1YUJA

Solution nmr structure of the gaga factor/dna complex, 50 structures
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
54
structure length
54
Chain Sequence
b'PKAKRAKHPPGTEKPRSRSQSEQPATCPICYAVIRQSRNLRRHLELRHFAKPGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*GP*CP*CP*GP*AP*GP*AP*GP*TP*AP*C)-3')
publication title The solution structure of a specific GAGA factor-DNA complex reveals a modular binding mode.
pubmed doi rcsb
molecule tags Dna binding protein/dna
total genus 11
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 1996-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09237 GAGA GAGA factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1yujA00
2GLIA 2YSOA 2RPCA 2CT1A 2EOFA 2ELYA 2LO3A 2YTPA 2YRKA 1YUIA 4IS1C 2EM8A 2EM5A 2EN3A 2WBUA 1UBDC 2EE8A 2YTDA 1BB8A 2YTGA 2EL5A 4R2EA 2CTDA 5KL5A 2LT7A 2NABA 2DRPA 2WBTA 2EN4A 2EJ4A 2EM0A 2ENCA 2JPAA 1A1IA 1ZU1A 4FK5C 2EOOA 1Z1BA 2EL6A 1X6EA 2A25A 3EPLA 2PRTA 2CSHA 1X3CA 2LVHA 5KL3A 2WCC3 2EOZA 2EMXA 2EPAA 1A1GA 1MEYC 5KL4A 2BB8A 1A1FA 4R2QA 1TF6A 2DMIA 2YTIA 5KL7A 3UK3C 1A1LA 2EPPA 2EOIA 3EPHA 1X5WA 4F6MA 2EMIA 2ENHA 4R2AA 2EN2A 2RSIA 2EOMA 2GHFA 2DLKA 2EQ0A 2YSPA 2EMWA 1P47A 2EPZA 2EL4A 2I13A 1BBOA 1RMDA 2EOEA 2YTQA 2EOJA 1UN6B 2EQ1A 1F2IG 2EPRA 2EMCA 4F2JC 4F6NA 3EPKA 2EM2A 2YTNA 2EN7A 1A1KA 2D9HA 5KL2A 2EMAA 2EOHA 1A1HA 2EMBA 2EOQA 1G2FC 4GZNC 2EORA 2YRMA 1B69A 2ELZA 2EMKA 2JP9A 2EM7A 2EM6A 2EMZA 2YTOA 1AAYA 4R2DA 4R2PA 2EN6A 3MHSC 2M9AA 2EMLA 1JK2A 2DGCA 1ZAAC 2EN1A 1WJPA 1TF3A 2DLQA 4R2CA 3M99B 1YUJA 2R1FA 2EP3A 3EPJA 4IJDA 2EQ3A 3VHTB 2LV2A 2EN8A 2EOYA 1TN9A 2ADRA 2EPCA 2EPUA 2EM4A 2MDGA 1NCSA 3MHHC 2EMYA 1DGCA 4M9VC 2ENAA 2EMGA 2EM9A 1KJKA 1ZR9A 2E72A 2YTJA 2VRDA 2YTFA 2WBSA 1A1JA 2YRHA 1X6FA 2EMHA 2MKDA 1YSAC 2YTEA 2J7JA 2LCEA 2YU8A 2YU5A 1LLMC 5KL6A 2HGHA 2EPXA 2EMFA 4R2SA 2MKNA 2EOXA 4R2RA 1JK1A 4X9JA 4WSGA 1G2DC 2EOSA 2EM3A 1X6HA
