1YUJA

Solution nmr structure of the gaga factor/dna complex, 50 structures
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
54
structure length
54
Chain Sequence
PKAKRAKHPPGTEKPRSRSQSEQPATCPICYAVIRQSRNLRRHLELRHFAKPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of a specific GAGA factor-DNA complex reveals a modular binding mode.
pubmed doi rcsb
molecule tags Dna binding protein/dna
molecule keywords DNA (5'-D(*GP*CP*CP*GP*AP*GP*AP*GP*TP*AP*C)-3')
total genus 11
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 1996-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09237 GAGA GAGA factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1yujA00
1TF3A 2YTOA 2EMLA 1UBDC 1X6HA 2NABA 4R2PA 2GLIA 2ADRA 2EMYA 1A1LA 2DLQA 1G2FC 2YTIA 2WCC3 3EPHA 2YTDA 1NCSA 5KL2A 2DMIA 5KL3A 1TN9A 2YSPA 2WBSA 2EE8A 2A25A 2YTJA 2WBUA 2EMFA 2EOHA 1MEYC 2YTQA 2LO3A 4R2QA 1A1FA 2EM8A 2EL4A 1A1HA 2DRPA 1X6EA 2D9HA 4R2AA 1ZAAC 1X3CA 2EN6A 2J7JA 2EPZA 4X9JA 3VHTB 2EM5A 5KL5A 2EOYA 1F2IG 2EMXA 2EPXA 2EM2A 2CTDA 1A1KA 2EORA 3EPLA 4F6NA 2EMAA 2EQ1A 5KL6A 2YTFA 1X5WA 1RMDA 3EPKA 2LV2A 2EOQA 1G2DC 2EMHA 2MDGA 2EM6A 4R2DA 2YRKA 2JP9A 2YRHA 2JPAA 2M9AA 2GHFA 2ELZA 2EM3A 2EOSA 2ENHA 4F6MA 4M9VC 1UN6B 2YTGA 2EM9A 1X6FA 2YU8A 2EN7A 1P47A 3EPJA 1JK1A 2I13A 4GZNC 2ENAA 2EOZA 4R2CA 2MKDA 1YUJA 5KL4A 4R2EA 1ZR9A 2EQ0A 3UK3C 2BB8A 2PRTA 2YTNA 1A1GA 2EN2A 2EJ4A 2EOEA 2MKNA 1A1IA 1A1JA 4WSGA 4F2JC 2VRDA 2EOMA 1LLMC 2EMZA 3M99B 2DLKA 2EMKA 1KJKA 2WBTA 2LT7A 2EM7A 2E72A 2EPCA 2YU5A 2EPRA 2EM0A 2EL5A 1WJPA 2EMCA 4IS1C 2EL6A 2EOJA 2ENCA 2CT1A 2YSOA 2YTPA 2EPUA 2EN3A 1JK2A 1YUIA 3MHSC 1BB8A 2EQ3A 2EPAA 1Z1BA 2YTEA 2YRMA 1AAYA 1TF6A 2EMWA 2EOXA 4R2RA 1B69A 2DGCA 5KL7A 1YSAC 2EM4A 4FK5C 2EOOA 1ZU1A 2LVHA 2EMBA 4IJDA 2EN4A 2RSIA 4R2SA 2RPCA 2R1FA 2EOIA 2EP3A 2EN8A 2EMGA 2EOFA 1DGCA 2EN1A 2EPPA 1BBOA 3MHHC 2ELYA 2LCEA 2EMIA 2HGHA 2CSHA
chains in the Genus database with same CATH superfamily
