1YUJA

Solution nmr structure of the gaga factor/dna complex, 50 structures
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
54
structure length
54
Chain Sequence
PKAKRAKHPPGTEKPRSRSQSEQPATCPICYAVIRQSRNLRRHLELRHFAKPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of a specific GAGA factor-DNA complex reveals a modular binding mode.
pubmed doi rcsb
molecule keywords DNA (5'-D(*GP*CP*CP*GP*AP*GP*AP*GP*TP*AP*C)-3')
molecule tags Dna binding protein/dna
total genus 11
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 1996-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09237 GAGA GAGA factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1yujA00
2LT7A 2EPCA 2EOZA 1LLMC 2YTFA 1A1LA 2EN7A 2M9AA 1TF3A 5KL5A 1B69A 2ELZA 2EL6A 2EM0A 1WJPA 1RMDA 2EMKA 2EN1A 4R2RA 2EM9A 1YSAC 1BB8A 5KL2A 2EOIA 2EPZA 1YUJA 2PRTA 4F6MA 2EOXA 2NABA 1JK2A 2LO3A 2YU8A 2EMXA 2YRHA 4M9VC 2EM6A 1X5WA 2DLQA 2EN4A 2EP3A 2MKNA 1JK1A 2EMHA 2LCEA 2J7JA 2WBTA 1UBDC 4IS1C 2EOQA 2EPRA 2EM3A 2MDGA 2WBUA 1ZU1A 4F6NA 2EPUA 4R2CA 2JP9A 1Z1BA 4X9JA 2GHFA 3EPKA 1A1GA 3MHSC 5KL7A 2EPAA 2EMZA 2DRPA 1A1IA 2YTDA 2EPXA 4IJDA 1X6HA 2EORA 1X3CA 2EOFA 2EM7A 1G2FC 2LV2A 2EN6A 2EOHA 1ZAAC 2DLKA 2WCC3 1A1FA 4R2EA 2EPPA 2JPAA 2YTIA 2EM2A 2RPCA 4R2PA 2A25A 4F2JC 1ZR9A 2YSPA 2CSHA 2YRKA 5KL3A 2DGCA 2GLIA 2YTGA 2EQ1A 2EOJA 2EJ4A 2YTOA 4FK5C 2YTJA 2VRDA 1DGCA 2DMIA 2EOYA 2HGHA 1KJKA 2EMCA 2WBSA 2YTPA 4R2QA 2EMFA 2CT1A 4GZNC 1AAYA 2EOOA 2I13A 2EQ0A 2LVHA 1NCSA 1G2DC 2EN3A 1P47A 3EPLA 2EN8A 3UK3C 2YRMA 1A1KA 2EMLA 2EOMA 1F2IG 2CTDA 2EMWA 2R1FA 2D9HA 2EE8A 2EMAA 2EMYA 2ADRA 1UN6B 5KL4A 1X6FA 3M99B 2ELYA 1TF6A 4R2DA 1YUIA 2EMGA 1A1HA 3EPJA 2YTQA 2EMIA 2EN2A 2YU5A 3EPHA 2EMBA 3MHHC 1A1JA 2EOSA 1BBOA 2ENCA 2ENAA 4R2SA 5KL6A 1TN9A 1X6EA 3VHTB 2BB8A 2EM5A 2EOEA 2YTEA 2EQ3A 2ENHA 2YSOA 2EL4A 2EL5A 2EM8A 1MEYC 2MKDA 4WSGA 2RSIA 4R2AA 2EM4A 2YTNA 2E72A
chains in the Genus database with same CATH superfamily