chains in the Genus database with same CATH superfamily
4O4KA 2GLIA 5A6BD 2CT1A 2LO3A 2ELYA 2YTPA 2JOBA 2YRKA 1HNZE 2EM8A 5LLQA 1N34E 2JVAA 5A6JA 2EN3A 4X62E 1UBDC 2YTGA 4RHBB 5KL5A 2WZOA 2DRPA 4AQYE 2IHR1 4TUIA 3AUZA 4KZSA 4LF5E 2I9IA 2FTXB 1X6EA 1QU6A 2F8BA 5KL3A 5DNYA 2YPNA 2DMYA 2HJJA 4KHPE 5IV8B 4BBYA 4NXNE 4DR4E 3DF6A 4HTGA 1A1FA 3THOB 4R2QA 2VE7C 2KONA 2N3GA 2DMIA 4BCAA 3UK3C 2MDRA 3BF2A 4JI7E 4F6MA 2ENHA 4LF7E 4BC9A 4B3TE 2DLKA 2GPIA 4P78A 1IQOA 1J26A 4Q35B 2NUFA 4GKKE 2LUPB 1P47A 3J7AG 2NUEA 1BBOA 1MGTA 2UUCE 1IBKE 2EMCA 4F6NA 2N8XA 2G7HA 2EMAA 5ADZA 2EMBA 1NEIA 2M4IA 1WXRA 4DR2E 4KWYA 2EM6A 2EMZA 4DR7E 4L8NA 2YT4A 1GTKA 2LBSB 2L8TA 2EN6A 2DSYA 1JK2A 1N36E 1BBGA 2R76A 1WJPA 2M1SA 4WFTA 1YUJA 3J81C 2L2MA 2R1FA 3ADGA 2LE2A 3EPJA 1KYQA 4F9AB 1NCSA 4WSPA 1T4OA 2EWLA 2JXPA 1KJKA 2H36X 4R8OA 1ZR9A 1STUA 4F9BB 4BMJA 2FV4B 4DR5E 5IT9C 2WBSA 3EQ1A 1X6FA 1T38A 2UU9E 2J7JA 2LCEA 2YU8A 1XMOE 1LLMC 5KL6A 2EPXA 4NHRA 5A2QC 3HTXA 2EOXA 1JK1A 4JI5E 3VYXA 1HR0E 3C4TA 2EM3A 1X6HA 1L4SA 2YSOA 2RPCA 2EOFA 4DV7E 4I8OA 2JR1A 4JV5E 1BB8A 3JAMC 4LFCE 1O0WA 4R03A 4JI4E 2EN4A 1YPNA 2EM0A 3C4BA 2E1MA 4WXDA 4LFBE 4FK5C 2EL6A 1SFEA 3ADJA 2LTSA 1HNXE 4DUYE 3HPZA 2N3HA 2EOZA 2LRSA 2EPAA 5KL4A 3FIGA 4DV1E 2L33A 4X64E 4J8ZA 4JI0E 2EPPA 1UHZA 1X5WA 3F6HA 3T1YE 1X48A 2EN2A 2DB2A 1ZBTA 2EQ0A 2YSPA 1N33E 2LUQA 5BR8E 2EPZA 2LTRA 4NZVA 4O43A 2V87A 1X47A 4DR3E 3L00A 5A6BA 2EN7A 1HNWE 4O5GA 2EOQA 4GZNC 4DV4E 2EPOA 5AE1A 2EMKA 2K4VA 2JP9A 1AAYA 3OMLA 3DJWA 3ADLA 3ECRA 4R2PA 2L3CA 3MHSC 2DGCA 2RSMA 4WPYA 2L92A 5AASA 3KZYA 4P7DA 2DLQA 4R2CA 4JYAE 4B3RE 3M99B 4L5NC 4IJDA 2EQ3A 2MC5A 3VHTB 2UUBE 4RH8A 2Q8UA 1WHNA 2EMYA 4BS9A 1DGCA 5CFFE 4M9VC 2ENAA 2EM9A 2E72A 2YTJA 1YYWA 2YRHA 2YTEA 3F6GA 2EPLX 2HGHA 2EMFA 3KZZA 2V86A 4R2RA 1N3GA 2UXBE 3BBGA 5IWAE 4BHCA 2EOSA 1PJTA 4X65E 1T4LB 3JTZA 1YYKA 1YUIA 4IS1C 1DI2A 4JI8E 4LU9A 4BC7A 2L2NA 2EM5A 3ADIA 2WBUA 1IMUA 3LLHA 4LTYA 1PJSA 2EL5A 