1YUJA

Solution nmr structure of the gaga factor/dna complex, 50 structures
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
54
structure length
54
Chain Sequence
PKAKRAKHPPGTEKPRSRSQSEQPATCPICYAVIRQSRNLRRHLELRHFAKPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of a specific GAGA factor-DNA complex reveals a modular binding mode.
pubmed doi rcsb
molecule tags Dna binding protein/dna
molecule keywords DNA (5'-D(*GP*CP*CP*GP*AP*GP*AP*GP*TP*AP*C)-3')
total genus 11
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 1996-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09237 GAGA GAGA factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1yujA00
2EMZA 1X6FA 2EMAA 1YUJA 2A25A 2YTFA 2YRKA 2EM0A 2EMLA 3MHSC 5KL7A 2EM6A 2EOSA 2EP3A 2M9AA 3EPLA 2EQ0A 2EPPA 1TN9A 2EM3A 4R2AA 2BB8A 2EN1A 1A1KA 2JPAA 4R2EA 4WSGA 2WBSA 5KL4A 2YRMA 2EOIA 2ELYA 5KL5A 2EM9A 2DGCA 2EOYA 2YTQA 1UN6B 2ELZA 4R2PA 1F2IG 4R2RA 1LLMC 1A1HA 3VHTB 2VRDA 1ZR9A 2EORA 2YTIA 4R2DA 4F6NA 2GHFA 2EOMA 2LVHA 2EOXA 1JK1A 4R2QA 2EOHA 4F6MA 1AAYA 1G2FC 2LO3A 1X6HA 3UK3C 2NABA 2EL6A 1MEYC 4R2CA 2MDGA 2EPUA 2YTPA 2YTDA 2MKDA 2GLIA 3MHHC 3EPKA 2EN4A 2RSIA 2YTOA 2EN2A 4X9JA 2LCEA 4F2JC 1A1LA 1Z1BA 2EPRA 1X6EA 2R1FA 2EPZA 2YTNA 2EMHA 1TF6A 2YTGA 2EMBA 1G2DC 1RMDA 2EOZA 4IJDA 1B69A 1KJKA 2MKNA 2EOOA 2WCC3 1TF3A 2YU8A 2EM7A 2HGHA 2YTJA 1A1GA 2EPXA 2LT7A 2DMIA 5KL3A 2EJ4A 2EM8A 1WJPA 2EMWA 2EM2A 2EM4A 3EPJA 5KL2A 2CT1A 2D9HA 2EMYA 2ADRA 2EMCA 2EOEA 2EN7A 2YRHA 2EOJA 2EMFA 1NCSA 2EN3A 1A1IA 1X5WA 2EM5A 1DGCA 2DLQA 3M99B 2WBUA 2LV2A 1UBDC 3EPHA 1JK2A 2DLKA 2ENAA 2EOFA 2EPCA 1P47A 1ZAAC 5KL6A 2ENCA 4IS1C 2YSPA 2ENHA 2EN6A 1A1FA 2EOQA 4R2SA 4M9VC 2EE8A 2EL4A 2EMXA 2EPAA 2JP9A 2EMGA 1ZU1A 1YSAC 2EN8A 1X3CA 4FK5C 1BBOA 1YUIA 2YTEA 2RPCA 4GZNC 2EL5A 2WBTA 2YSOA 2CSHA 2J7JA 2CTDA 2YU5A 2DRPA 2EQ1A 2PRTA 2EMKA 1BB8A 1A1JA 2EMIA 2EQ3A 2E72A 2I13A
chains in the Genus database with same CATH superfamily