1T4OA 2VF1A 2YTOA 2EMLA 3RMPA 1HR0E 1UBDC 4R2PA 2MC6A 2UUCE 2WCC3 4AQYE 2JXPA 3HPSA 4KZSA 1EH6A 4LF4E 2FV4B 4DR6E 1KYQA 2YTJA 2L8TA 2V89A 2EMFA 2WBUA 1YFHA 2EOHA 4WFTA 2JVAA 4DMIA 2EL4A 2DRPA 2YPNA 1XMQE 1ZAAC 3ADIA 4JI0E 3BGHA 2VQFE 3VHTB 2NUEA 5KL5A 2UXBE 1WHNA 3IWDA 2EM2A 2ZM6E 2UXCE 1X49A 1A1KA 2B7VA 2EORA 3EPLA 1EKZA 4X8WA 2EQ1A 3MSWA 4O43A 4DR5E 3K6QA 3EPKA 1N32E 5ADZA 4OOGC 4B3SE 2JP9A 1GTKA 1AH5A 5BR8E 4MLVA 2GHFA 4WX9A 1RQ0A 4KHPE 4BC9A 1EH7A 4F6MA 4ZYDA 2EN7A 4X66E 3J7Yp 5LMNE 4R2CA 2LUQA 2EN2A 2M4IA 4O24A 2MKNA 4DR2E 4F2JC 2VRDA 1LLMC 4HTGA 2EMZA 5IXMB 4X65E 1GZ6A 2LJHA 2YU5A 2MDRA 4L8NA 1WJPA 4IS1C 2Q8UA 4M0VA 2YTPA 3QG5C 3MHSC 2WZOA 2EPAA 2YTEA 3VYYA 3ADLA 4BS9A 2DGCA 3ECRA 3EQ1A 2EPMX 1YSAC 2JR1A 5A6AA 4IJDA 5A6JA 2B9DA 4BBYA 4R2SA 2L2NA 4LF7E 3F6HA 5TSEA 2R1FA 2EOIA 2EP3A 4DR3E 2EMGA 1DGCA 4JI2E 1BBOA 2EMIA 5DNYA 3F6GA 2CSHA 4X64E 1X6HA 2ADRA 3T1YE 1A1LA 3VYXA 1I94E 3EPHA 3IWCA 2LUPB 4R8OA 4KWYA 1TN9A 3ZOQB 2LE2A 4ZYEA 1MEYC 4GEQB 3DF6A 4R2QA 3KZYA 2EM8A 4NHRA 1UHZA 2HJJA 2EPZA 2M7QA 4X9JA 4MLQA 2EM5A 5FLXC 4DV1E 2EOYA 3C6MA 2K4VA 2EPXA 5A2QC 2CTDA 3ADJA 4LFAE 2NUGA 5AE1A 2EZ6A 3OMLA 4JI1E 2ODRC 5A69A 2L92A 3THOB 3HXLA 2YRHA 4LU9A 2UUAE 1X48A 2JWOA 1N36E 2ELZA 4JI3E 3J81C 4BHBA 2ENHA 1UN6B 2YU8A 1X6FA 4DR7E 3EPJA 1JK1A 1IQOA 1J5EE 4JYAE 1BBGA 4TUGA 4LF6E 4BHCA 5LMUE 4O5GA 4R2EA 3KWRA 1ZBQA 2EQ0A 4ZYHA 2N8XA 2BB8A 2PRTA 2KOUA 1N3GA 2YTNA 4B3RE 5LL6R 1WRJA 1A1IA 4WSPA 4B3TE 3OTOE 2DLKA 5F3WA 2LTRA 1YZ9A 2WBTA 1KJKA 2EM7A 2E72A 2EPCA 4RHBB 1HNXE 1YYWA 2EPRA 2RS7A 2L33A 1FJGE 2EPUA 4YY3E 1HNWE 1BB8A 2EQ3A 1SFEA 2DMYA 1AAYA 2EMWA 1YYOA 2L2MA 5AE3A 3JAMC 4DUYE 4K0KE 4WXCA 2R76A 2RSIA 4B3ME 2RPCA 4DV6E 2MC5A 3HPZA 4HEIA 1WHQA 5A6BD 2NUFA 4JV5E 2EN1A 4DKKA 2ELYA 2FGGA 1ZBTA 4BMJA 1MGTA 5CFFE 4N4RB 4JI4E 1TF3A 1DI2A 5IWAE 4DR1E 4WXDA 2E1MA 2EMYA 2DLQA 1QNTA 2EPOA 4LF8E 2RSMA 1NCSA 5KL2A 3J7AG 1PJSA 2WBSA 2VQEE 2EE8A 1T4LB 2A25A 2EWLA 5T6JA 2V88A 2LO3A 4F9AB 1A1FA 2I9IA 2EPNA 1IBME 2D9HA 2EN6A 2J7JA 5AE2A 1PJQA 4BC7A 2L3CA 1F2IG 1DQ3A 4WPYA 2G7HA 