2LT7A 3K6QA 4B3TE 5KL5A 1N33E 4AQYE 3BBGA 3TQMA 5KL2A 3BGHA 5BR8E 4F6MA 4RHBB 3HTXA 2LO3A 2YU8A 2EMXA 2UXBE 2EM6A 1JK1A 1PJSA 3P1XA 2LCEA 4IS1C 3VYYA 1ZU1A 3LMLA 4F9AB 2UXCE 4X9JA 2LMZA 2RQLA 5IV8B 3JAMC 2LBSB 2DRPA 2WZOA 2YTDA 2L2NA 4B3ME 1X3CA 1G2FC 4OOGC 3KWRA 2MDRA 4R2EA 5A2QC 2E1MA 4N4RB 2VE7C 2YTIA 3HQ1A 1PDAA 1N3GA 4F2JC 2M1SA 2L92A 3C6MA 2BBGA 2GLIA 2YTGA 3FIGA 2NUGA 2YTJA 2VRDA 1KJKA 2WBSA 4JI0E 2N3HA 4F9CB 4LF4E 5A69A 4GKKE 1DI2A 2LVHA 1G2DC 4ZYGA 3HXLA 4WYQB 1IBLE 4F54A 2LTRA 4JV5E 2EPNA 2EE8A 4KZSA 2K4VA 4JI3E 4M0VA 3C4BA 2L2MA 3KZYA 4M30A 4B3RE 2KONA 5F3WA 4GKJE 5AC4A 5FLXC 2EPOA 2EMGA 1PJTA 3EPHA 1BBOA 2ENAA 1TN9A 3VHTB 3DJWA 3QG5C 2EQ3A 1MEYC 4JI5E 5A6KA 5LL6R 1QU6A 2EM4A 2FTXB 1PKPA 4LF8E 4JI4E 2EOZA 4P7DA 4JI2E 2N8XA 1N34E 2B7VA 2B7TA 2ELZA 2EL6A 2V83A 2EM0A 4RH8A 1N32E 2EN1A 4L8NA 2FV4B 2G7HA 2EM9A 1YSAC 2HJJA 2EPZA 1DQ3A 3EQ1A 2EOXA 1J26A 2NABA 2YRHA 4M9VC 2DLQA 2EP3A 5IT9C 4BC9A 2JOXA 4NXME 3J81C 1NEIA 4O43A 2EM3A 2MDGA 4O4KA 4TUIA 4R2CA 2JP9A 1Z1BA 2R76A 4LTYA 5LLQA 1SR9A 4NHRA 1X47A 3J7AG 3THOB 5KL7A 1J5EE 1EH8A 5AC5A 1X48A 2LJHA 1BBGA 4BHBA 2L8TA 3IWBA 1EH6A 2EN6A 2GPIA 4JI7E 4OX9E 2DLKA 1WXRA 2WCC3 2F8BA 2UUCE 2DIXA 2VQEE 5A6JA 2CSHA 2RSMA 4DV3E 2DGCA 4MLQA 5A6AA 2EZ6A 3J80C 4KWYA 2EJ4A 2NUEA 1GZ6A 4FK5C 2N3GA 4JI6E 2HGHA 2DMIA 2EOYA 4DV6E 2DMYA 2EMFA 1SFEA 2CT1A 2I13A 2EQ0A 4JI8E 2V86A 2EN8A 1A1KA 1YYOA 5IXMB 4LU9A 4X8WA 4DV1E 2NUFA 1GQEA 2RS6A 2UU9E 2EMAA 5ADZA 5CFFE 3M99B 4R8OA 1YUIA 1IBKE 1YZ9A 2YTQA 4WFTA 2ZM6E 4LFBE 2EMIA 2EN2A 4Q35B 2CPNA 1A1JA 4DV7E 2L6MA 4DR1E 4R2SA 5KL6A 3DF6A 1X6EA 2L2KB 2YTEA 2EPLX 2YSOA 2EL4A 3IWDA 4MLVA 3ADIA 4WSGA 4R2AA 1IBME 2M7QA 1YFHA 2E72A 1LLMC 2YTFA 2EN7A 4ZYDA 3T1HE 3ADJA 2YPNA 3HPZA 3JU0A 4BMJA 2EMKA 3MSWA 1N36E 4B3SE 2YZTA 1BB8A 1EKZA 2EOIA 1YUJA 1STUA 5A6BD 3T1YE 3C4TA 1YPNA 4HTGA 4DR2E 1JK2A 4DV2E 4LF5E 4DR3E 2EN4A 1X5WA 3ZOQB 2EMHA 2J7JA 2WBTA 1UBDC 1KYQA 2EOQA 2EPRA 4P78A 2WBUA 2EPUA 1T39A 3EPKA 3ADLA 1A1GA 4ZYHA 3MHSC 5T6JA 2FGGA 3AV0A 4HEIA 2EPAA 2EMZA 1A1IA 4DV5E 2RS7A 3OMLA 2EPXA 