4LF5E 2N3GA 2EMZA 3LMLA 5AE3A 3J7AG 4DV3E 1X6FA 5KL7A 4N4RB 4NXME 2EM6A 3EPLA 2EPPA 3J7Yp 1DI2A 1A1KA 4JYAE 2Q8UA 2V89A 4DV1E 5KL5A 1L4SA 4OOGC 4ZYHA 4R2PA 4R2RA 2L92A 1LLMC 4JI6E 2RSMA 2VRDA 1N34E 2EORA 2YTIA 1JK1A 2EOHA 1AH5A 4RHBB 2V86A 4ZYDA 1G2FC 1IMUA 2B3TB 2CPNA 2EPUA 3THOB 2JXPA 4RH8A 3DF6A 4DV4E 2YTPA 4MLQA 2YTDA 3EPKA 3TQMA 2RSIA 2DMYA 4DMIA 4J8ZA 1Z1BA 1DQ3A 1FJGE 4Q35B 1T4NA 1WHNA 2YZTA 1RMDA 3RMPA 1O0WA 2LJUA 4L8NA 1T39A 3F6HA 2V88A 1KJKA 2V83A 2WCC3 4JI2E 2V87A 2YTJA 1A1GA 2LT7A 3T1HE 2VF1A 5KL2A 3ADIA 4P7DA 3BF2A 4R03A 4DV2E 2EN7A 3MSWA 2EOJA 3VK6A 2N3HA 2EM5A 1IQOA 3M99B 3IWCA 2DLKA 2EPCA 1SR9A 2EWLA 3ADJA 2JVAA 4DR7E 4DR3E 1IBKE 4B3RE 1X48A 3LLHA 4M2ZA 1N33E 1N32E 4JI0E 4B3SE 2MC5A 1T38A 2EMXA 1KYQA 2FTXB 2B7TA 3P1XA 1SFEA 3ECRA 3KZYA 1STUA 5AE2A 2MDRA 2RPCA 4LFAE 2RS7A 2YU5A 4BC9A 2DRPA 4DUYE 1UILA 3JAMC 2EPOA 3KZZA 3C6MA 2LE2A 2E72A 4GEQB 4DR6E 2I13A 2ODRD 4M30A 2EPNA 2ODRC 2YRKA 2EMLA 4KWYA 1EKZA 2EOSA 2EP3A 3C6KA 5A6BA 2EM3A 3OMLA 2BB8A 5AC4A 2JPAA 4NHRA 2L2KB 2WBSA 5KL4A 2YRMA 2JWOA 2EOIA 4L5NC 2ELYA 2KHXA 1FKAE 4WYQB 1PJQA 2DGCA 2EOYA 2N8XA 2ELZA 2VE7C 2K7IA 2L6MA 2UUBE 1EH8A 1PJSA 2IHR1 2I9IA 2LVHA 2EOXA 2F4VE 4F6MA 1AAYA 1BBGA 1X6HA 3UK3C 2EL6A 3BGHA 4I8OA 3F6GA 4R2CA 5A6KA 4LF4E 4F9AB 2V8QB 1N36E 4P78A 2GLIA 3AV0A 2LCEA 2UXCE 1A1LA 2EPRA 1X6EA 2L8TA 2EMHA 2DB2A 3HPSA 4B3TE 5F3WA 4F54A 2EOZA 3ADGA 2VQEE 5TSEA 4BBYA 2YU8A 5A2QC 4ZYEA 5KL3A 1ZBTA 3HTXA 1IBLE 2EZ6A 2CT1A 2L3JA 1N3GA 2EMYA 1HR0E 4BCAA 3J80C 2YPNA 1DGCA 4O24A 2DLQA 2WBUA 2YWQA 2ENAA 1GZ6A 3C4BA 5KL6A 2UUCE 2WZOA 4DR1E 3HPZA 4LFCE 4TUIA 4LF7E 4R2SA 4M9VC 4LF8E 2JOBA 2EL4A 5FLXC 4B3ME 4K0KE 4JI1E 2L2MA 1YSAC 2EN8A 1YYKA 2UXDE 1X3CA 2NA2A 3FIGA 4DUZE 1YUIA 1HNWE 2YTEA 2BBGA 4R8OA 5LL6R 5A6AA 2UXBE 2ZM6E 2RS6A 5IWAE 3VYXA 2NUEA 2LUPB 2F8BA 3EQ1A 2GPIA 2HHHE 4Q28A 5LLQA 2FGGA 5AASA 2EMAA 1YUJA 2A25A 2YTFA 2EM0A 4DR2E 4F9BB 2M9AA 2EQ0A 1TN9A 2M7QA 2LTRA 4HEIA 3L00A 1WRJA 4O5GA 4M0VA 3C4TA 2KOUA 1X47A 1HNXE 3J81C 2YTQA 4BHCA 5ADZA 4MLVA 1F2IG 1ZR9A 4YY3E 2GHFA 5IV8B 4R2QA 