1YUJA

Solution nmr structure of the gaga factor/dna complex, 50 structures
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
54
structure length
54
Chain Sequence
PKAKRAKHPPGTEKPRSRSQSEQPATCPICYAVIRQSRNLRRHLELRHFAKPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*GP*CP*CP*GP*AP*GP*AP*GP*TP*AP*C)-3')
publication title The solution structure of a specific GAGA factor-DNA complex reveals a modular binding mode.
pubmed doi rcsb
molecule tags Dna binding protein/dna
total genus 11
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 1996-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09237 GAGA GAGA factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1yujA00
2EL6A 2EM3A 2EMAA 2YTNA 2DRPA 2EM9A 1P47A 2YSOA 4R2CA 2GLIA 2JPAA 2ENAA 2EOHA 2EM7A 1TF3A 2EN8A 4R2PA 2LT7A 2YRMA 2EN6A 2WBTA 5KL4A 1X6FA 1MEYC 1RMDA 2YTQA 2WCC3 2EOQA 2MKDA 2CSHA 2YTFA 5KL5A 4GZNC 2EOMA 1JK1A 2LV2A 3M99B 2ELYA 1KJKA 2A25A 2EM6A 5KL3A 1A1JA 1ZAAC 4IS1C 2I13A 2EM8A 1A1KA 2BB8A 1A1LA 2DGCA 2EPXA 4FK5C 3EPKA 1G2DC 2WBUA 1A1FA 2EPPA 2YSPA 2EMYA 1AAYA 2YTOA 1A1GA 5KL2A 4R2AA 5KL7A 2EMZA 2EMXA 2RPCA 2EP3A 3MHSC 1UBDC 2EM0A 2LCEA 2YTIA 2EMLA 3UK3C 2EM4A 2DLKA 2YRHA 4F6MA 1A1IA 2EMIA 4R2DA 2EQ3A 2YU8A 2EQ0A 2EMFA 2LO3A 2EPZA 2EMKA 1B69A 2HGHA 2YRKA 1JK2A 2CT1A 2EJ4A 2EPRA 2EPAA 2EE8A 1G2FC 2ENHA 2ELZA 1BB8A 2EOZA 3EPHA 2D9HA 1TF6A 2MKNA 1NCSA 1YUIA 3EPJA 2EOOA 2EOJA 1X6EA 2EL5A 2EMGA 4R2RA 2EN4A 2EN1A 5KL6A 2EMCA 4M9VC 2YTDA 1LLMC 2ADRA 2EMBA 2EQ1A 3VHTB 2VRDA 2J7JA 1F2IG 1Z1BA 2LVHA 2EM2A 2YTJA 2EOSA 1X6HA 2MDGA 1X5WA 1X3CA 4WSGA 1ZR9A 2ENCA 4F6NA 2EOYA 2DLQA 2YTGA 4F2JC 2NABA 2EN2A 2EN7A 2M9AA 1YSAC 2GHFA 1YUJA 2YTEA 2DMIA 2YTPA 2EOFA 4R2QA 4R2EA 1BBOA 1DGCA 2RSIA 2EOIA 2EL4A 1UN6B 4X9JA 2EN3A 2EOEA 2WBSA 4IJDA 3EPLA 2EMWA 4R2SA 1A1HA 2R1FA 1WJPA 2EOXA 2CTDA 2EMHA 3MHHC 1TN9A 2EPCA 2JP9A 1ZU1A 2YU5A 2PRTA 2E72A 2EM5A 2EORA 2EPUA
chains in the Genus database with same CATH superfamily