2F8BA 4YHHE 4F6NA 2EMAA 1X5WA 2L3JA 1PJTA 1STUA 2JOBA 4P7DA 3BBGA 2EOQA 2F4VE 4X62E 2EMHA 2MDGA 1G2DC 5IT9C 2EM6A 2KONA 1RC7A 5A6BA 3T1HE 4DV5E 2E5LE 2M9AA 2EOSA 2DSYA 2YTGA 1EH8A 4L5NC 5AC4A 2B3TB 2LRSA 2EOZA 1YUJA 3C4TA 4GKKE 2ODRD 2YWQA 4ZYGA 5IV8B 5AC5A 2EOEA 2EPLX 3LLHA 1XNQE 4I8OA 4WSGA 1N33E 3TQMA 2EOMA 2B7TA 3M99B 3KZZA 1XMOE 4J8ZA 5A6KA 3HQ1A 3ADGA 4WYQB 2EM0A 2EL5A 2HC5A 2L6MA 4JI6E 2BBGA 4P78A 3BF2A 2YSOA 1JK2A 4JI7E 1YUIA 4NXNE 4R03A 2V83A 2FTXB 1TF6A 2LMZA 4R2RA 1B69A 4JI8E 4DV3E 2YT4A 5KL7A 1QU6A 4LTYA 2EM4A 4JI5E 2LVHA 3AUZA 2EN4A 3L00A 1YPNA 1IMUA 4Q35B 2LTSA 3DJWA 1L4SA 5LLQA 2H36X 3MHHC 1IBKE 1N34E 4NXME 1HNZE 1X47A 1T38A 2CPNA 2GLIA 2NABA 1G2FC 3IWBA 2YTIA 2YTDA 4F9BB 2V8QB 4OX9E 2DMIA 2M1SA 2EPKX 2YSPA 5KL3A 2V87A 1PKPA 4LF5E 1YYKA 4M2ZA 2YTQA 3HTXA 2YZTA 1O0WA 4BCAA 4M30A 1A1HA 1X6EA 2DB2A 1PDAA 4R2AA 1X3CA 2KHXA 2RQLA 4NZVA 3JU0A 1IBLE 2N3GA 2EMXA 4LFBE 1T4NA 2IHR1 2L2KB 1T39A 5KL6A 2YTFA 3BIDA 3C4BA 1IQSA 2UUBE 1RMDA 2LV2A 1XNRE 2UXDE 4R2DA 2YRKA 2K7IA 4Q28A 2GPIA 2JPAA 4TUIA 2EM3A 4DV2E 4M9VC 2JOXA 2EM9A 3AV0A 2UU9E 1P47A 2VE7C 2I13A 4GZNC 2ENAA 1SR9A 3J80C 2MKDA 3H09A 5KL4A 1ZR9A 3UK3C 1J26A 4F54A 1A1GA 2EJ4A 4DUZE 1A1JA 2EMKA 2LT7A 4DV7E 2V86A 4DR4E 2EMCA 1WXRA 2EL6A 2EOJA 2ENCA 2JY9A 2CT1A 4F9CB 2EN3A 4DV0E 1Z1BA 2YRMA 4LF9E 2JYAA 4O4KA 1GQEA 3JTZA 2EOXA 1FKAE 5AASA 3THNA 3FIGA 1NEIA 2EOOA 4FK5C 1ZU1A 2V85A 2EMBA 2LBSB 3P1XA 2HHHE 2LJUA 2NA2A 3C6KA 2RS6A 3VK6A 2RTXA 2DIXA 4DV4E 2EN8A 1UILA 2N3HA 2EOFA 4RH8A 2EPPA 4GKJE 4LFCE 2HGHA 2LCEA 3LMLA
chains in the Genus database with same CATH topology
1TF3A 2YTOA 2EMLA 1UBDC 1X6HA 2NABA 4R2PA 2GLIA 2ADRA 2EMYA 1A1LA 2DLQA 1G2FC 2YTIA 2WCC3 3EPHA 2YTDA 1NCSA 5KL2A 2DMIA 5KL3A 1TN9A 2YSPA 2WBSA 2EE8A 2A25A 2YTJA 2WBUA 2EMFA 2EOHA 1MEYC 2YTQA 2LO3A 4R2QA 1A1FA 2EM8A 2EL4A 1A1HA 2DRPA 1X6EA 2D9HA 4R2AA 1ZAAC 1X3CA 2EN6A 2J7JA 2EPZA 4X9JA 3VHTB 2EM5A 5KL5A 2EOYA 1F2IG 2EMXA 2EPXA 2EM2A 2CTDA 1A1KA 2EORA 3EPLA 4F6NA 2EMAA 2EQ1A 5KL6A 