2JY9A 5AC5A 5LMNE 2K4VA 4WXDA 1HNZE 2NABA 1MEYC 3THNA 4BHBA 4GKJE 3JTZA 4X66E 4X65E 1RQ0A 4DV6E 2MKDA 3AUZA 3MHHC 2EN4A 2EPMX 2EN2A 2L2NA 4X9JA 4F2JC 2R1FA 1XMOE 2EPZA 3ADLA 1PKPA 2YTGA 2DIXA 2H36X 2RTXA 1GTKA 3ZOQB 4IJDA 1B69A 2MKNA 4DR4E 2EM7A 2EPXA 1WJPA 2MC6A 2EPLX 2EM2A 2EM4A 4BMJA 5IXMB 1QNTA 3EPJA 1YZ9A 4NZVA 1QU6A 3HXLA 4LTYA 2EMFA 5BR8E 2EN3A 1A1IA 1X5WA 2LMZA 2LV2A 4WFTA 1UBDC 1JK2A 3EPHA 2L3CA 4JI4E 1P47A 4JI5E 1ZAAC 4LU9A 4IS1C 1EH6A 3KWRA 3QG5C 4BS9A 4JI8E 3T1YE 4WSPA 2EOQA 2EE8A 5CFFE 1YYOA 1ZU1A 3DJWA 4DV5E 3K6QA 1YFHA 5DNYA 2VQFE 4FK5C 1PDAA 5A6JA 1EH7A 2YT4A 4F9CB 4ZYGA 4GZNC 2EL5A 4WX9A 2B9DA 2J7JA 1I94E 2CTDA 2NUFA 2EMKA 2M4IA 2FV4B 1BB8A 2E5LE 1GQEA 2EMIA 3BIDA 2EQ3A 2JR1A 2HJJA 2JYAA 2G7HA 4DR5E 3MHSC 4R2AA 4LF9E 2RQLA 2EN1A 3IWDA 4TUGA 4X8WA 2KONA 5T6JA 4R2EA 4WSGA 1MGTA 1J26A 2LBSB 2EM9A 1WXRA 3VYYA 1UN6B 3OTOE 1A1HA 1T4OA 3VHTB 4DV0E 4R2DA 4OX9E 4F6NA 2EOMA 5A6BD 1XNQE 2LO3A 2E1MA 2MDGA 5AE1A 4WXCA 3IWBA 2YTOA 2HC5A 4GKKE 1NEIA 2LTSA 2UU9E 4O43A 2UUAE 4O4KA 2V85A 2YTNA 1TF6A 2EMBA 4YHHE 1G2DC 1J5EE 4LFBE 4JI7E 3BBGA 2B7VA 2M1SA 1IQSA 2EOOA 1TF3A 1WHQA 2HGHA 1RC7A 2DMIA 2EJ4A 2EM8A 2EMWA 2D9HA 3H09A 2ADRA 2EMCA 2EOEA 2EPKX 1PJTA 2YRHA 5IT9C 4X64E 1NCSA 4BC7A 1ZBQA 1T4LB 2L33A 4HTGA 2EOFA 2LUQA 2ENCA 4WPYA 4NXNE 2YSPA 2ENHA 2EN6A 1UHZA 1A1FA 3JU0A 4JI3E 1IBME 2EPAA 2JP9A 2R76A 1YPNA 2EMGA 4KHPE 5LMUE 2NUGA 2LJHA 4JV5E 4LF6E 4DV7E 1X49A 1BBOA 3HQ1A 4X62E 1YYWA 2WBTA 2YSOA 2LRSA 2CSHA 5A69A 1XNRE 2EQ1A 2PRTA 1XMQE 4AQYE 4DKKA 1A1JA 2JOXA 4KZSA 2DSYA
chains in the Genus database with same CATH topology
2EMZA 1X6FA 2EMAA 1YUJA 2A25A 2YTFA 2YRKA 2EM0A 2EMLA 3MHSC 5KL7A 2EM6A 2EOSA 2EP3A 2M9AA 3EPLA 2EQ0A 2EPPA 1TN9A 2EM3A 4R2AA 2BB8A 2EN1A 1A1KA 2JPAA 4R2EA 4WSGA 2WBSA 5KL4A 2YRMA 2EOIA 2ELYA 5KL5A 2EM9A 2DGCA 2EOYA 2YTQA 1UN6B 2ELZA 4R2PA 1F2IG 4R2RA 1LLMC 1A1HA 3VHTB 2VRDA 1ZR9A 2EORA 2YTIA 4R2DA 4F6NA 2GHFA 2EOMA 2LVHA 2EOXA 1JK1A 4R2QA 2EOHA 4F6MA 1AAYA 1G2FC 2LO3A 1X6HA 3UK3C 