2I9IA 2EMAA 2JXPA 3JAMC 2DRPA 3HTXA 3QG5C 2EOHA 2EM7A 4LF5E 4X64E 2EN8A 4LFCE 3LMLA 4R2PA 1J5EE 2HJJA 2L2KB 1MEYC 1T4NA 1N34E 4JI6E 1SFEA 1J26A 2DSYA 5KL5A 2EOMA 3VK6A 1IBLE 3BGHA 2EZ6A 2A25A 4B3TE 2LJUA 3BF2A 2NUEA 4JI7E 2I13A 2N3GA 4OOGC 2EPKX 2EPXA 4TUGA 1AH5A 4FK5C 3EPKA 1L4SA 1G2DC 2EMYA 3P1XA 2YTOA 2V87A 4P78A 4DV7E 3FIGA 5KL2A 1A1GA 5AC4A 1RQ0A 4DR4E 1GTKA 2YT4A 4BS9A 4KHPE 2YTIA 4BMJA 4DV5E 4KZSA 5AASA 1HR0E 1A1IA 4R2DA 4DR2E 2EQ0A 2EPZA 2NUFA 1HNZE 4JI0E 4X66E 1T4OA 1YYWA 2EPRA 2DIXA 3C4BA 1I94E 2ENHA 2N3HA 4DV4E 1BB8A 1GQEA 5AE3A 4NXME 2DB2A 2UXBE 4DMIA 4R03A 5KL6A 4B3ME 2L92A 4R8OA 2VQFE 4M9VC 2L6MA 1LLMC 1WHQA 1N3GA 4LF7E 2JR1A 1IMUA 3THOB 5AE2A 1PJQA 3JU0A 1Z1BA 2LVHA 2DMYA 2YTJA 4O5GA 2G7HA 4WSGA 3C6MA 2ENCA 2B9DA 3VYYA 1FJGE 2NABA 2ODRC 3MSWA 2EPLX 2EN7A 1SR9A 2B3TB 2GPIA 3C6KA 3THNA 2L33A 1DGCA 2RSIA 4LU9A 4ZYGA 2EOIA 3KWRA 3EPLA 1MGTA 2L3CA 2L2NA 2EMWA 2WZOA 2HHHE 3EQ1A 3MHHC 3F6HA 1TN9A 1IBME 4LF8E 4LF4E 2R76A 2EM5A 2FGGA 1STUA 2EL6A 2EM3A 2L8TA 1IQSA 2RS7A 2V8QB 2YTNA 3IWBA 1RC7A 4R2CA 2KONA 2ENAA 2LRSA 1YFHA 2FV4B 4L8NA 4N4RB 1ZBTA 2EN6A 2WBTA 3OMLA 4GEQB 4NZVA 5KL4A 1RMDA 2YTQA 3KZYA 3J80C 1X49A 4JYAE 1O0WA 2YTFA 2LBSB 4GZNC 4DV6E 2V83A 2LMZA 1A1JA 3IWDA 5LMNE 2EM8A 1A1KA 2LTRA 1DQ3A 2BB8A 2DGCA 4HTGA 1A1FA 1AAYA 4GKKE 2RS6A 4I8OA 2EMZA 2V88A 3VYXA 1WRJA 2EP3A 1UBDC 1DI2A 2EM0A 3T1YE 2EMLA 3UK3C 2VE7C 4NHRA 2YRHA 4F9AB 2E1MA 2EQ3A 2JOBA 2YU8A 1B69A 1GZ6A 1QU6A 2YRKA 1YPNA 2EE8A 1XNRE 2UXCE 4DR7E 4KWYA 3C4TA 2D9HA 3KZZA 1UILA 4TUIA 2EOOA 3J7Yp 4DV3E 2CPNA 3HPZA 2EMGA 1PJSA 4R2RA 1EH6A 1YZ9A 4WSPA 2YTDA 5DNYA 2EMBA 4BC9A 1X47A 5CFFE 5A2QC 1F2IG 1T4LB 4Q35B 1ZR9A 1XMQE 4OX9E 1XMOE 2EOYA 5IXMB 3ZOQB 2H36X 4MLQA 1YUJA 4M0VA 4ZYEA 4DUZE 5A6JA 2UUBE 2UXDE 2EL4A 4DR6E 4P7DA 2EN3A 4IJDA 2EPNA 5A6BD 1WJPA 1BBGA 2EOXA 4LF9E 2EMHA 3BIDA 1HNWE 2EPCA 1N33E 2HC5A 2JP9A 1ZU1A 2ZM6E 1X6EA 2EORA 2F4VE 3ADJA 4RH8A 3ECRA 2EM9A 1P47A 2YSOA 4ZYDA 1QNTA 2EWLA 2KHXA 3HQ1A 1N36E 4B3RE 2LT7A 2YRMA 5IT9C 4DUYE 4DR1E 4JI3E 1X6FA 4HEIA 2WCC3 2EOQA 