2YTFA 1X5WA 1RMDA 3EPKA 2LV2A 2EOQA 1G2DC 2EMHA 2MDGA 2EM6A 4R2DA 2YRKA 2JP9A 2YRHA 2JPAA 2M9AA 2GHFA 2ELZA 2EM3A 2EOSA 2ENHA 4F6MA 4M9VC 1UN6B 2YTGA 2EM9A 1X6FA 2YU8A 2EN7A 1P47A 3EPJA 1JK1A 2I13A 4GZNC 2ENAA 2EOZA 4R2CA 2MKDA 1YUJA 5KL4A 4R2EA 1ZR9A 2EQ0A 3UK3C 2BB8A 2PRTA 2YTNA 1A1GA 2EN2A 2EJ4A 2EOEA 2MKNA 1A1IA 1A1JA 4WSGA 4F2JC 2VRDA 2EOMA 1LLMC 2EMZA 3M99B 2DLKA 2EMKA 1KJKA 2WBTA 2LT7A 2EM7A 2E72A 2EPCA 2YU5A 2EPRA 2EM0A 2EL5A 1WJPA 2EMCA 4IS1C 2EL6A 2EOJA 2ENCA 2CT1A 2YSOA 2YTPA 2EPUA 2EN3A 1JK2A 1YUIA 3MHSC 1BB8A 2EQ3A 2EPAA 1Z1BA 2YTEA 2YRMA 1AAYA 1TF6A 2EMWA 2EOXA 4R2RA 1B69A 2DGCA 5KL7A 1YSAC 2EM4A 4FK5C 2EOOA 1ZU1A 2LVHA 2EMBA 4IJDA 2EN4A 2RSIA 4R2SA 2RPCA 2R1FA 2EOIA 2EP3A 2EN8A 2EMGA 2EOFA 1DGCA 2EN1A 2EPPA 1BBOA 3MHHC 2ELYA 2LCEA 2EMIA 2HGHA 2CSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TF3 A;  2YTO A;  2EML A;  1UBD C;  1X6H A;  2NAB A;  4R2P A;  2GLI A;  2ADR A;  2EMY A;  1A1L A;  2DLQ A;  1G2F C;  2YTI A;  2WCC 3;  3EPH A;  2YTD A;  1NCS A;  5KL2 A;  2DMI A;  5KL3 A;  1TN9 A;  2YSP A;  2WBS A;  2EE8 A;  2A25 A;  2YTJ A;  2WBU A;  2EMF A;  2EOH A;  1MEY C;  2YTQ A;  2LO3 A;  4R2Q A;  1A1F A;  2EM8 A;  2EL4 A;  1A1H A;  2DRP A;  1X6E A;  2D9H A;  4R2A A;  1ZAA C;  1X3C A;  2EN6 A;  2J7J A;  2EPZ A;  4X9J A;  3VHT B;  2EM5 A;  5KL5 A;  2EOY A;  1F2I G;  2EMX A;  2EPX A;  2EM2 A;  2CTD A;  1A1K A;  2EOR A;  3EPL A;  4F6N A;  2EMA A;  2EQ1 A;  5KL6 A;  2YTF A;  1X5W A;  1RMD A;  3EPK A;  2LV2 A;  2EOQ A;  1G2D C;  2EMH A;  2MDG A;  2EM6 A;  4R2D A;  2YRK A;  2JP9 A;  2YRH A;  2JPA A;  2M9A A;  2GHF A;  2ELZ A;  2EM3 A;  2EOS A;  2ENH A;  4F6M A;  4M9V C;  1UN6 B;  2YTG A;  2EM9 A;  1X6F A;  2YU8 A;  2EN7 A;  1P47 A;  3EPJ A;  1JK1 A;  2I13 A;  4GZN C;  2ENA A;  2EOZ A;  4R2C A;  2MKD A;  1YUJ A;  5KL4 A;  4R2E A;  1ZR9 A;  2EQ0 A;  3UK3 C;  2BB8 A;  2PRT A;  2YTN A;  1A1G A;  2EN2 A;  2EJ4 A;  2EOE A;  2MKN A;  1A1I A;  1A1J A;  4WSG A;  4F2J C;  2VRD A;  2EOM A;  1LLM C;  2EMZ A;  