2NABA 2EL6A 1MEYC 4R2CA 2MDGA 2EPUA 2YTPA 2YTDA 2MKDA 2GLIA 3MHHC 3EPKA 2EN4A 2RSIA 2YTOA 2EN2A 4X9JA 2LCEA 4F2JC 1A1LA 1Z1BA 2EPRA 1X6EA 2R1FA 2EPZA 2YTNA 2EMHA 1TF6A 2YTGA 2EMBA 1G2DC 1RMDA 2EOZA 4IJDA 1B69A 1KJKA 2MKNA 2EOOA 2WCC3 1TF3A 2YU8A 2EM7A 2HGHA 2YTJA 1A1GA 2EPXA 2LT7A 2DMIA 5KL3A 2EJ4A 2EM8A 1WJPA 2EMWA 2EM2A 2EM4A 3EPJA 5KL2A 2CT1A 2D9HA 2EMYA 2ADRA 2EMCA 2EOEA 2EN7A 2YRHA 2EOJA 2EMFA 1NCSA 2EN3A 1A1IA 1X5WA 2EM5A 1DGCA 2DLQA 3M99B 2WBUA 2LV2A 1UBDC 3EPHA 1JK2A 2DLKA 2ENAA 2EOFA 2EPCA 1P47A 1ZAAC 5KL6A 2ENCA 4IS1C 2YSPA 2ENHA 2EN6A 1A1FA 2EOQA 4R2SA 4M9VC 2EE8A 2EL4A 2EMXA 2EPAA 2JP9A 2EMGA 1ZU1A 1YSAC 2EN8A 1X3CA 4FK5C 1BBOA 1YUIA 2YTEA 2RPCA 4GZNC 2EL5A 2WBTA 2YSOA 2CSHA 2J7JA 2CTDA 2YU5A 2DRPA 2EQ1A 2PRTA 2EMKA 1BB8A 1A1JA 2EMIA 2EQ3A 2E72A 2I13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMZ A;  1X6F A;  2EMA A;  1YUJ A;  2A25 A;  2YTF A;  2YRK A;  2EM0 A;  2EML A;  3MHS C;  5KL7 A;  2EM6 A;  2EOS A;  2EP3 A;  2M9A A;  3EPL A;  2EQ0 A;  2EPP A;  1TN9 A;  2EM3 A;  4R2A A;  2BB8 A;  2EN1 A;  1A1K A;  2JPA A;  4R2E A;  4WSG A;  2WBS A;  5KL4 A;  2YRM A;  2EOI A;  2ELY A;  5KL5 A;  2EM9 A;  2DGC A;  2EOY A;  2YTQ A;  1UN6 B;  2ELZ A;  4R2P A;  1F2I G;  4R2R A;  1LLM C;  1A1H A;  3VHT B;  2VRD A;  1ZR9 A;  2EOR A;  2YTI A;  4R2D A;  4F6N A;  2GHF A;  2EOM A;  2LVH A;  2EOX A;  1JK1 A;  4R2Q A;  2EOH A;  4F6M A;  1AAY A;  1G2F C;  2LO3 A;  1X6H A;  3UK3 C;  2NAB A;  2EL6 A;  1MEY C;  4R2C A;  2MDG A;  2EPU A;  2YTP A;  2YTD A;  2MKD A;  2GLI A;  3MHH C;  3EPK A;  2EN4 A;  2RSI A;  2YTO A;  2EN2 A;  4X9J A;  2LCE A;  4F2J C;  1A1L A;  1Z1B A;  2EPR A;  1X6E A;  2R1F A;  2EPZ A;  2YTN A;  2EMH A;  1TF6 A;  2YTG A;  2EMB A;  1G2D C;  1RMD A;  2EOZ A;  4IJD A;  1B69 A;  1KJK A;  2MKN A;  2EOO A;  2WCC 3;  1TF3 A;  2YU8 A;  2EM7 A;  2HGH A;  2YTJ A;  1A1G A;  2EPX A;  2LT7 A;  2DMI A;  5KL3 A;  2EJ4 A;  2EM8 A;  1WJP A;  2EMW A;  2EM2 A;  2EM4 A;  3EPJ A;  5KL2 A;  2CT1 A;  2D9H A;  2EMY A;  