2MKDA 1XNQE 2E5LE 3DJWA 2K4VA 4WX9A 1JK1A 1N32E 2ELYA 4DV1E 4JV5E 3OTOE 4IS1C 2IHR1 4YY3E 4LFAE 2EPPA 3J81C 4R2AA 5KL7A 1PJTA 4DV2E 2EMXA 2RPCA 2LCEA 1PDAA 2ODRD 5AC5A 1T38A 2DLKA 1YYKA 3L00A 1WHNA 2EMFA 2EMKA 4LF6E 2HGHA 2V86A 4O43A 3J7AG 2LJHA 1JK2A 4YHHE 2EJ4A 2MC6A 5T6JA 2EPAA 1X48A 4WFTA 5TSEA 2EOZA 3EPHA 2MKNA 3ADLA 4MLVA 1NCSA 2JWOA 3EPJA 2EL5A 4AQYE 3HXLA 2B7TA 4K0KE 2YZTA 2EQ1A 4X8WA 4DR5E 3VHTB 2VRDA 2MDRA 4BC7A 2M1SA 4JI8E 5IWAE 4B3SE 1X5WA 1X3CA 4DR3E 4WPYA 5LMUE 4F6NA 2Q8UA 4F2JC 4DV0E 4X65E 1EH7A 2UUAE 2M9AA 2YTEA 1WXRA 1HNXE 2EOFA 4R2QA 3BBGA 5LLQA 5ADZA 3ADIA 2V89A 3IWCA 2MC5A 4R2SA 1A1HA 2R1FA 2CTDA 2K7IA 4ZYHA 2V85A 4RHBB 2PRTA 2E72A 2EPUA 2FTXB 2NA2A 3LLHA 2GLIA 2JPAA 1TF3A 4BHBA 5IV8B 3DF6A 2L2MA 4X62E 1EKZA 1KYQA 2CSHA 4F9BB 2LV2A 3M99B 4WXCA 4M2ZA 1KJKA 2EPMX 2EM6A 5KL3A 4DKKA 2EPOA 1ZAAC 1UHZA 1NEIA 5F3WA 1EH8A 1A1LA 2YWQA 2JY9A 2WBUA 2JOXA 2N8XA 2YSPA 2RQLA 4NXNE 2VQEE 5A6AA 4BBYA 3K6QA 3MHSC 4F9CB 4LFBE 5A69A 2B7VA 2EM4A 2UUCE 4F6MA 2EMIA 5A6KA 3AV0A 4Q28A 5A6BA 2LO3A 2RSMA 2JYAA 1FKAE 2CT1A 3TQMA 1YYOA 4WXDA 3HPSA 1PKPA 2M4IA 1G2FC 2ELZA 1TF6A 3H09A 4JI2E 2L3JA 4BHCA 3ADGA 1YUIA 3AUZA 2EOJA 5AE1A 2F8BA 1IBKE 3T1HE 2EN4A 2EN1A 2EMCA 4GKJE 2LUQA 4F54A 3JTZA 4O24A 2J7JA 2M7QA 1IQOA 2EM2A 2EOSA 1X6HA 2MDGA 5LL6R 3RMPA 2JVAA 4JI5E 1T39A 2RTXA 1ZBQA 4M30A 2DLQA 2BBGA 2YTGA 4LTYA 3F6GA 2EN2A 1YSAC 2GHFA 2DMIA 2VF1A 2NUGA 2YTPA 4JI4E 1BBOA 4R2EA 4O4KA 4JI1E 4J8ZA 2LUPB 1UN6B 4X9JA 2UU9E 2EOEA 2KOUA 5FLXC 2WBSA 2LE2A 2LTSA 4BCAA 2YPNA 4WYQB 2YU5A 4L5NC 2ADRA 5BR8E
chains in the Genus database with same CATH topology
2EL6A 2EM3A 2EMAA 2YTNA 2DRPA 2EM9A 1P47A 2YSOA 4R2CA 2GLIA 2JPAA 2ENAA 2EOHA 2EM7A 1TF3A 2EN8A 4R2PA 2LT7A 2YRMA 2EN6A 2WBTA 5KL4A 1X6FA 1MEYC 1RMDA 2YTQA 2WCC3 2EOQA 2MKDA 2CSHA 2YTFA 5KL5A 4GZNC 2EOMA 1JK1A 2LV2A 3M99B 2ELYA 1KJKA 2A25A 2EM6A 5KL3A 1A1JA 1ZAAC 4IS1C 2I13A 2EM8A 1A1KA 2BB8A 1A1LA 2DGCA 2EPXA 4FK5C 3EPKA 1G2DC 2WBUA 1A1FA 2EPPA 2YSPA 2EMYA 1AAYA 2YTOA 1A1GA 