2ODRC 4R2EA 2CTDA 3VYYA 2EPNA 2LT7A 5AE2A 2NABA 1RQ0A 1FKAE 1IBLE 4MLQA 2ENCA 2JPAA 3P1XA 1PJQA 1ZU1A 2VQFE 2EOOA 4NXME 1SR9A 2LMZA 1PDAA 4DMIA 1GQEA 1X3CA 2CSHA 2WCC3 3K6QA 2V8QB 3C6KA 3J80C 2BB8A 5F3WA 5LMUE 4JI6E 4LFAE 4JI1E 1TF6A 5KL7A 2YTIA 2V89A 2RS6A 1A1LA 4DV6E 4M2ZA 1XMQE 4O24A 4R2AA 2FGGA 1IBME 2EOMA 4ZYGA 3VK6A 1RMDA 2UXDE 2EOEA 1UN6B 4ZYHA 4LF6E 2EQ1A 2V85A 4F2JC 3ZOQB 2EM2A 1GZ6A 2LJHA 1ZBQA 3T1HE 2D9HA 3OTOE 1G2FC 5A6AA 4WX9A 3HXLA 2RQLA 4MLVA 4DUZE 2EM7A 4F54A 4R2DA 4Q28A 2EMLA 4M30A 4ZYDA 1ZAAC 2EN1A 3BGHA 5AE3A 3HPSA 2L3JA 3HQ1A 1TF3A 2EPKX 3J7Yp 4F9CB 1DQ3A 4WXCA 2ODRD 2LV2A 2ZM6E 1N32E 4OOGC 2EPCA 2EPUA 2EM4A 2CPNA 3MHHC 2B9DA 1WHQA 2JYAA 1J5EE 2EMGA 4LF4E 2YTFA 2EMHA 1YSAC 4YHHE 2YZTA 4B3ME 4DV2E 3RMPA 2RTXA 3IWBA 1X49A 4N4RB 1YZ9A 2B3TB 2L6MA 4TUGA 1EH8A 4WSGA 1G2DC 2M7QA 2JWOA 4R2SA 3AV0A 2B7TA 2E5LE 4OX9E 1T39A 3JU0A 2JOXA 2KOUA 1IQSA 2HC5A 4DR1E 1FJGE 2KHXA 1YYOA 4ZYEA 2EE8A 2YTDA 1UILA 2B7VA 2WBTA 5AC4A 2EJ4A 1A1IA 5AC5A 1EH7A 2HHHE 1WRJA 2DIXA 1Z1BA 4YY3E 5A6KA 4GEQB 1EH6A 4HEIA 3C6MA 5TSEA 2A25A 2EPMX 2V88A 4WYQB 2LVHA 3EPLA 2JY9A 2PRTA 1I94E 2EMXA 2VQEE 1A1GA 1MEYC 4B3SE 3QG5C 3H09A 1PKPA 2EOIA 3EPHA 1RC7A 2EMIA 2F4VE 2RSIA 2GHFA 2EMWA 2EL4A 2I13A 4GKJE 1T4NA 1XNQE 4JI2E 3TQMA 5A69A 2YTQA 2EOJA 4BHBA 1F2IG 2EPRA 1XNRE 4K0KE 1AH5A 3EPKA 3IWDA 2K7IA 2YTNA 1A1KA 5KL2A 2EOHA 4DKKA 1A1HA 2EORA 4M0VA 2YRMA 1B69A 4LF9E 2ELZA 4DV3E 2UXCE 2YTOA 3BIDA 1QNTA 2M9AA 1YFHA 2YWQA 4X66E 3MSWA 4DV0E 5FLXC 2EP3A 5T6JA 2L2KB 5LL6R 2EN8A 2EOYA 4DV5E 1TN9A 4LF8E 2ADRA 2UUAE 2MDGA 2RS7A 3LMLA 3THNA 2EZ6A 5LMNE 1EKZA 3KWRA 2VRDA 1A1JA 5IXMB 2BBGA 2MKDA 4X8WA 2NUGA 2YU5A 2MC6A 2NA2A 2VF1A 4JI3E 4DR6E 3IWCA 2MKNA 2LJUA 4X9JA 2V83A
chains in the Genus database with same CATH topology