4IJDA 1X6HA 4DR7E 4R03A 2EOFA 2EM7A 3AUZA 1WHQA 2K7IA 2EWLA 2LV2A 1ZAAC 2EOHA 1A1FA 1XNQE 4TUGA 1WHNA 2JY9A 4WPYA 5AASA 2EM2A 4R2PA 1IQOA 1ZR9A 1HNWE 2LE2A 3J7Yp 2E5LE 5IWAE 2EQ1A 2JR1A 3RMPA 2EPMX 2EMCA 4O5GA 2YTPA 4R2QA 4DUYE 2JWOA 4X66E 1HR0E 4LF9E 2EOOA 4ZYEA 1FJGE 4JI1E 2V87A 3L00A 2L3CA 4L5NC 2EN3A 2MC5A 4NZVA 1P47A 4DMIA 3EPLA 3UK3C 2H36X 4BCAA 4DR6E 2EMLA 2EOMA 1F2IG 1MGTA 2EMWA 2D9HA 3ECRA 2EMYA 1T38A 5KL4A 2L33A 1X6FA 1XNRE 2YT4A 3JTZA 1T4NA 2V85A 2VQFE 2I9IA 1TF6A 4R2DA 1WRJA 5TSEA 4NXNE 2YU5A 4DR5E 2EMBA 3MHHC 2LTSA 2B3TB 3F6GA 1ZBQA 2JYAA 2JXPA 2RTXA 4WSPA 4LFCE 1HNXE 2ENCA 2KHXA 1HNZE 2EM5A 2BB8A 2B9DA 2EOEA 4X64E 2EPKX 2MKDA 4LFAE 2V8QB 2YTNA 1FKAE 2EPCA 1A1LA 4O24A 1TF3A 2M9AA 1ZBTA 2L3JA 1B69A 1AH5A 1PJQA 1RMDA 1WJPA 2ODRD 4R2RA 1X49A 3ADGA 4DUZE 2PRTA 1I94E 3VYXA 2V88A 2MKNA 5AE1A 1T4OA 3THNA 4F6NA 4JYAE 2GHFA 2UUAE 4LF7E 4F9BB 3H09A 2F4VE 4J8ZA 3LLHA 3BF2A 2EORA 2JOBA 2M4IA 5A6BA 3BIDA 4LF6E 3C6KA 2V89A 2LUQA 4YY3E 2EPPA 3VK6A 4DKKA 2JPAA 1UILA 3HPSA 2RPCA 1L4SA 2DB2A 2A25A 2MC6A 2JVAA 2YSPA 4K0KE 2YRKA 4YHHE 5KL3A 4WXDA 4X62E 2DSYA 5AE3A 2EOJA 1RC7A 2YTOA 4KHPE 1IMUA 1DGCA 4BHCA 2LJUA 1XMQE 2IHR1 4DV4E 4GZNC 1AAYA 4Q28A 1T4LB 4DR4E 1NCSA 4X65E 5DNYA 2ODRC 2YRMA 2UXDE 1GTKA 1UHZA 2CTDA 2Q8UA 2VF1A 1YYKA 2R1FA 2YWQA 2HHHE 1YYWA 2LRSA 1QNTA 2ADRA 1UN6B 2KOUA 4DV0E 2UUBE 2ELYA 4WXCA 1O0WA 1RQ0A 4BBYA 5LMUE 1A1HA 3EPJA 3OTOE 4GEQB 2NA2A 1XMOE 4M2ZA 4BS9A 1IQSA 2HC5A 4WX9A 2EOSA 4I8OA 3F6HA 5LMNE 1EH7A 5AE2A 2LUPB 2ENHA 2EL5A 2EM8A 4BC7A 3IWCA 2RSIA 3KZZA
chains in the Genus database with same CATH topology
2LT7A 2EPCA 2EOZA 1LLMC 2YTFA 1A1LA 2EN7A 2M9AA 1TF3A 5KL5A 1B69A 2ELZA 2EL6A 2EM0A 1WJPA 1RMDA 2EMKA 2EN1A 4R2RA 2EM9A 1YSAC 1BB8A 5KL2A 2EOIA 2EPZA 1YUJA 2PRTA 4F6MA 2EOXA 2NABA 1JK2A 2LO3A 2YU8A 2EMXA 2YRHA 4M9VC 2EM6A 1X5WA 2DLQA 2EN4A 2EP3A 2MKNA 1JK1A 2EMHA 2LCEA 2J7JA 2WBTA 1UBDC 4IS1C 2EOQA 2EPRA 2EM3A 2MDGA 2WBUA 1ZU1A 4F6NA 2EPUA 4R2CA 2JP9A 1Z1BA 4X9JA 2GHFA 3EPKA 1A1GA 3MHSC 