3M99 B;  2DLK A;  2EMK A;  1KJK A;  2WBT A;  2LT7 A;  2EM7 A;  2E72 A;  2EPC A;  2YU5 A;  2EPR A;  2EM0 A;  2EL5 A;  1WJP A;  2EMC A;  4IS1 C;  2EL6 A;  2EOJ A;  2ENC A;  2CT1 A;  2YSO A;  2YTP A;  2EPU A;  2EN3 A;  1JK2 A;  1YUI A;  3MHS C;  1BB8 A;  2EQ3 A;  2EPA A;  1Z1B A;  2YTE A;  2YRM A;  1AAY A;  1TF6 A;  2EMW A;  2EOX A;  4R2R A;  1B69 A;  2DGC A;  5KL7 A;  1YSA C;  2EM4 A;  4FK5 C;  2EOO A;  1ZU1 A;  2LVH A;  2EMB A;  4IJD A;  2EN4 A;  2RSI A;  4R2S A;  2RPC A;  2R1F A;  2EOI A;  2EP3 A;  2EN8 A;  2EMG A;  2EOF A;  1DGC A;  2EN1 A;  2EPP A;  1BBO A;  3MHH C;  2ELY A;  2LCE A;  2EMI A;  2HGH A;  2CSH A; 
#chains in the Genus database with same CATH topology
 1T4O A;  2VF1 A;  2YTO A;  2EML A;  3RMP A;  1HR0 E;  1UBD C;  4R2P A;  2MC6 A;  2UUC E;  2WCC 3;  4AQY E;  2JXP A;  3HPS A;  4KZS A;  1EH6 A;  4LF4 E;  2FV4 B;  4DR6 E;  1KYQ A;  2YTJ A;  2L8T A;  2V89 A;  2EMF A;  2WBU A;  1YFH A;  2EOH A;  4WFT A;  2JVA A;  4DMI A;  2EL4 A;  2DRP A;  2YPN A;  1XMQ E;  1ZAA C;  3ADI A;  4JI0 E;  3BGH A;  2VQF E;  3VHT B;  2NUE A;  5KL5 A;  2UXB E;  1WHN A;  3IWD A;  2EM2 A;  2ZM6 E;  2UXC E;  1X49 A;  1A1K A;  2B7V A;  2EOR A;  3EPL A;  1EKZ A;  4X8W A;  2EQ1 A;  3MSW A;  4O43 A;  4DR5 E;  3K6Q A;  3EPK A;  1N32 E;  5ADZ A;  4OOG C;  4B3S E;  2JP9 A;  1GTK A;  1AH5 A;  5BR8 E;  4MLV A;  2GHF A;  4WX9 A;  1RQ0 A;  4KHP E;  4BC9 A;  1EH7 A;  4F6M A;  4ZYD A;  2EN7 A;  4X66 E;  3J7Y p;  5LMN E;  4R2C A;  2LUQ A;  2EN2 A;  2M4I A;  4O24 A;  2MKN A;  4DR2 E;  4F2J C;  2VRD A;  1LLM C;  4HTG A;  2EMZ A;  5IXM B;  4X65 E;  1GZ6 A;  2LJH A;  2YU5 A;  2MDR A;  4L8N A;  1WJP A;  4IS1 C;  2Q8U A;  4M0V A;  2YTP A;  3QG5 C;  3MHS C;  2WZO A;  2EPA A;  2YTE A;  3VYY A;  3ADL A;  4BS9 A;  2DGC A;  3ECR A;  3EQ1 A;  2EPM X;  1YSA C;  2JR1 A;  5A6A A;  4IJD A;  5A6J A;  2B9D A;  4BBY A;  4R2S A;  2L2N A;  4LF7 E;  3F6H A;  5TSE A;  2R1F A;  2EOI A;  2EP3 A;  4DR3 E;  2EMG A;  1DGC A;  4JI2 E;  1BBO A;  2EMI A;  5DNY