5KL2A 4R2AA 5KL7A 2EMZA 2EMXA 2RPCA 2EP3A 3MHSC 1UBDC 2EM0A 2LCEA 2YTIA 2EMLA 3UK3C 2EM4A 2DLKA 2YRHA 4F6MA 1A1IA 2EMIA 4R2DA 2EQ3A 2YU8A 2EQ0A 2EMFA 2LO3A 2EPZA 2EMKA 1B69A 2HGHA 2YRKA 1JK2A 2CT1A 2EJ4A 2EPRA 2EPAA 2EE8A 1G2FC 2ENHA 2ELZA 1BB8A 2EOZA 3EPHA 2D9HA 1TF6A 2MKNA 1NCSA 1YUIA 3EPJA 2EOOA 2EOJA 1X6EA 2EL5A 2EMGA 4R2RA 2EN4A 2EN1A 5KL6A 2EMCA 4M9VC 2YTDA 1LLMC 2ADRA 2EMBA 2EQ1A 3VHTB 2VRDA 2J7JA 1F2IG 1Z1BA 2LVHA 2EM2A 2YTJA 2EOSA 1X6HA 2MDGA 1X5WA 1X3CA 4WSGA 1ZR9A 2ENCA 4F6NA 2EOYA 2DLQA 2YTGA 4F2JC 2NABA 2EN2A 2EN7A 2M9AA 1YSAC 2GHFA 1YUJA 2YTEA 2DMIA 2YTPA 2EOFA 4R2QA 4R2EA 1BBOA 1DGCA 2RSIA 2EOIA 2EL4A 1UN6B 4X9JA 2EN3A 2EOEA 2WBSA 4IJDA 3EPLA 2EMWA 4R2SA 1A1HA 2R1FA 1WJPA 2EOXA 2CTDA 2EMHA 3MHHC 1TN9A 2EPCA 2JP9A 1ZU1A 2YU5A 2PRTA 2E72A 2EM5A 2EORA 2EPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EL6 A;  2EM3 A;  2EMA A;  2YTN A;  2DRP A;  2EM9 A;  1P47 A;  2YSO A;  4R2C A;  2GLI A;  2JPA A;  2ENA A;  2EOH A;  2EM7 A;  1TF3 A;  2EN8 A;  4R2P A;  2LT7 A;  2YRM A;  2EN6 A;  2WBT A;  5KL4 A;  1X6F A;  1MEY C;  1RMD A;  2YTQ A;  2WCC 3;  2EOQ A;  2MKD A;  2CSH A;  2YTF A;  5KL5 A;  4GZN C;  2EOM A;  1JK1 A;  2LV2 A;  3M99 B;  2ELY A;  1KJK A;  2A25 A;  2EM6 A;  5KL3 A;  1A1J A;  1ZAA C;  4IS1 C;  2I13 A;  2EM8 A;  1A1K A;  2BB8 A;  1A1L A;  2DGC A;  2EPX A;  4FK5 C;  3EPK A;  1G2D C;  2WBU A;  1A1F A;  2EPP A;  2YSP A;  2EMY A;  1AAY A;  2YTO A;  1A1G A;  5KL2 A;  4R2A A;  5KL7 A;  2EMZ A;  2EMX A;  2RPC A;  2EP3 A;  3MHS C;  1UBD C;  2EM0 A;  2LCE A;  2YTI A;  2EML A;  3UK3 C;  2EM4 A;  2DLK A;  2YRH A;  4F6M A;  1A1I A;  2EMI A;  4R2D A;  2EQ3 A;  2YU8 A;  2EQ0 A;  2EMF A;  2LO3 A;  2EPZ A;  2EMK A;  1B69 A;  2HGH A;  2YRK A;  1JK2 A;  2CT1 A;  2EJ4 A;  2EPR A;  2EPA A;  2EE8 A;  1G2F C;  2ENH A;  2ELZ A;  1BB8 A;  2EOZ A;  3EPH A;  2D9H A;  1TF6 A;  2MKN A;  1NCS A;  1YUI A;  3EPJ A;  2EOO A;  2EOJ A;  1X6E A;  2EL5 A;  2EMG A;  4R2R A;  2EN4 A;  2EN1 A;  5KL6 A;  2EMC A;  4M9V C;  2YTD A;  1LLM C;  2ADR A;  2EMB A;  2EQ1 A;  3VHT B;  2VRD A;  2J7J A;  1F2I G;  1Z1B A;  2LVH A;  2EM2 A;  2YTJ A;  2EOS A;  1X6H A;  2MDG A;  1X5W A;  1X3C A;  4WSG A;  1ZR9 A;  2ENC A;  4F6N A;  2EOY A;  2DLQ A;  2YTG A;  4F2J C;  2NAB A;  2EN2 A;  2EN7 A;  2M9A A;  1YSA C;  2GHF A;  1YUJ A;  2YTE A;  2DMI A;  2YTP A;  2EOF A;  4R2Q A;  4R2E A;  1BBO A;  1DGC A;  2RSI A;  2EOI A;  2EL4 A;  1UN6 B;  4X9J A;  2EN3 A;  2EOE A;  2WBS A;  4IJD A;  3EPL A;  2EMW A;  4R2S A;  1A1H A;  2R1F A;  1WJP A;  2EOX A;  2CTD A;  2EMH A;  3MHH C;  1TN9 A;  2EPC A;  2JP9 A;  1ZU1 A;  2YU5 A;  2PRT A;  2E72 A;  2EM5 A;  2EOR A;  2EPU A; 
#chains in the Genus database with same CATH topology
 2I9I A;  2EMA A;  2JXP A;  3JAM C;  2DRP A;  3HTX A;  3QG5 C;  2EOH A;  2EM7 A;  4LF5 E;  4X64 E;  2EN8 A;  4LFC E;  3LML A;  4R2P A;  1J5E E;  2HJJ A;  2L2K B;  1MEY C;  1T4N A;  1N34 E;  4JI6 E;  1SFE A;  1J26 A;  2DSY A;  5KL5 A;  2EOM A;  3VK6 A;  1IBL E;  3BGH A;  2EZ6 A;  2A25 A;  4B3T E;  2LJU A;  3BF2 A;  2NUE A;  4JI7 E;  2I13 A;  2N3G A;  4OOG C;  2EPK X;  2EPX A;  4TUG A;  1AH5 A;  4FK5 C;  3EPK A;  1L4S A;  1G2D C;  2EMY A;  3P1X A;  2YTO A;  2V87 A;  4P78 A;  4DV7 E;  3FIG A;  5KL2 A;  1A1G A;  5AC4 A;  1RQ0 A;  4DR4 E;  1GTK A;  2YT4 A;  4BS9 A;  4KHP E;  2YTI A;  4BMJ A;  4DV5 E;  4KZS A;  5AAS A;  1HR0 E;  1A1I A;  4R2D A;  4DR2 E;  2EQ0 A;  2EPZ A;  2NUF A;  1HNZ E;  4JI0 E;  4X66 E;  1T4O A;  1YYW A;  2EPR A;  2DIX A;  3C4B A;  1I94 E;  2ENH A;  2N3H A;  4DV4 E;  1BB8 A;  1GQE A;  5AE3 A;  4NXM E;  2DB2 A;  2UXB E;  4DMI A;  4R03 A;  5KL6 A;  4B3M E;  2L92 A;  4R8O A;  2VQF E;  4M9V C;  2L6M A;  1LLM C;  1WHQ A;  1N3G A;  4LF7 E;  2JR1 A;  1IMU A;  3THO B;  5AE2 A;  1PJQ A;  3JU0 A;  1Z1B A;  2LVH A;  2DMY A;  2YTJ A;  4O5G A;  2G7H A;  4WSG A;  3C6M A;  2ENC A;  2B9D A;  3VYY A;  1FJG E;  2NAB A;  2ODR C;  3MSW A;  2EPL X;  2EN7 A;  1SR9 A;  2B3T B;  2GPI A;  3C6K A;  3THN A;  2L33 A;  1DGC A;  2RSI A;  4LU9 A;  