2ADR A;  2EMC A;  2EOE A;  2EN7 A;  2YRH A;  2EOJ A;  2EMF A;  1NCS A;  2EN3 A;  1A1I A;  1X5W A;  2EM5 A;  1DGC A;  2DLQ A;  3M99 B;  2WBU A;  2LV2 A;  1UBD C;  3EPH A;  1JK2 A;  2DLK A;  2ENA A;  2EOF A;  2EPC A;  1P47 A;  1ZAA C;  5KL6 A;  2ENC A;  4IS1 C;  2YSP A;  2ENH A;  2EN6 A;  1A1F A;  2EOQ A;  4R2S A;  4M9V C;  2EE8 A;  2EL4 A;  2EMX A;  2EPA A;  2JP9 A;  2EMG A;  1ZU1 A;  1YSA C;  2EN8 A;  1X3C A;  4FK5 C;  1BBO A;  1YUI A;  2YTE A;  2RPC A;  4GZN C;  2EL5 A;  2WBT A;  2YSO A;  2CSH A;  2J7J A;  2CTD A;  2YU5 A;  2DRP A;  2EQ1 A;  2PRT A;  2EMK A;  1BB8 A;  1A1J A;  2EMI A;  2EQ3 A;  2E72 A;  2I13 A; 
#chains in the Genus database with same CATH topology
 4LF5 E;  2N3G A;  2EMZ A;  3LML A;  5AE3 A;  3J7A G;  4DV3 E;  1X6F A;  5KL7 A;  4N4R B;  4NXM E;  2EM6 A;  3EPL A;  2EPP A;  3J7Y p;  1DI2 A;  1A1K A;  4JYA E;  2Q8U A;  2V89 A;  4DV1 E;  5KL5 A;  1L4S A;  4OOG C;  4ZYH A;  4R2P A;  4R2R A;  2L92 A;  1LLM C;  4JI6 E;  2RSM A;  2VRD A;  1N34 E;  2EOR A;  2YTI A;  1JK1 A;  2EOH A;  1AH5 A;  4RHB B;  2V86 A;  4ZYD A;  1G2F C;  1IMU A;  2B3T B;  2CPN A;  2EPU A;  3THO B;  2JXP A;  4RH8 A;  3DF6 A;  4DV4 E;  2YTP A;  4MLQ A;  2YTD A;  3EPK A;  3TQM A;  2RSI A;  2DMY A;  4DMI A;  4J8Z A;  1Z1B A;  1DQ3 A;  1FJG E;  4Q35 B;  1T4N A;  1WHN A;  2YZT A;  1RMD A;  3RMP A;  1O0W A;  2LJU A;  4L8N A;  1T39 A;  3F6H A;  2V88 A;  1KJK A;  2V83 A;  2WCC 3;  4JI2 E;  2V87 A;  2YTJ A;  1A1G A;  2LT7 A;  3T1H E;  2VF1 A;  5KL2 A;  3ADI A;  4P7D A;  3BF2 A;  4R03 A;  4DV2 E;  2EN7 A;  3MSW A;  2EOJ A;  3VK6 A;  2N3H A;  2EM5 A;  1IQO A;  3M99 B;  3IWC A;  2DLK A;  2EPC A;  1SR9 A;  2EWL A;  3ADJ A;  2JVA A;  4DR7 E;  4DR3 E;  1IBK E;  4B3R E;  1X48 A;  3LLH A;  4M2Z A;  1N33 E;  1N32 E;  4JI0 E;  4B3S E;  2MC5 A;  1T38 A;  2EMX A;  1KYQ A;  2FTX B;  2B7T A;  3P1X A;  1SFE A;  3ECR A;  3KZY A;  1STU A;  5AE2 A;  2MDR A;  2RPC A;  4LFA E;  2RS7 A;  2YU5 A;  4BC9 A;  2DRP A;  4DUY E;  1UIL A;  3JAM C;  2EPO