A;  3F6G A;  2CSH A;  4X64 E;  1X6H A;  2ADR A;  3T1Y E;  1A1L A;  3VYX A;  1I94 E;  3EPH A;  3IWC A;  2LUP B;  4R8O A;  4KWY A;  1TN9 A;  3ZOQ B;  2LE2 A;  4ZYE A;  1MEY C;  4GEQ B;  3DF6 A;  4R2Q A;  3KZY A;  2EM8 A;  4NHR A;  1UHZ A;  2HJJ A;  2EPZ A;  2M7Q A;  4X9J A;  4MLQ A;  2EM5 A;  5FLX C;  4DV1 E;  2EOY A;  3C6M A;  2K4V A;  2EPX A;  5A2Q C;  2CTD A;  3ADJ A;  4LFA E;  2NUG A;  5AE1 A;  2EZ6 A;  3OML A;  4JI1 E;  2ODR C;  5A69 A;  2L92 A;  3THO B;  3HXL A;  2YRH A;  4LU9 A;  2UUA E;  1X48 A;  2JWO A;  1N36 E;  2ELZ A;  4JI3 E;  3J81 C;  4BHB A;  2ENH A;  1UN6 B;  2YU8 A;  1X6F A;  4DR7 E;  3EPJ A;  1JK1 A;  1IQO A;  1J5E E;  4JYA E;  1BBG A;  4TUG A;  4LF6 E;  4BHC A;  5LMU E;  4O5G A;  4R2E A;  3KWR A;  1ZBQ A;  2EQ0 A;  4ZYH A;  2N8X A;  2BB8 A;  2PRT A;  2KOU A;  1N3G A;  2YTN A;  4B3R E;  5LL6 R;  1WRJ A;  1A1I A;  4WSP A;  4B3T E;  3OTO E;  2DLK A;  5F3W A;  2LTR A;  1YZ9 A;  2WBT A;  1KJK A;  2EM7 A;  2E72 A;  2EPC A;  4RHB B;  1HNX E;  1YYW A;  2EPR A;  2RS7 A;  2L33 A;  1FJG E;  2EPU A;  4YY3 E;  1HNW E;  1BB8 A;  2EQ3 A;  1SFE A;  2DMY A;  1AAY A;  2EMW A;  1YYO A;  2L2M A;  5AE3 A;  3JAM C;  4DUY E;  4K0K E;  4WXC A;  2R76 A;  2RSI A;  4B3M E;  2RPC A;  4DV6 E;  2MC5 A;  3HPZ A;  4HEI A;  1WHQ A;  5A6B D;  2NUF A;  4JV5 E;  2EN1 A;  4DKK A;  2ELY A;  2FGG A;  1ZBT A;  4BMJ A;  1MGT A;  5CFF E;  4N4R B;  4JI4 E;  1TF3 A;  1DI2 A;  5IWA E;  4DR1 E;  4WXD A;  2E1M A;  2EMY A;  2DLQ A;  1QNT A;  2EPO A;  4LF8 E;  2RSM A;  1NCS A;  5KL2 A;  3J7A G;  1PJS A;  2WBS A;  2VQE E;  2EE8 A;  1T4L B;  2A25 A;  2EWL A;  5T6J A;  2V88 A;  2LO3 A;  4F9A B;  1A1F A;  2I9I A;  2EPN A;  1IBM E;  2D9H A;  2EN6 A;  2J7J A;  5AE2 A;  1PJQ A;  4BC7 A;  2L3C A;  1F2I G;  1DQ3 A;  4WPY A;  2G7H A;  2F8B A;  4YHH E;  4F6N A;  2EMA A;  1X5W A;  2L3J A;  1PJT A;  1STU A;  2JOB A;  4P7D A;  3BBG A;  2EOQ A;  2F4V E;  4X62 E;  2EMH A;  2MDG A;  1G2D C;  5IT9 C;  2EM6 A;  2KON A;  1RC7 A;  5A6B A;  3T1H E;  4DV5 