4ZYG A;  2EOI A;  3KWR A;  3EPL A;  1MGT A;  2L3C A;  2L2N A;  2EMW A;  2WZO A;  2HHH E;  3EQ1 A;  3MHH C;  3F6H A;  1TN9 A;  1IBM E;  4LF8 E;  4LF4 E;  2R76 A;  2EM5 A;  2FGG A;  1STU A;  2EL6 A;  2EM3 A;  2L8T A;  1IQS A;  2RS7 A;  2V8Q B;  2YTN A;  3IWB A;  1RC7 A;  4R2C A;  2KON A;  2ENA A;  2LRS A;  1YFH A;  2FV4 B;  4L8N A;  4N4R B;  1ZBT A;  2EN6 A;  2WBT A;  3OML A;  4GEQ B;  4NZV A;  5KL4 A;  1RMD A;  2YTQ A;  3KZY A;  3J80 C;  1X49 A;  4JYA E;  1O0W A;  2YTF A;  2LBS B;  4GZN C;  4DV6 E;  2V83 A;  2LMZ A;  1A1J A;  3IWD A;  5LMN E;  2EM8 A;  1A1K A;  2LTR A;  1DQ3 A;  2BB8 A;  2DGC A;  4HTG A;  1A1F A;  1AAY A;  4GKK E;  2RS6 A;  4I8O A;  2EMZ A;  2V88 A;  3VYX A;  1WRJ A;  2EP3 A;  1UBD C;  1DI2 A;  2EM0 A;  3T1Y E;  2EML A;  3UK3 C;  2VE7 C;  4NHR A;  2YRH A;  4F9A B;  2E1M A;  2EQ3 A;  2JOB A;  2YU8 A;  1B69 A;  1GZ6 A;  1QU6 A;  2YRK A;  1YPN A;  2EE8 A;  1XNR E;  2UXC E;  4DR7 E;  4KWY A;  3C4T A;  2D9H A;  3KZZ A;  1UIL A;  4TUI A;  2EOO A;  3J7Y p;  4DV3 E;  2CPN A;  3HPZ A;  2EMG A;  1PJS A;  4R2R A;  1EH6 A;  1YZ9 A;  4WSP A;  2YTD A;  5DNY A;  2EMB A;  4BC9 A;  1X47 A;  5CFF E;  5A2Q C;  1F2I G;  1T4L B;  4Q35 B;  1ZR9 A;  1XMQ E;  4OX9 E;  1XMO E;  2EOY A;  5IXM B;  3ZOQ B;  2H36 X;  4MLQ A;  1YUJ A;  4M0V A;  4ZYE A;  4DUZ E;  5A6J A;  2UUB E;  2UXD E;  2EL4 A;  4DR6 E;  4P7D A;  2EN3 A;  4IJD A;  2EPN A;  5A6B D;  1WJP A;  1BBG A;  2EOX A;  4LF9 E;  2EMH A;  3BID A;  1HNW E;  2EPC A;  1N33 E;  2HC5 A;  2JP9 A;  1ZU1 A;  2ZM6 E;  1X6E A;  2EOR A;  2F4V E;  3ADJ A;  4RH8 A;  3ECR A;  2EM9 A;  1P47 A;  2YSO A;  4ZYD A;  1QNT A;  2EWL A;  2KHX A;  3HQ1 A;  1N36 E;  4B3R E;  2LT7 A;  2YRM A;  5IT9 C;  4DUY E;  4DR1 E;  4JI3 E;  1X6F A;  4HEI A;  2WCC 3;  2EOQ A;  2MKD A;  1XNQ E;  2E5L E;  3DJW A;  2K4V A;  4WX9 A;  1JK1 A;  1N32 E;  2ELY A;  4DV1 E;  4JV5 E;  3OTO E;  4IS1 C;  2IHR 1;  4YY3 E;  4LFA E;  2EPP A;  3J81 C;  4R2A A;  5KL7 A;  1PJT A;  4DV2 E;  2EMX A;  2RPC A;  2LCE A;  1PDA