5KL7A 2EPAA 2EMZA 2DRPA 1A1IA 2YTDA 2EPXA 4IJDA 1X6HA 2EORA 1X3CA 2EOFA 2EM7A 1G2FC 2LV2A 2EN6A 2EOHA 1ZAAC 2DLKA 2WCC3 1A1FA 4R2EA 2EPPA 2JPAA 2YTIA 2EM2A 2RPCA 4R2PA 2A25A 4F2JC 1ZR9A 2YSPA 2CSHA 2YRKA 5KL3A 2DGCA 2GLIA 2YTGA 2EQ1A 2EOJA 2EJ4A 2YTOA 4FK5C 2YTJA 2VRDA 1DGCA 2DMIA 2EOYA 2HGHA 1KJKA 2EMCA 2WBSA 2YTPA 4R2QA 2EMFA 2CT1A 4GZNC 1AAYA 2EOOA 2I13A 2EQ0A 2LVHA 1NCSA 1G2DC 2EN3A 1P47A 3EPLA 2EN8A 3UK3C 2YRMA 1A1KA 2EMLA 2EOMA 1F2IG 2CTDA 2EMWA 2R1FA 2D9HA 2EE8A 2EMAA 2EMYA 2ADRA 1UN6B 5KL4A 1X6FA 3M99B 2ELYA 1TF6A 4R2DA 1YUIA 2EMGA 1A1HA 3EPJA 2YTQA 2EMIA 2EN2A 2YU5A 3EPHA 2EMBA 3MHHC 1A1JA 2EOSA 1BBOA 2ENCA 2ENAA 4R2SA 5KL6A 1TN9A 1X6EA 3VHTB 2BB8A 2EM5A 2EOEA 2YTEA 2EQ3A 2ENHA 2YSOA 2EL4A 2EL5A 2EM8A 1MEYC 2MKDA 4WSGA 2RSIA 4R2AA 2EM4A 2YTNA 2E72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LT7 A;  2EPC A;  2EOZ A;  1LLM C;  2YTF A;  1A1L A;  2EN7 A;  2M9A A;  1TF3 A;  5KL5 A;  1B69 A;  2ELZ A;  2EL6 A;  2EM0 A;  1WJP A;  1RMD A;  2EMK A;  2EN1 A;  4R2R A;  2EM9 A;  1YSA C;  1BB8 A;  5KL2 A;  2EOI A;  2EPZ A;  1YUJ A;  2PRT A;  4F6M A;  2EOX A;  2NAB A;  1JK2 A;  2LO3 A;  2YU8 A;  2EMX A;  2YRH A;  4M9V C;  2EM6 A;  1X5W A;  2DLQ A;  2EN4 A;  2EP3 A;  2MKN A;  1JK1 A;  2EMH A;  2LCE A;  2J7J A;  2WBT A;  1UBD C;  4IS1 C;  2EOQ A;  2EPR A;  2EM3 A;  2MDG A;  2WBU A;  1ZU1 A;  4F6N A;  2EPU A;  4R2C A;  2JP9 A;  1Z1B A;  4X9J A;  2GHF A;  3EPK A;  1A1G A;  3MHS C;  5KL7 A;  2EPA A;  2EMZ A;  2DRP A;  1A1I A;  2YTD A;  2EPX A;  4IJD A;  1X6H A;  2EOR A;  1X3C A;  2EOF A;  2EM7 A;  1G2F C;  2LV2 A;  2EN6 A;  2EOH A;  1ZAA C;  2DLK A;  2WCC 3;  1A1F A;  4R2E A;  2EPP A;  2JPA A;  2YTI A;  2EM2 A;  2RPC A;  4R2P A;  2A25 A;  4F2J C;  1ZR9 A;  2YSP A;  2CSH A;  2YRK A;  5KL3 A;  2DGC A;  2GLI A;  2YTG A;  2EQ1 A;  2EOJ A;  2EJ4 A;  2YTO A;  4FK5 C;  2YTJ A;  2VRD A;  1DGC A;  2DMI A;  2EOY A;  2HGH A;  1KJK A;  2EMC A;  2WBS A;  2YTP A;  4R2Q A;  2EMF A;  2CT1 A;  4GZN C;  1AAY A;  2EOO A;  