E;  2E5L E;  2M9A A;  2EOS A;  2DSY A;  2YTG A;  1EH8 A;  4L5N C;  5AC4 A;  2B3T B;  2LRS A;  2EOZ A;  1YUJ A;  3C4T A;  4GKK E;  2ODR D;  2YWQ A;  4ZYG A;  5IV8 B;  5AC5 A;  2EOE A;  2EPL X;  3LLH A;  1XNQ E;  4I8O A;  4WSG A;  1N33 E;  3TQM A;  2EOM A;  2B7T A;  3M99 B;  3KZZ A;  1XMO E;  4J8Z A;  5A6K A;  3HQ1 A;  3ADG A;  4WYQ B;  2EM0 A;  2EL5 A;  2HC5 A;  2L6M A;  4JI6 E;  2BBG A;  4P78 A;  3BF2 A;  2YSO A;  1JK2 A;  4JI7 E;  1YUI A;  4NXN E;  4R03 A;  2V83 A;  2FTX B;  1TF6 A;  2LMZ A;  4R2R A;  1B69 A;  4JI8 E;  4DV3 E;  2YT4 A;  5KL7 A;  1QU6 A;  4LTY A;  2EM4 A;  4JI5 E;  2LVH A;  3AUZ A;  2EN4 A;  3L00 A;  1YPN A;  1IMU A;  4Q35 B;  2LTS A;  3DJW A;  1L4S A;  5LLQ A;  2H36 X;  3MHH C;  1IBK E;  1N34 E;  4NXM E;  1HNZ E;  1X47 A;  1T38 A;  2CPN A;  2GLI A;  2NAB A;  1G2F C;  3IWB A;  2YTI A;  2YTD A;  4F9B B;  2V8Q B;  4OX9 E;  2DMI A;  2M1S A;  2EPK X;  2YSP A;  5KL3 A;  2V87 A;  1PKP A;  4LF5 E;  1YYK A;  4M2Z A;  2YTQ A;  3HTX A;  2YZT A;  1O0W A;  4BCA A;  4M30 A;  1A1H A;  1X6E A;  2DB2 A;  1PDA A;  4R2A A;  1X3C A;  2KHX A;  2RQL A;  4NZV A;  3JU0 A;  1IBL E;  2N3G A;  2EMX A;  4LFB E;  1T4N A;  2IHR 1;  2L2K B;  1T39 A;  5KL6 A;  2YTF A;  3BID A;  3C4B A;  1IQS A;  2UUB E;  1RMD A;  2LV2 A;  1XNR E;  2UXD E;  4R2D A;  2YRK A;  2K7I A;  4Q28 A;  2GPI A;  2JPA A;  4TUI A;  2EM3 A;  4DV2 E;  4M9V C;  2JOX A;  2EM9 A;  3AV0 A;  2UU9 E;  1P47 A;  2VE7 C;  2I13 A;  4GZN C;  2ENA A;  1SR9 A;  3J80 C;  2MKD A;  3H09 A;  5KL4 A;  1ZR9 A;  3UK3 C;  1J26 A;  4F54 A;  1A1G A;  2EJ4 A;  4DUZ E;  1A1J A;  2EMK A;  2LT7 A;  4DV7 E;  2V86 A;  4DR4 E;  2EMC A;  1WXR A;  2EL6 A;  2EOJ A;  2ENC A;  2JY9 A;  2CT1 A;  4F9C B;  2EN3 A;  4DV0 E;  1Z1B A;  2YRM A;  4LF9 E;  2JYA A;  4O4K A;  1GQE A;  3JTZ A;  2EOX A;  1FKA E;  5AAS A;  3THN A;  3FIG A;  1NEI A;  2EOO A;  4FK5 C;  1ZU1 A;  2V85 A;  2EMB A;  2LBS B;  3P1X A;  2HHH E;  2LJU A;  2NA2 A;  3C6K A;  2RS6 A;  3VK6 A;  2RTX A;  2DIX A;  4DV4 E;  2EN8 A;  1UIL A;  2N3H A;  2EOF A;  4RH8 A;  2EPP A;  4GKJ E;  4LFC E;  2HGH A;  2LCE A;  3LML A; 