A;  2ODR D;  5AC5 A;  1T38 A;  2DLK A;  1YYK A;  3L00 A;  1WHN A;  2EMF A;  2EMK A;  4LF6 E;  2HGH A;  2V86 A;  4O43 A;  3J7A G;  2LJH A;  1JK2 A;  4YHH E;  2EJ4 A;  2MC6 A;  5T6J A;  2EPA A;  1X48 A;  4WFT A;  5TSE A;  2EOZ A;  3EPH A;  2MKN A;  3ADL A;  4MLV A;  1NCS A;  2JWO A;  3EPJ A;  2EL5 A;  4AQY E;  3HXL A;  2B7T A;  4K0K E;  2YZT A;  2EQ1 A;  4X8W A;  4DR5 E;  3VHT B;  2VRD A;  2MDR A;  4BC7 A;  2M1S A;  4JI8 E;  5IWA E;  4B3S E;  1X5W A;  1X3C A;  4DR3 E;  4WPY A;  5LMU E;  4F6N A;  2Q8U A;  4F2J C;  4DV0 E;  4X65 E;  1EH7 A;  2UUA E;  2M9A A;  2YTE A;  1WXR A;  1HNX E;  2EOF A;  4R2Q A;  3BBG A;  5LLQ A;  5ADZ A;  3ADI A;  2V89 A;  3IWC A;  2MC5 A;  4R2S A;  1A1H A;  2R1F A;  2CTD A;  2K7I A;  4ZYH A;  2V85 A;  4RHB B;  2PRT A;  2E72 A;  2EPU A;  2FTX B;  2NA2 A;  3LLH A;  2GLI A;  2JPA A;  1TF3 A;  4BHB A;  5IV8 B;  3DF6 A;  2L2M A;  4X62 E;  1EKZ A;  1KYQ A;  2CSH A;  4F9B B;  2LV2 A;  3M99 B;  4WXC A;  4M2Z A;  1KJK A;  2EPM X;  2EM6 A;  5KL3 A;  4DKK A;  2EPO A;  1ZAA C;  1UHZ A;  1NEI A;  5F3W A;  1EH8 A;  1A1L A;  2YWQ A;  2JY9 A;  2WBU A;  2JOX A;  2N8X A;  2YSP A;  2RQL A;  4NXN E;  2VQE E;  5A6A A;  4BBY A;  3K6Q A;  3MHS C;  4F9C B;  4LFB E;  5A69 A;  2B7V A;  2EM4 A;  2UUC E;  4F6M A;  2EMI A;  5A6K A;  3AV0 A;  4Q28 A;  5A6B A;  2LO3 A;  2RSM A;  2JYA A;  1FKA E;  2CT1 A;  3TQM A;  1YYO A;  4WXD A;  3HPS A;  1PKP A;  2M4I A;  1G2F C;  2ELZ A;  1TF6 A;  3H09 A;  4JI2 E;  2L3J A;  4BHC A;  3ADG A;  1YUI A;  3AUZ A;  2EOJ A;  5AE1 A;  2F8B A;  1IBK E;  3T1H E;  2EN4 A;  2EN1 A;  2EMC A;  4GKJ E;  2LUQ A;  4F54 A;  3JTZ A;  4O24 A;  2J7J A;  2M7Q A;  1IQO A;  2EM2 A;  2EOS A;  1X6H A;  2MDG A;  5LL6 R;  3RMP A;  2JVA A;  4JI5 E;  1T39 A;  2RTX A;  1ZBQ A;  4M30 A;  2DLQ A;  2BBG A;  2YTG A;  4LTY A;  3F6G A;  2EN2 A;  1YSA C;  2GHF A;  2DMI A;  2VF1 A;  2NUG A;  2YTP A;  4JI4 E;  1BBO A;  4R2E A;  4O4K A;  4JI1 E;  4J8Z A;  2LUP B;  1UN6 B;  4X9J A;  2UU9 E;  2EOE A;  2KOU A;  5FLX C;  2WBS A;  2LE2 A;  2LTS A;  4BCA A;  2YPN A;  4WYQ B;  2YU5 A;  4L5N C;  2ADR A;  5BR8 E; 