2I13 A;  2EQ0 A;  2LVH A;  1NCS A;  1G2D C;  2EN3 A;  1P47 A;  3EPL A;  2EN8 A;  3UK3 C;  2YRM A;  1A1K A;  2EML A;  2EOM A;  1F2I G;  2CTD A;  2EMW A;  2R1F A;  2D9H A;  2EE8 A;  2EMA A;  2EMY A;  2ADR A;  1UN6 B;  5KL4 A;  1X6F A;  3M99 B;  2ELY A;  1TF6 A;  4R2D A;  1YUI A;  2EMG A;  1A1H A;  3EPJ A;  2YTQ A;  2EMI A;  2EN2 A;  2YU5 A;  3EPH A;  2EMB A;  3MHH C;  1A1J A;  2EOS A;  1BBO A;  2ENC A;  2ENA A;  4R2S A;  5KL6 A;  1TN9 A;  1X6E A;  3VHT B;  2BB8 A;  2EM5 A;  2EOE A;  2YTE A;  2EQ3 A;  2ENH A;  2YSO A;  2EL4 A;  2EL5 A;  2EM8 A;  1MEY C;  2MKD A;  4WSG A;  2RSI A;  4R2A A;  2EM4 A;  2YTN A;  2E72 A; 
#chains in the Genus database with same CATH topology
 2LT7 A;  3K6Q A;  4B3T E;  5KL5 A;  1N33 E;  4AQY E;  3BBG A;  3TQM A;  5KL2 A;  3BGH A;  5BR8 E;  4F6M A;  4RHB B;  3HTX A;  2LO3 A;  2YU8 A;  2EMX A;  2UXB E;  2EM6 A;  1JK1 A;  1PJS A;  3P1X A;  2LCE A;  4IS1 C;  3VYY A;  1ZU1 A;  3LML A;  4F9A B;  2UXC E;  4X9J A;  2LMZ A;  2RQL A;  5IV8 B;  3JAM C;  2LBS B;  2DRP A;  2WZO A;  2YTD A;  2L2N A;  4B3M E;  1X3C A;  1G2F C;  4OOG C;  3KWR A;  2MDR A;  4R2E A;  5A2Q C;  2E1M A;  4N4R B;  2VE7 C;  2YTI A;  3HQ1 A;  1PDA A;  1N3G A;  4F2J C;  2M1S A;  2L92 A;  3C6M A;  2BBG A;  2GLI A;  2YTG A;  3FIG A;  2NUG A;  2YTJ A;  2VRD A;  1KJK A;  2WBS A;  4JI0 E;  2N3H A;  4F9C B;  4LF4 E;  5A69 A;  4GKK E;  1DI2 A;  2LVH A;  1G2D C;  4ZYG A;  3HXL A;  4WYQ B;  1IBL E;  4F54 A;  2LTR A;  4JV5 E;  2EPN A;  2EE8 A;  4KZS A;  2K4V A;  4JI3 E;  4M0V A;  3C4B A;  2L2M A;  3KZY A;  4M30 A;  4B3R E;  2KON A;  5F3W A;  4GKJ E;  5AC4 A;  5FLX C;  2EPO A;  2EMG A;  1PJT A;  3EPH A;  1BBO A;  2ENA A;  1TN9 A;  3VHT B;  3DJW A;  3QG5 C;  2EQ3 A;  1MEY C;  4JI5 E;  5A6K A;  5LL6 R;  1QU6 A;  2EM4 A;  2FTX B;  1PKP A;  4LF8 E;  4JI4 E;  2EOZ A;  4P7D A;  4JI2 E;  2N8X A;  1N34 E;  2B7V A;  2B7T A;  2ELZ A;  2EL6 A;  2V83 A;  2EM0 A;  4RH8 A;  1N32 E;  2EN1 A;  4L8N A;  2FV4 B;  2G7H A;  2EM9 A;  1YSA C;  2HJJ A;  2EPZ A;  1DQ3 A;  3EQ1 A;  2EOX A;  1J26 A;  2NAB A;  2YRH A;  4M9V C;  2DLQ A;  2EP3 A;  5IT9 C;  4BC9 A;  2JOX A;  4NXM E;  3J81 C;  1NEI A;  4O43 A;  2EM3 A;  2MDG A;  4O4K A;  4TUI A;  4R2C A;  2JP9 A;  1Z1B A;  2R76 A;  4LTY A;  5LLQ A;  1SR9 A;  4NHR A;  1X47 A;  3J7A G;  3THO B;  5KL7 A;  1J5E E;  1EH8 A;  5AC5 A;  1X48 A;  2LJH A;  1BBG A;  4BHB A;  2L8T A;  3IWB A;  1EH6 A;  2EN6 A;  2GPI A;  4JI7 E;  4OX9 E;  2DLK A;  1WXR A;  2WCC 3;  2F8B A;  2UUC E;  2DIX A;  2VQE E;  5A6J A;  2CSH A;  2RSM A;  4DV3 E;  2DGC A;  4MLQ A;  5A6A A;  2EZ6 A;  3J80 C;  4KWY A;  2EJ4 A;  2NUE A;  1GZ6 A;  4FK5 C;  2N3G A;  4JI6 E;  2HGH A;  2DMI A;  2EOY A;  4DV6 E;  2DMY A;  2EMF A;  1SFE A;  2CT1 A;  2I13 A;  2EQ0 A;  4JI8 E;  2V86 A;  2EN8 A;  1A1K A;  1YYO A;  5IXM B;  4LU9 A;  4X8W A;  4DV1 E;  2NUF A;  1GQE A;  2RS6 A;  2UU9 E;  2EMA A;  5ADZ A;  5CFF E;  3M99 B;  4R8O A;  1YUI A;  1IBK E;  1YZ9 A;  2YTQ A;  4WFT A;  2ZM6 E;  4LFB E;  2EMI A;  2EN2 A;  4Q35 B;  2CPN A;  1A1J A;  4DV7 E;  2L6M A;  4DR1 E;  4R2S A;  5KL6 A;  3DF6 A;  1X6E A;  2L2K B;  2YTE A;  2EPL X;  2YSO A;  2EL4 A;  3IWD A;  4MLV A;  3ADI A;  4WSG A;  4R2A A;  1IBM E;  2M7Q A;  1YFH A;  2E72 A;  1LLM C;  2YTF A;  2EN7 A;  4ZYD A;  3T1H E;  3ADJ A;  2YPN A;  3HPZ A;  3JU0 A;  4BMJ A;  2EMK A;  3MSW A;  1N36 E;  4B3S E;  2YZT A;  1BB8 A;  1EKZ A;  2EOI A;  1YUJ A;  1STU A;  5A6B D;  3T1Y E;  3C4T A;  1YPN A;  4HTG A;  4DR2 E;  1JK2 A;  4DV2 E;  4LF5 E;  4DR3 E;  2EN4 A;  1X5W A;  3ZOQ B;  2EMH A;  2J7J A;  2WBT A;  1UBD C;  1KYQ A;  2EOQ A;  2EPR A;  4P78 A;  2WBU A;  2EPU A;  1T39 A;  3EPK A;  3ADL A;  1A1G A;  4ZYH A;  3MHS C;  5T6J A;  2FGG A;  3AV0 A;  4HEI A;  2EPA A;  2EMZ A;  1A1I A;  4DV5 E;  2RS7 A;  3OML A;  2EPX A;  4IJD A;  1X6H A;  4DR7 E;  4R03 A;  2EOF A;  2EM7 A;  3AUZ A;  1WHQ A;  2K7I A;  2EWL A;  2LV2 A;  1ZAA C;  2EOH A;  1A1F A;  1XNQ E;  4TUG A;  1WHN A;  2JY9 A;  4WPY A;  5AAS A;  2EM2 A;  4R2P A;  1IQO A;  1ZR9 