#chains in the Genus database with same CATH homology
 1TF3 A;  2YTO A;  2EML A;  1UBD C;  1X6H A;  2NAB A;  4R2P A;  2GLI A;  2ADR A;  2EMY A;  1A1L A;  2DLQ A;  1G2F C;  2YTI A;  2WCC 3;  3EPH A;  2YTD A;  1NCS A;  5KL2 A;  2DMI A;  5KL3 A;  1TN9 A;  2YSP A;  2WBS A;  2EE8 A;  2A25 A;  2YTJ A;  2WBU A;  2EMF A;  2EOH A;  1MEY C;  2YTQ A;  2LO3 A;  4R2Q A;  1A1F A;  2EM8 A;  2EL4 A;  1A1H A;  2DRP A;  1X6E A;  2D9H A;  4R2A A;  1ZAA C;  1X3C A;  2EN6 A;  2J7J A;  2EPZ A;  4X9J A;  3VHT B;  2EM5 A;  5KL5 A;  2EOY A;  1F2I G;  2EMX A;  2EPX A;  2EM2 A;  2CTD A;  1A1K A;  2EOR A;  3EPL A;  4F6N A;  2EMA A;  2EQ1 A;  5KL6 A;  2YTF A;  1X5W A;  1RMD A;  3EPK A;  2LV2 A;  2EOQ A;  1G2D C;  2EMH A;  2MDG A;  2EM6 A;  4R2D A;  2YRK A;  2JP9 A;  2YRH A;  2JPA A;  2M9A A;  2GHF A;  2ELZ A;  2EM3 A;  2EOS A;  2ENH A;  4F6M A;  4M9V C;  1UN6 B;  2YTG A;  2EM9 A;  1X6F A;  2YU8 A;  2EN7 A;  1P47 A;  3EPJ A;  1JK1 A;  2I13 A;  4GZN C;  2ENA A;  2EOZ A;  4R2C A;  2MKD A;  1YUJ A;  5KL4 A;  4R2E A;  1ZR9 A;  2EQ0 A;  3UK3 C;  2BB8 A;  2PRT A;  2YTN A;  1A1G A;  2EN2 A;  2EJ4 A;  2EOE A;  2MKN A;  1A1I A;  1A1J A;  4WSG A;  4F2J C;  2VRD A;  2EOM A;  1LLM C;  2EMZ A;  3M99 B;  2DLK A;  2EMK A;  1KJK A;  2WBT A;  2LT7 A;  2EM7 A;  2E72 A;  2EPC A;  2YU5 A;  2EPR A;  2EM0 A;  2EL5 A;  1WJP A;  2EMC A;  4IS1 C;  2EL6 A;  2EOJ A;  2ENC A;  2CT1 A;  2YSO A;  2YTP A;  2EPU A;  2EN3 A;  1JK2 A;  1YUI A;  3MHS C;  1BB8 A;  2EQ3 A;  2EPA A;  1Z1B A;  2YTE A;  2YRM A;  1AAY A;  1TF6 A;  2EMW A;  2EOX A;  4R2R A;  1B69 A;  2DGC A;  5KL7 A;  1YSA C;  2EM4 A;  4FK5 C;  2EOO A;  1ZU1 A;  2LVH A;  2EMB A;  4IJD A;  2EN4 A;  2RSI A;  4R2S A;  2RPC A;  2R1F A;  2EOI A;  2EP3 A;  2EN8 A;  2EMG A;  2EOF A;  1DGC A;  2EN1 A;  2EPP A;  1BBO A;  3MHH C;  2ELY A;  2LCE A;  2EMI A;  2HGH A;  2CSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...