#chains in the Genus database with same CATH homology
 2EL6 A;  2EM3 A;  2EMA A;  2YTN A;  2DRP A;  2EM9 A;  1P47 A;  2YSO A;  4R2C A;  2GLI A;  2JPA A;  2ENA A;  2EOH A;  2EM7 A;  1TF3 A;  2EN8 A;  4R2P A;  2LT7 A;  2YRM A;  2EN6 A;  2WBT A;  5KL4 A;  1X6F A;  1MEY C;  1RMD A;  2YTQ A;  2WCC 3;  2EOQ A;  2MKD A;  2CSH A;  2YTF A;  5KL5 A;  4GZN C;  2EOM A;  1JK1 A;  2LV2 A;  3M99 B;  2ELY A;  1KJK A;  2A25 A;  2EM6 A;  5KL3 A;  1A1J A;  1ZAA C;  4IS1 C;  2I13 A;  2EM8 A;  1A1K A;  2BB8 A;  1A1L A;  2DGC A;  2EPX A;  4FK5 C;  3EPK A;  1G2D C;  2WBU A;  1A1F A;  2EPP A;  2YSP A;  2EMY A;  1AAY A;  2YTO A;  1A1G A;  5KL2 A;  4R2A A;  5KL7 A;  2EMZ A;  2EMX A;  2RPC A;  2EP3 A;  3MHS C;  1UBD C;  2EM0 A;  2LCE A;  2YTI A;  2EML A;  3UK3 C;  2EM4 A;  2DLK A;  2YRH A;  4F6M A;  1A1I A;  2EMI A;  4R2D A;  2EQ3 A;  2YU8 A;  2EQ0 A;  2EMF A;  2LO3 A;  2EPZ A;  2EMK A;  1B69 A;  2HGH A;  2YRK A;  1JK2 A;  2CT1 A;  2EJ4 A;  2EPR A;  2EPA A;  2EE8 A;  1G2F C;  2ENH A;  2ELZ A;  1BB8 A;  2EOZ A;  3EPH A;  2D9H A;  1TF6 A;  2MKN A;  1NCS A;  1YUI A;  3EPJ A;  2EOO A;  2EOJ A;  1X6E A;  2EL5 A;  2EMG A;  4R2R A;  2EN4 A;  2EN1 A;  5KL6 A;  2EMC A;  4M9V C;  2YTD A;  1LLM C;  2ADR A;  2EMB A;  2EQ1 A;  3VHT B;  2VRD A;  2J7J A;  1F2I G;  1Z1B A;  2LVH A;  2EM2 A;  2YTJ A;  2EOS A;  1X6H A;  2MDG A;  1X5W A;  1X3C A;  4WSG A;  1ZR9 A;  2ENC A;  4F6N A;  2EOY A;  2DLQ A;  2YTG A;  4F2J C;  2NAB A;  2EN2 A;  2EN7 A;  2M9A A;  1YSA C;  2GHF A;  1YUJ A;  2YTE A;  2DMI A;  2YTP A;  2EOF A;  4R2Q A;  4R2E A;  1BBO A;  1DGC A;  2RSI A;  2EOI A;  2EL4 A;  1UN6 B;  4X9J A;  2EN3 A;  2EOE A;  2WBS A;  4IJD A;  3EPL A;  2EMW A;  4R2S A;  1A1H A;  2R1F A;  1WJP A;  2EOX A;  2CTD A;  2EMH A;  3MHH C;  1TN9 A;  2EPC A;  2JP9 A;  1ZU1 A;  2YU5 A;  2PRT A;  2E72 A;  2EM5 A;  2EOR A;  2EPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...