A;  3KZZ A;  3C6M A;  2LE2 A;  2E72 A;  4GEQ B;  4DR6 E;  2I13 A;  2ODR D;  4M30 A;  2EPN A;  2ODR C;  2YRK A;  2EML A;  4KWY A;  1EKZ A;  2EOS A;  2EP3 A;  3C6K A;  5A6B A;  2EM3 A;  3OML A;  2BB8 A;  5AC4 A;  2JPA A;  4NHR A;  2L2K B;  2WBS A;  5KL4 A;  2YRM A;  2JWO A;  2EOI A;  4L5N C;  2ELY A;  2KHX A;  1FKA E;  4WYQ B;  1PJQ A;  2DGC A;  2EOY A;  2N8X A;  2ELZ A;  2VE7 C;  2K7I A;  2L6M A;  2UUB E;  1EH8 A;  1PJS A;  2IHR 1;  2I9I A;  2LVH A;  2EOX A;  2F4V E;  4F6M A;  1AAY A;  1BBG A;  1X6H A;  3UK3 C;  2EL6 A;  3BGH A;  4I8O A;  3F6G A;  4R2C A;  5A6K A;  4LF4 E;  4F9A B;  2V8Q B;  1N36 E;  4P78 A;  2GLI A;  3AV0 A;  2LCE A;  2UXC E;  1A1L A;  2EPR A;  1X6E A;  2L8T A;  2EMH A;  2DB2 A;  3HPS A;  4B3T E;  5F3W A;  4F54 A;  2EOZ A;  3ADG A;  2VQE E;  5TSE A;  4BBY A;  2YU8 A;  5A2Q C;  4ZYE A;  5KL3 A;  1ZBT A;  3HTX A;  1IBL E;  2EZ6 A;  2CT1 A;  2L3J A;  1N3G A;  2EMY A;  1HR0 E;  4BCA A;  3J80 C;  2YPN A;  1DGC A;  4O24 A;  2DLQ A;  2WBU A;  2YWQ A;  2ENA A;  1GZ6 A;  3C4B A;  5KL6 A;  2UUC E;  2WZO A;  4DR1 E;  3HPZ A;  4LFC E;  4TUI A;  4LF7 E;  4R2S A;  4M9V C;  4LF8 E;  2JOB A;  2EL4 A;  5FLX C;  4B3M E;  4K0K E;  4JI1 E;  2L2M A;  1YSA C;  2EN8 A;  1YYK A;  2UXD E;  1X3C A;  2NA2 A;  3FIG A;  4DUZ E;  1YUI A;  1HNW E;  2YTE A;  2BBG A;  4R8O A;  5LL6 R;  5A6A A;  2UXB E;  2ZM6 E;  2RS6 A;  5IWA E;  3VYX A;  2NUE A;  2LUP B;  2F8B A;  3EQ1 A;  2GPI A;  2HHH E;  4Q28 A;  5LLQ A;  2FGG A;  5AAS A;  2EMA A;  1YUJ A;  2A25 A;  2YTF A;  2EM0 A;  4DR2 E;  4F9B B;  2M9A A;  2EQ0 A;  1TN9 A;  2M7Q A;  2LTR A;  4HEI A;  3L00 A;  1WRJ A;  4O5G A;  4M0V A;  3C4T A;  2KOU A;  1X47 A;  1HNX E;  3J81 C;  2YTQ A;  4BHC A;  5ADZ A;  4MLV A;  1F2I G;  1ZR9 A;  4YY3 E;  2GHF A;  5IV8 B;  4R2Q A;  2JY9 A;  5AC5 A;  5LMN E;  2K4V A;  4WXD A;  1HNZ E;  2NAB A;  1MEY C;  3THN A;  4BHB A;  4GKJ E;  3JTZ A;  4X66 E;  4X65 E;  1RQ0 A;  4DV6 E;  2MKD A;  3AUZ A;  3MHH C;  2EN4 A;  2EPM X;  2EN2 A;  2L2N A;  4X9J