2F C;  2I9I A;  2RTX A;  3IWB A;  3HXL A;  2EP3 A;  5F3W A;  3C6K A;  1HNW E;  2EOR A;  3BBG A;  2CT1 A;  1IQO A;  3ADI A;  2CSH A;  4R2A A;  2L92 A;  2JY9 A;  2EJ4 A;  4NZV A;  2RS7 A;  3BF2 A;  2EMH A;  3EPJ A;  2ZM6 E;  1HNX E;  2L2K B;  2EL4 A;  2EMX A;  2JP9 A;  2GLI A;  4TUI A;  2LJU A;  1T4O A;  2EOM A;  3HTX A;  2RSI A;  1TF3 A;  2D9H A;  2YTN A;  2N3H A;  1T39 A;  5A6J A;  2LRS A;  4N4R B;  2NA2 A;  4BCA A;  1X6E A;  1X6F A;  3THO B;  1ZU1 A;  4X9J A;  2EOH A;  5LMU E;  1X49 A;  1YFH A;  4B3T E;  2VE7 C;  2LUP B;  2HJJ A;  5A6B D;  2M4I A;  1JK2 A;  2KOU A;  2DB2 A;  4P78 A;  2ENC A;  1EH8 A;  1X5W A;  4F9B B;  1N3G A;  2DIX A;  2EQ0 A;  3ZOQ B;  2EZ6 A;  2K7I A;  2R1F A;  2YPN A;  2EOE A;  2NUG A;  4BMJ A;  2I13 A;  2EMB A;  1MEY C;  2RS6 A;  2V8Q B;  5AE1 A;  1EKZ A;  4JI0 E;  2N8X A;  5KL4 A;  2N3G A;  3OML A;  3DJW A;  2H36 X;  1ZR9 A;  4WFT A;  4WSP A;  2VQE E;  4LFB E;  4DV7 E;  4DV5 E;  5ADZ A;  1UBD C;  2ELY A;  2L6M A;  1A1F A;  4M30 A;  4BHB A;  3F6G A;  1P47 A;  2UXD E;  2LUQ A;  2EM9 A;  2V85 A;  2EL5 A;  4DR5 E;  4O4K A;  2EMZ A;  1UHZ A;  2EPU A;  4JI5 E;  3VYY A;  2EOO A;  2LV2 A;  4JI8 E;  3UK3 C;  3QG5 C;  2DLQ A;  4DR1 E;  2LTS A;  4OOG C;  4AQY E;  1Z1B A;  4DR2 E;  3EQ1 A;  2EMY A;  2A25 A;  2WZO A;  4DV6 E;  3VK6 A;  4WXD A;  2EL6 A;  2L2N A;  4ZYG A;  2EML A;  1BB8 A;  2LTR A;  1WRJ A;  1KJK A;  4M0V A;  4GEQ B;  3M99 B;  1X6H A;  4ZYH A;  2JVA A;  3C4T A;  2R76 A;  2YTI A;  4LU9 A;  2YRH A;  4BC7 A;  3EPL A;  5KL3 A;  4IJD A;  4KWY A;  2BB8 A;  1PJQ A;  2EOS A;  5IXM B;  4WYQ B;  3C6M A;  3IWD A;  1PJT A;  2BBG A;  1EH6 A;  2YRK A;  2MKN A;  1A1G A;  5AC4 A;  3VHT B;  4BBY A;  2VF1 A;  4R2R A;  2EN6 A;  3AUZ A;  2GHF A;  4JI6 E;  1BBO A;  2EN3 A;  4BC9 A;  4JI4 E;  2E5L E;  4J8Z A;  2JXP A;  2YTJ A;  2WBS A;  5BR8 E;  4DR6 E;  4K0K E;  2ENH A;  4DV4 E;  1XMQ E;  1A1K A;  1BBG A;  4JI7 E;  2DLK A;  1T38 A;  2RSM A;  4LFC E;  1T4L B;  3J7A G;  2EPL X;  1AH5 A;  2M7Q A;  2YTF A;  4BS9 A;  1G2D C;  4GKK E;  1YYK A;  2JYA A;  2YZT A;  1A1L A;  3KZZ A;  2EPR A;  3J80 C;  1XNR E;  3MHH C;  4F2J C;  3K6Q A;  2F8B A;  2V87 A;  5A2Q C;  3F6H A;  4O43 A;  2E72 A;  5LL6 R;  3TQM A;  4R2P A;  4ZYE A;  3HPS A;  2B7T A;  2EN7 A;  4R8O A;  4R2E A;  2FV4 B;  2LCE A;  2EE8 A;  3T1Y E;  5LMN E;  4LFA E;  1ZAA C;  4P7D A;  4GZN C;  2EPK X;  4X66 E;  3ADG A;  4DR4 E;  