2GLIA 2YSOA 2RPCA 2CT1A 2EOFA 2ELYA 2LO3A 2YTPA 2YRKA 1YUIA 4IS1C 2EM8A 2EM5A 2EN3A 2WBUA 1UBDC 2EE8A 2YTDA 1BB8A 2YTGA 2EL5A 4R2EA 2CTDA 5KL5A 2LT7A 2NABA 2DRPA 2WBTA 2EN4A 2EJ4A 2EM0A 2ENCA 2JPAA 1A1IA 1ZU1A 4FK5C 2EOOA 1Z1BA 2EL6A 1X6EA 2A25A 3EPLA 2PRTA 2CSHA 1X3CA 2LVHA 5KL3A 2WCC3 2EOZA 2EMXA 2EPAA 1A1GA 1MEYC 5KL4A 2BB8A 1A1FA 4R2QA 1TF6A 2DMIA 2YTIA 5KL7A 3UK3C 1A1LA 2EPPA 2EOIA 3EPHA 1X5WA 4F6MA 2EMIA 2ENHA 4R2AA 2EN2A 2RSIA 2EOMA 2GHFA 2DLKA 2EQ0A 2YSPA 2EMWA 1P47A 2EPZA 2EL4A 2I13A 1BBOA 1RMDA 2EOEA 2YTQA 2EOJA 1UN6B 2EQ1A 1F2IG 2EPRA 2EMCA 4F2JC 4F6NA 3EPKA 2EM2A 2YTNA 2EN7A 1A1KA 2D9HA 5KL2A 2EMAA 2EOHA 1A1HA 2EMBA 2EOQA 1G2FC 4GZNC 2EORA 2YRMA 1B69A 2ELZA 2EMKA 2JP9A 2EM7A 2EM6A 2EMZA 2YTOA 1AAYA 4R2DA 4R2PA 2EN6A 3MHSC 2M9AA 2EMLA 1JK2A 2DGCA 1ZAAC 2EN1A 1WJPA 1TF3A 2DLQA 4R2CA 3M99B 1YUJA 2R1FA 2EP3A 3EPJA 4IJDA 2EQ3A 3VHTB 2LV2A 2EN8A 2EOYA 1TN9A 2ADRA 2EPCA 2EPUA 2EM4A 2MDGA 1NCSA 3MHHC 2EMYA 1DGCA 4M9VC 2ENAA 2EMGA 2EM9A 1KJKA 1ZR9A 2E72A 2YTJA 2VRDA 2YTFA 2WBSA 1A1JA 2YRHA 1X6FA 2EMHA 2MKDA 1YSAC 2YTEA 2J7JA 2LCEA 2YU8A 2YU5A 1LLMC 5KL6A 2HGHA 2EPXA 2EMFA 4R2SA 2MKNA 2EOXA 4R2RA 1JK1A 4X9JA 4WSGA 1G2DC 2EOSA 2EM3A 1X6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GLI A;  2YSO A;  2RPC A;  2CT1 A;  2EOF A;  2ELY A;  2LO3 A;  2YTP A;  2YRK A;  1YUI A;  4IS1 C;  2EM8 A;  2EM5 A;  2EN3 A;  2WBU A;  1UBD C;  2EE8 A;  2YTD A;  1BB8 A;  2YTG A;  2EL5 A;  4R2E A;  2CTD A;  5KL5 A;  2LT7 A;  2NAB A;  2DRP A;  2WBT A;  2EN4 A;  2EJ4 A;  2EM0 A;  2ENC A;  2JPA A;  1A1I A;  1ZU1 A;  4FK5 C;  2EOO A;  1Z1B A;  2EL6 A;  1X6E A;  2A25 A;  3EPL A;  2PRT A;  2CSH A;  1X3C A;  2LVH A;  5KL3 A;  2WCC 3;  2EOZ A;  2EMX A;  2EPA A;  1A1G A;  1MEY C;  5KL4 A;  2BB8 A;  1A1F A;  4R2Q A;  1TF6 A;  2DMI A;  2YTI A;  5KL7 A;  3UK3 C;  1A1L A;  2EPP A;  2EOI A;  3EPH A;  1X5W A;  4F6M A;  2EMI A;  2ENH A;  4R2A A;  2EN2 A;  2RSI A;  2EOM A;  2GHF A;  2DLK A;  2EQ0 A;  2YSP A;  2EMW A;  1P47 A;  2EPZ A;  2EL4 A;  2I13 A;  1BBO A;  1RMD A;  2EOE A;  2YTQ A;  2EOJ A;  