A;  4F2J C;  2R1F A;  1XMO E;  2EPZ A;  3ADL A;  1PKP A;  2YTG A;  2DIX A;  2H36 X;  2RTX A;  1GTK A;  3ZOQ B;  4IJD A;  1B69 A;  2MKN A;  4DR4 E;  2EM7 A;  2EPX A;  1WJP A;  2MC6 A;  2EPL X;  2EM2 A;  2EM4 A;  4BMJ A;  5IXM B;  1QNT A;  3EPJ A;  1YZ9 A;  4NZV A;  1QU6 A;  3HXL A;  4LTY A;  2EMF A;  5BR8 E;  2EN3 A;  1A1I A;  1X5W A;  2LMZ A;  2LV2 A;  4WFT A;  1UBD C;  1JK2 A;  3EPH A;  2L3C A;  4JI4 E;  1P47 A;  4JI5 E;  1ZAA C;  4LU9 A;  4IS1 C;  1EH6 A;  3KWR A;  3QG5 C;  4BS9 A;  4JI8 E;  3T1Y E;  4WSP A;  2EOQ A;  2EE8 A;  5CFF E;  1YYO A;  1ZU1 A;  3DJW A;  4DV5 E;  3K6Q A;  1YFH A;  5DNY A;  2VQF E;  4FK5 C;  1PDA A;  5A6J A;  1EH7 A;  2YT4 A;  4F9C B;  4ZYG A;  4GZN C;  2EL5 A;  4WX9 A;  2B9D A;  2J7J A;  1I94 E;  2CTD A;  2NUF A;  2EMK A;  2M4I A;  2FV4 B;  1BB8 A;  2E5L E;  1GQE A;  2EMI A;  3BID A;  2EQ3 A;  2JR1 A;  2HJJ A;  2JYA A;  2G7H A;  4DR5 E;  3MHS C;  4R2A A;  4LF9 E;  2RQL A;  2EN1 A;  3IWD A;  4TUG A;  4X8W A;  2KON A;  5T6J A;  4R2E A;  4WSG A;  1MGT A;  1J26 A;  2LBS B;  2EM9 A;  1WXR A;  3VYY A;  1UN6 B;  3OTO E;  1A1H A;  1T4O A;  3VHT B;  4DV0 E;  4R2D A;  4OX9 E;  4F6N A;  2EOM A;  5A6B D;  1XNQ E;  2LO3 A;  2E1M A;  2MDG A;  5AE1 A;  4WXC A;  3IWB A;  2YTO A;  2HC5 A;  4GKK E;  1NEI A;  2LTS A;  2UU9 E;  4O43 A;  2UUA E;  4O4K A;  2V85 A;  2YTN A;  1TF6 A;  2EMB A;  4YHH E;  1G2D C;  1J5E E;  4LFB E;  4JI7 E;  3BBG A;  2B7V A;  2M1S A;  1IQS A;  2EOO A;  1TF3 A;  1WHQ A;  2HGH A;  1RC7 A;  2DMI A;  2EJ4 A;  2EM8 A;  2EMW A;  2D9H A;  3H09 A;  2ADR A;  2EMC A;  2EOE A;  2EPK X;  1PJT A;  2YRH A;  5IT9 C;  4X64 E;  1NCS A;  4BC7 A;  1ZBQ A;  1T4L B;  2L33 A;  4HTG A;  2EOF A;  2LUQ A;  2ENC A;  4WPY A;  4NXN E;  2YSP A;  2ENH A;  2EN6 A;  1UHZ A;  1A1F A;  3JU0 A;  4JI3 E;  1IBM E;  2EPA A;  2JP9 A;  2R76 A;  1YPN A;  2EMG A;  4KHP E;  5LMU E;  2NUG A;  2LJH A;  4JV5 E;  4LF6 E;  4DV7 E;  1X49 A;  1BBO A;  3HQ1 A;  4X62 E;  1YYW A;  2WBT A;  2YSO A;  2LRS A;  2CSH A;  5A69 A;  1XNR E;  2EQ1 A;  2PRT A;  1XMQ E;  4AQY E;  4DKK A;  1A1J A;  2JOX A;  4KZS A;  2DSY A; 
#chains in the Genus database with same CATH homology
 2EMZ A;  1X6F A;  2EMA A;  1YUJ A;  2A25 A;  2YTF A;  2YRK A;  2EM0 A;  2EML A;  3MHS C;  5KL7 A;  2EM6 A;  2EOS A;  2EP3 A;  2M9A A;  3EPL A;  2EQ0 A;  2EPP A;  1TN9 A;  2EM3 A;  4R2A A;  2BB8 A;  2EN1 A;  1A1K A;  2JPA A;  4R2E A;  4WSG A;  2WBS A;  5KL4 A;  2YRM A;  2EOI A;  2ELY A;  5KL5 A;  2EM9 A;  2DGC A;  2EOY A;  2YTQ A;  1UN6 B;  2ELZ A;  4R2P A;  1F2I G;  4R2R A;  1LLM C;  1A1H A;  3VHT B;  2VRD A;  1ZR9 A;  2EOR A;  2YTI A;  4R2D A;  4F6N A;  2GHF A;  2EOM A;  2LVH A;  2EOX A;  1JK1 A;  4R2Q A;  2EOH A;  4F6M A;  1AAY A;  1G2F C;  2LO3 A;  1X6H A;  3UK3 C;  2NAB A;  2EL6 A;  1MEY C;  4R2C A;  2MDG A;  2EPU A;  2YTP A;  2YTD A;  2MKD A;  2GLI A;  3MHH C;  3EPK A;  2EN4 A;  2RSI A;  2YTO A;  2EN2 A;  4X9J A;  2LCE A;  4F2J C;  1A1L A;  1Z1B A;  2EPR A;  1X6E A;  2R1F A;  2EPZ A;  2YTN A;  2EMH A;  1TF6 A;  2YTG A;  2EMB A;  1G2D C;  1RMD A;  2EOZ A;  4IJD A;  1B69 A;  1KJK A;  2MKN A;  2EOO A;  2WCC 3;  1TF3 A;  2YU8 A;  2EM7 A;  2HGH A;  2YTJ A;  1A1G A;  2EPX A;  2LT7 A;  2DMI A;  5KL3 A;  2EJ4 A;  2EM8 A;  1WJP A;  2EMW A;  2EM2 A;  2EM4 A;  3EPJ A;  5KL2 A;  2CT1 A;  2D9H A;  2EMY A;  2ADR A;  2EMC A;  2EOE A;  2EN7 A;  2YRH A;  2EOJ A;  2EMF A;  1NCS A;  2EN3 A;  1A1I A;  1X5W A;  2EM5 A;  1DGC A;  2DLQ A;  3M99 B;  2WBU A;  2LV2 A;  1UBD C;  3EPH A;  1JK2 A;  2DLK A;  2ENA A;  2EOF A;  2EPC A;  1P47 A;  1ZAA C;  5KL6 A;  2ENC A;  4IS1 C;  2YSP A;  2ENH A;  2EN6 A;  1A1F A;  2EOQ A;  4R2S A;  4M9V C;  2EE8 A;  2EL4 A;  2EMX A;  2EPA A;  2JP9 A;  2EMG A;  1ZU1 A;  1YSA C;  2EN8 A;  1X3C A;  4FK5 C;  1BBO A;  1YUI A;  2YTE A;  2RPC A;  4GZN C;  2EL5 A;  2WBT A;  2YSO A;  2CSH A;  2J7J A;  2CTD A;  2YU5 A;  2DRP A;  2EQ1 A;  2PRT A;  2EMK A;  1BB8 A;  1A1J A;  2EMI A;  2EQ3 A;  2E72 A;  2I13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...