3J7Y p;  2RQL A;  1HNZ E;  3LML A;  2V88 A;  2GPI A;  1KYQ A;  1MGT A;  2NAB A;  4R2S A;  2JWO A;  2EMC A;  4HEI A;  2DMI A;  2LJH A;  2NUE A;  1WHN A;  2HC5 A;  4TUG A;  2EOX A;  5DNY A;  1XNQ E;  4X65 E;  5IV8 B;  2RPC A;  1T4N A;  1WJP A;  4ZYD A;  1IMU A;  1N32 E;  2VRD A;  3EPK A;  2EMA A;  2YSP A;  1SR9 A;  2V86 A;  2EOJ A;  2WBU A;  1DI2 A;  1RC7 A;  1YYW A;  2YWQ A;  4DMI A;  2EMI A;  2YU5 A;  2EPA A;  4F54 A;  2YTD A;  5IT9 C;  4JI2 E;  1EH7 A;  2YTO A;  1LLM C; 
#chains in the Genus database with same CATH homology
 5KL3 A;  2EJ4 A;  2EN8 A;  4IJD A;  1YUJ A;  1YUI A;  2BB8 A;  2EMH A;  3EPJ A;  2EOS A;  2YRK A;  4R2C A;  2EL4 A;  1A1G A;  2MKN A;  2EMX A;  2JP9 A;  3VHT B;  2YRM A;  4R2R A;  2GLI A;  2HGH A;  2EN6 A;  2GHF A;  2EOM A;  1BBO A;  2EN3 A;  2RSI A;  1TF3 A;  2EPC A;  2D9H A;  2EM2 A;  2EOY A;  2YTN A;  2EOZ A;  2YTJ A;  2EOI A;  2JPA A;  1JK1 A;  2WBS A;  2YTG A;  2ENH A;  1F2I G;  5KL6 A;  2EQ1 A;  2EPX A;  1A1K A;  1X6F A;  1X6E A;  4R2Q A;  2YTE A;  1ZU1 A;  2CTD A;  2EM0 A;  2EOF A;  2DLK A;  2DGC A;  2LO3 A;  4X9J A;  2M9A A;  2DRP A;  2YTF A;  2EOH A;  1G2D C;  1RMD A;  4R2D A;  3EPL A;  2EM5 A;  1A1L A;  2EMW A;  1JK2 A;  2EPR A;  2ENC A;  1X5W A;  3MHH C;  4F2J C;  4M9V C;  2EQ0 A;  1A1J A;  1A1I A;  2YSO A;  2R1F A;  2EOQ A;  3EPH A;  4R2P A;  2E72 A;  2EOE A;  2LT7 A;  2EN7 A;  2WCC 3;  2I13 A;  5KL7 A;  2EMB A;  1DGC A;  4R2E A;  1MEY C;  2YTP A;  2MKD A;  1AAY A;  2J7J A;  2LCE A;  2EE8 A;  1B69 A;  2YU8 A;  5KL4 A;  1ZAA C;  2EPZ A;  1ZR9 A;  2EMG A;  4GZN C;  2MDG A;  1TN9 A;  2EM7 A;  2ADR A;  2LVH A;  4F6N A;  2ELY A;  1UBD C;  1A1F A;  1UN6 B;  1P47 A;  2EM9 A;  2PRT A;  2EL5 A;  2NAB A;  4R2S A;  1X3C A;  2EMC A;  2EMZ A;  2DMI A;  4F6M A;  2EPU A;  1YSA C;  2EOO A;  2LV2 A;  1NCS A;  3MHS C;  3UK3 C;  2EOX A;  2DLQ A;  1TF6 A;  2EN2 A;  2RPC A;  1WJP A;  4WSG A;  4FK5 C;  1Z1B A;  2EM6 A;  2ENA A;  2EMK A;  2EN1 A;  2WBT A;  2VRD A;  3EPK A;  2EMA A;  2A25 A;  2EMY A;  2EPP A;  2YSP A;  2EOJ A;  2WBU A;  2YTQ A;  2EL6 A;  5KL5 A;  2EM4 A;  2EML A;  2EM8 A;  2EM3 A;  1A1H A;  1BB8 A;  1G2F C;  1KJK A;  2EMI A;  2EP3 A;  3M99 B;  1X6H A;  2EPA A;  2EOR A;  2YU5 A;  5KL2 A;  2YTD A;  2CT1 A;  2YTO A;  4IS1 C;  2YTI A;  2ELZ A;  2CSH A;  2EN4 A;  2YRH A;  2EQ3 A;  2EMF A;  4R2A A;  1LLM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...