1UN6 B;  2EQ1 A;  1F2I G;  2EPR A;  2EMC A;  4F2J C;  4F6N A;  3EPK A;  2EM2 A;  2YTN A;  2EN7 A;  1A1K A;  2D9H A;  5KL2 A;  2EMA A;  2EOH A;  1A1H A;  2EMB A;  2EOQ A;  1G2F C;  4GZN C;  2EOR A;  2YRM A;  1B69 A;  2ELZ A;  2EMK A;  2JP9 A;  2EM7 A;  2EM6 A;  2EMZ A;  2YTO A;  1AAY A;  4R2D A;  4R2P A;  2EN6 A;  3MHS C;  2M9A A;  2EML A;  1JK2 A;  2DGC A;  1ZAA C;  2EN1 A;  1WJP A;  1TF3 A;  2DLQ A;  4R2C A;  3M99 B;  1YUJ A;  2R1F A;  2EP3 A;  3EPJ A;  4IJD A;  2EQ3 A;  3VHT B;  2LV2 A;  2EN8 A;  2EOY A;  1TN9 A;  2ADR A;  2EPC A;  2EPU A;  2EM4 A;  2MDG A;  1NCS A;  3MHH C;  2EMY A;  1DGC A;  4M9V C;  2ENA A;  2EMG A;  2EM9 A;  1KJK A;  1ZR9 A;  2E72 A;  2YTJ A;  2VRD A;  2YTF A;  2WBS A;  1A1J A;  2YRH A;  1X6F A;  2EMH A;  2MKD A;  1YSA C;  2YTE A;  2J7J A;  2LCE A;  2YU8 A;  2YU5 A;  1LLM C;  5KL6 A;  2HGH A;  2EPX A;  2EMF A;  4R2S A;  2MKN A;  2EOX A;  4R2R A;  1JK1 A;  4X9J A;  4WSG A;  1G2D C;  2EOS A;  2EM3 A;  1X6H A; 
#chains in the Genus database with same CATH topology
 4O4K A;  2GLI A;  5A6B D;  2CT1 A;  2LO3 A;  2ELY A;  2YTP A;  2JOB A;  2YRK A;  1HNZ E;  2EM8 A;  5LLQ A;  1N34 E;  2JVA A;  5A6J A;  2EN3 A;  4X62 E;  1UBD C;  2YTG A;  4RHB B;  5KL5 A;  2WZO A;  2DRP A;  4AQY E;  2IHR 1;  4TUI A;  3AUZ A;  4KZS A;  4LF5 E;  2I9I A;  2FTX B;  1X6E A;  1QU6 A;  2F8B A;  5KL3 A;  5DNY A;  2YPN A;  2DMY A;  2HJJ A;  4KHP E;  5IV8 B;  4BBY A;  4NXN E;  4DR4 E;  3DF6 A;  4HTG A;  1A1F A;  3THO B;  4R2Q A;  2VE7 C;  2KON A;  2N3G A;  2DMI A;  4BCA A;  3UK3 C;  2MDR A;  3BF2 A;  4JI7 E;  4F6M A;  2ENH A;  4LF7 E;  4BC9 A;  4B3T E;  2DLK A;  2GPI A;  4P78 A;  1IQO A;  1J26 A;  4Q35 B;  2NUF A;  4GKK E;  2LUP B;  1P47 A;  3J7A G;  2NUE A;  1BBO A;  1MGT A;  2UUC E;  1IBK E;  2EMC A;  4F6N A;  2N8X A;  2G7H A;  2EMA A;  5ADZ A;  2EMB A;  1NEI A;  2M4I A;  1WXR A;  4DR2 E;  4KWY A;  2EM6 A;  2EMZ A;  4DR7 E;  4L8N A;  2YT4 