A;  1HNW E;  2LE2 A;  3J7Y p;  2E5L E;  5IWA E;  2EQ1 A;  2JR1 A;  3RMP A;  2EPM X;  2EMC A;  4O5G A;  2YTP A;  4R2Q A;  4DUY E;  2JWO A;  4X66 E;  1HR0 E;  4LF9 E;  2EOO A;  4ZYE A;  1FJG E;  4JI1 E;  2V87 A;  3L00 A;  2L3C A;  4L5N C;  2EN3 A;  2MC5 A;  4NZV A;  1P47 A;  4DMI A;  3EPL A;  3UK3 C;  2H36 X;  4BCA A;  4DR6 E;  2EML A;  2EOM A;  1F2I G;  1MGT A;  2EMW A;  2D9H A;  3ECR A;  2EMY A;  1T38 A;  5KL4 A;  2L33 A;  1X6F A;  1XNR E;  2YT4 A;  3JTZ A;  1T4N A;  2V85 A;  2VQF E;  2I9I A;  1TF6 A;  4R2D A;  1WRJ A;  5TSE A;  4NXN E;  2YU5 A;  4DR5 E;  2EMB A;  3MHH C;  2LTS A;  2B3T B;  3F6G A;  1ZBQ A;  2JYA A;  2JXP A;  2RTX A;  4WSP A;  4LFC E;  1HNX E;  2ENC A;  2KHX A;  1HNZ E;  2EM5 A;  2BB8 A;  2B9D A;  2EOE A;  4X64 E;  2EPK X;  2MKD A;  4LFA E;  2V8Q B;  2YTN A;  1FKA E;  2EPC A;  1A1L A;  4O24 A;  1TF3 A;  2M9A A;  1ZBT A;  2L3J A;  1B69 A;  1AH5 A;  1PJQ A;  1RMD A;  1WJP A;  2ODR D;  4R2R A;  1X49 A;  3ADG A;  4DUZ E;  2PRT A;  1I94 E;  3VYX A;  2V88 A;  2MKN A;  5AE1 A;  1T4O A;  3THN A;  4F6N A;  4JYA E;  2GHF A;  2UUA E;  4LF7 E;  4F9B B;  3H09 A;  2F4V E;  4J8Z A;  3LLH A;  3BF2 A;  2EOR A;  2JOB A;  2M4I A;  5A6B A;  3BID A;  4LF6 E;  3C6K A;  2V89 A;  2LUQ A;  4YY3 E;  2EPP A;  3VK6 A;  4DKK A;  2JPA A;  1UIL A;  3HPS A;  2RPC A;  1L4S A;  2DB2 A;  2A25 A;  2MC6 A;  2JVA A;  2YSP A;  4K0K E;  2YRK A;  4YHH E;  5KL3 A;  4WXD A;  4X62 E;  2DSY A;  5AE3 A;  2EOJ A;  1RC7 A;  2YTO A;  4KHP E;  1IMU A;  1DGC A;  4BHC A;  2LJU A;  1XMQ E;  2IHR 1;  4DV4 E;  4GZN C;  1AAY A;  4Q28 A;  1T4L B;  4DR4 E;  1NCS A;  4X65 E;  5DNY A;  2ODR C;  2YRM A;  2UXD E;  1GTK A;  1UHZ A;  2CTD A;  2Q8U A;  2VF1 A;  1YYK A;  2R1F A;  2YWQ A;  2HHH E;  1YYW A;  2LRS A;  1QNT A;  2ADR A;  1UN6 B;  2KOU A;  4DV0 E;  2UUB E;  2ELY A;  4WXC A;  1O0W A;  1RQ0 A;  4BBY A;  5LMU E;  1A1H A;  3EPJ A;  3OTO E;  4GEQ B;  2NA2 A;  1XMO E;  4M2Z A;  4BS9 A;  1IQS A;  2HC5 A;  4WX9 A;  2EOS A;  4I8O A;  3F6H A;  5LMN E;  1EH7 A;  5AE2 A;  2LUP B;  2ENH A;  2EL5 A;  2EM8 A;  4BC7 A;  3IWC A;  2RSI A;  3KZZ A; 