A;  1GTK A;  2LBS B;  2L8T A;  2EN6 A;  2DSY A;  1JK2 A;  1N36 E;  1BBG A;  2R76 A;  1WJP A;  2M1S A;  4WFT A;  1YUJ A;  3J81 C;  2L2M A;  2R1F A;  3ADG A;  2LE2 A;  3EPJ A;  1KYQ A;  4F9A B;  1NCS A;  4WSP A;  1T4O A;  2EWL A;  2JXP A;  1KJK A;  2H36 X;  4R8O A;  1ZR9 A;  1STU A;  4F9B B;  4BMJ A;  2FV4 B;  4DR5 E;  5IT9 C;  2WBS A;  3EQ1 A;  1X6F A;  1T38 A;  2UU9 E;  2J7J A;  2LCE A;  2YU8 A;  1XMO E;  1LLM C;  5KL6 A;  2EPX A;  4NHR A;  5A2Q C;  3HTX A;  2EOX A;  1JK1 A;  4JI5 E;  3VYX A;  1HR0 E;  3C4T A;  2EM3 A;  1X6H A;  1L4S A;  2YSO A;  2RPC A;  2EOF A;  4DV7 E;  4I8O A;  2JR1 A;  4JV5 E;  1BB8 A;  3JAM C;  4LFC E;  1O0W A;  4R03 A;  4JI4 E;  2EN4 A;  1YPN A;  2EM0 A;  3C4B A;  2E1M A;  4WXD A;  4LFB E;  4FK5 C;  2EL6 A;  1SFE A;  3ADJ A;  2LTS A;  1HNX E;  4DUY E;  3HPZ A;  2N3H A;  2EOZ A;  2LRS A;  2EPA A;  5KL4 A;  3FIG A;  4DV1 E;  2L33 A;  4X64 E;  4J8Z A;  4JI0 E;  2EPP A;  1UHZ A;  1X5W A;  3F6H A;  3T1Y E;  1X48 A;  2EN2 A;  2DB2 A;  1ZBT A;  2EQ0 A;  2YSP A;  1N33 E;  2LUQ A;  5BR8 E;  2EPZ A;  2LTR A;  4NZV A;  4O43 A;  2V87 A;  1X47 A;  4DR3 E;  3L00 A;  5A6B A;  2EN7 A;  1HNW E;  4O5G A;  2EOQ A;  4GZN C;  4DV4 E;  2EPO A;  5AE1 A;  2EMK A;  2K4V A;  2JP9 A;  1AAY A;  3OML A;  3DJW A;  3ADL A;  3ECR A;  4R2P A;  2L3C A;  3MHS C;  2DGC A;  2RSM A;  4WPY A;  2L92 A;  5AAS A;  3KZY A;  4P7D A;  2DLQ A;  4R2C A;  4JYA E;  4B3R E;  3M99 B;  4L5N C;  4IJD A;  2EQ3 A;  2MC5 A;  3VHT B;  2UUB E;  4RH8 A;  2Q8U A;  1WHN A;  2EMY A;  4BS9 A;  1DGC A;  5CFF E;  4M9V C;  2ENA A;  2EM9 A;  2E72 A;  2YTJ A;  1YYW A;  2YRH A;  2YTE A;  3F6G A;  2EPL X;  2HGH A;  2EMF A;  3KZZ A;  2V86 A;  4R2R A;  1N3G A;  2UXB E;  3BBG A;  5IWA E;  4BHC A;  2EOS A;  1PJT A;  4X65 E;  1T4L B;  3JTZ A;  1YYK A;  1YUI A;  4IS1 C;  1DI2 A;  4JI8 E;  4LU9 A;  4BC7 A;  2L2N A;  2EM5 A;  3ADI A;  2WBU A;  1IMU A;  3LLH A;  4LTY A;  1PJS A;  