#chains in the Genus database with same CATH homology
 2LT7 A;  2EPC A;  2EOZ A;  1LLM C;  2YTF A;  1A1L A;  2EN7 A;  2M9A A;  1TF3 A;  5KL5 A;  1B69 A;  2ELZ A;  2EL6 A;  2EM0 A;  1WJP A;  1RMD A;  2EMK A;  2EN1 A;  4R2R A;  2EM9 A;  1YSA C;  1BB8 A;  5KL2 A;  2EOI A;  2EPZ A;  1YUJ A;  2PRT A;  4F6M A;  2EOX A;  2NAB A;  1JK2 A;  2LO3 A;  2YU8 A;  2EMX A;  2YRH A;  4M9V C;  2EM6 A;  1X5W A;  2DLQ A;  2EN4 A;  2EP3 A;  2MKN A;  1JK1 A;  2EMH A;  2LCE A;  2J7J A;  2WBT A;  1UBD C;  4IS1 C;  2EOQ A;  2EPR A;  2EM3 A;  2MDG A;  2WBU A;  1ZU1 A;  4F6N A;  2EPU A;  4R2C A;  2JP9 A;  1Z1B A;  4X9J A;  2GHF A;  3EPK A;  1A1G A;  3MHS C;  5KL7 A;  2EPA A;  2EMZ A;  2DRP A;  1A1I A;  2YTD A;  2EPX A;  4IJD A;  1X6H A;  2EOR A;  1X3C A;  2EOF A;  2EM7 A;  1G2F C;  2LV2 A;  2EN6 A;  2EOH A;  1ZAA C;  2DLK A;  2WCC 3;  1A1F A;  4R2E A;  2EPP A;  2JPA A;  2YTI A;  2EM2 A;  2RPC A;  4R2P A;  2A25 A;  4F2J C;  1ZR9 A;  2YSP A;  2CSH A;  2YRK A;  5KL3 A;  2DGC A;  2GLI A;  2YTG A;  2EQ1 A;  2EOJ A;  2EJ4 A;  2YTO A;  4FK5 C;  2YTJ A;  2VRD A;  1DGC A;  2DMI A;  2EOY A;  2HGH A;  1KJK A;  2EMC A;  2WBS A;  2YTP A;  4R2Q A;  2EMF A;  2CT1 A;  4GZN C;  1AAY A;  2EOO A;  2I13 A;  2EQ0 A;  2LVH A;  1NCS A;  1G2D C;  2EN3 A;  1P47 A;  3EPL A;  2EN8 A;  3UK3 C;  2YRM A;  1A1K A;  2EML A;  2EOM A;  1F2I G;  2CTD A;  2EMW A;  2R1F A;  2D9H A;  2EE8 A;  2EMA A;  2EMY A;  2ADR A;  1UN6 B;  5KL4 A;  1X6F A;  3M99 B;  2ELY A;  1TF6 A;  4R2D A;  1YUI A;  2EMG A;  1A1H A;  3EPJ A;  2YTQ A;  2EMI A;  2EN2 A;  2YU5 A;  3EPH A;  2EMB A;  3MHH C;  1A1J A;  2EOS A;  1BBO A;  2ENC A;  2ENA A;  4R2S A;  5KL6 A;  1TN9 A;  1X6E A;  3VHT B;  2BB8 A;  2EM5 A;  2EOE A;  2YTE A;  2EQ3 A;  2ENH A;  2YSO A;  2EL4 A;  2EL5 A;  2EM8 A;  1MEY C;  2MKD A;  4WSG A;  2RSI A;  4R2A A;  2EM4 A;  2YTN A;  2E72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...