2EL5 A;  2ODR C;  4R2E A;  2CTD A;  3VYY A;  2EPN A;  2LT7 A;  5AE2 A;  2NAB A;  1RQ0 A;  1FKA E;  1IBL E;  4MLQ A;  2ENC A;  2JPA A;  3P1X A;  1PJQ A;  1ZU1 A;  2VQF E;  2EOO A;  4NXM E;  1SR9 A;  2LMZ A;  1PDA A;  4DMI A;  1GQE A;  1X3C A;  2CSH A;  2WCC 3;  3K6Q A;  2V8Q B;  3C6K A;  3J80 C;  2BB8 A;  5F3W A;  5LMU E;  4JI6 E;  4LFA E;  4JI1 E;  1TF6 A;  5KL7 A;  2YTI A;  2V89 A;  2RS6 A;  1A1L A;  4DV6 E;  4M2Z A;  1XMQ E;  4O24 A;  4R2A A;  2FGG A;  1IBM E;  2EOM A;  4ZYG A;  3VK6 A;  1RMD A;  2UXD E;  2EOE A;  1UN6 B;  4ZYH A;  4LF6 E;  2EQ1 A;  2V85 A;  4F2J C;  3ZOQ B;  2EM2 A;  1GZ6 A;  2LJH A;  1ZBQ A;  3T1H E;  2D9H A;  3OTO E;  1G2F C;  5A6A A;  4WX9 A;  3HXL A;  2RQL A;  4MLV A;  4DUZ E;  2EM7 A;  4F54 A;  4R2D A;  4Q28 A;  2EML A;  4M30 A;  4ZYD A;  1ZAA C;  2EN1 A;  3BGH A;  5AE3 A;  3HPS A;  2L3J A;  3HQ1 A;  1TF3 A;  2EPK X;  3J7Y p;  4F9C B;  1DQ3 A;  4WXC A;  2ODR D;  2LV2 A;  2ZM6 E;  1N32 E;  4OOG C;  2EPC A;  2EPU A;  2EM4 A;  2CPN A;  3MHH C;  2B9D A;  1WHQ A;  2JYA A;  1J5E E;  2EMG A;  4LF4 E;  2YTF A;  2EMH A;  1YSA C;  4YHH E;  2YZT A;  4B3M E;  4DV2 E;  3RMP A;  2RTX A;  3IWB A;  1X49 A;  4N4R B;  1YZ9 A;  2B3T B;  2L6M A;  4TUG A;  1EH8 A;  4WSG A;  1G2D C;  2M7Q A;  2JWO A;  4R2S A;  3AV0 A;  2B7T A;  2E5L E;  4OX9 E;  1T39 A;  3JU0 A;  2JOX A;  2KOU A;  1IQS A;  2HC5 A;  4DR1 E;  1FJG E;  2KHX A;  1YYO A;  4ZYE A;  2EE8 A;  2YTD A;  1UIL A;  2B7V A;  2WBT A;  5AC4 A;  2EJ4 A;  1A1I A;  5AC5 A;  1EH7 A;  2HHH E;  1WRJ A;  2DIX A;  1Z1B A;  4YY3 E;  5A6K A;  4GEQ B;  1EH6 A;  4HEI A;  3C6M A;  5TSE A;  2A25 A;  2EPM X;  2V88 A;  4WYQ B;  2LVH A;  3EPL A;  2JY9 A;  2PRT A;  1I94 E;  2EMX A;  2VQE E;  1A1G A;  1MEY C;  4B3S E;  3QG5 C;  3H09 A;  1PKP A;  2EOI A;  3EPH A;  1RC7 A;  2EMI A;  2F4V E;  2RSI A;  2GHF A;  2EMW A;  2EL4 A;  2I13 A;  4GKJ E;  1T4N A;  1XNQ E;  4JI2 E;  3TQM A;  5A69 A;  2YTQ A;  2EOJ A;  4BHB A;  1F2I G;  2EPR A;  1XNR E;  4K0K E;  1AH5 A;  3EPK A;  3IWD A;  2K7I A;  2YTN A;  1A1K A;  5KL2 A;  2EOH A;  4DKK A;  1A1H A;  2EOR A;  4M0V A;  2YRM A;  1B69 A;  4LF9 E;  2ELZ A;  4DV3 E;  2UXC E;  2YTO A;  3BID A;  1QNT A;  2M9A A;  1YFH A;  2YWQ A;  4X66 E;  3MSW A;  4DV0 E;  5FLX C;  2EP3 A;  5T6J A;  2L2K B;  5LL6 R;  2EN8 A;  2EOY A;  4DV5 E;  1TN9 A;  4LF8 E;  2ADR A;  2UUA E;  2MDG A;  2RS7 A;  3LML A;  3THN A;  2EZ6 A;  5LMN E;  1EKZ A;  3KWR A;  2VRD A;  1A1J A;  5IXM B;  2BBG A;  2MKD A;  4X8W A;  2NUG A;  2YU5 A;  2MC6 A;  2NA2 A;  2VF1 A;  4JI3 E;  4DR6 E;  3IWC A;  2MKN A;  2LJU A;  4X9J A;  2V83 A; 
#chains in the Genus database with same CATH homology
 2GLI A;  2YSO A;  2RPC A;  2CT1 A;  2EOF A;  2ELY A;  2LO3 A;  2YTP A;  2YRK A;  1YUI A;  4IS1 C;  2EM8 A;  2EM5 A;  2EN3 A;  2WBU A;  1UBD C;  2EE8 A;  2YTD A;  1BB8 A;  2YTG A;  2EL5 A;  4R2E A;  2CTD A;  5KL5 A;  2LT7 A;  2NAB A;  2DRP A;  2WBT A;  2EN4 A;  2EJ4 A;  2EM0 A;  2ENC A;  2JPA A;  1A1I A;  1ZU1 A;  4FK5 C;  2EOO A;  1Z1B A;  2EL6 A;  1X6E A;  2A25 A;  3EPL A;  2PRT A;  2CSH A;  1X3C A;  2LVH A;  5KL3 A;  2WCC 3;  2EOZ A;  2EMX A;  2EPA A;  1A1G A;  1MEY C;  5KL4 A;  2BB8 A;  1A1F A;  4R2Q A;  1TF6 A;  2DMI A;  2YTI A;  5KL7 A;  3UK3 C;  1A1L A;  2EPP A;  2EOI A;  3EPH A;  1X5W A;  4F6M A;  2EMI A;  2ENH A;  4R2A A;  2EN2 A;  2RSI A;  2EOM A;  2GHF A;  2DLK A;  2EQ0 A;  2YSP A;  2EMW A;  1P47 A;  2EPZ A;  2EL4 A;  2I13 A;  1BBO A;  1RMD A;  2EOE A;  2YTQ A;  2EOJ A;  1UN6 B;  2EQ1 A;  1F2I G;  2EPR A;  2EMC A;  4F2J C;  4F6N A;  3EPK A;  2EM2 A;  2YTN A;  2EN7 A;  1A1K A;  2D9H A;  5KL2 A;  2EMA A;  2EOH A;  1A1H A;  2EMB A;  2EOQ A;  1G2F C;  4GZN C;  2EOR A;  2YRM A;  1B69 A;  2ELZ A;  2EMK A;  2JP9 A;  2EM7 A;  2EM6 A;  2EMZ A;  2YTO A;  1AAY A;  4R2D A;  4R2P A;  2EN6 A;  3MHS C;  2M9A A;  2EML A;  1JK2 A;  2DGC A;  1ZAA C;  2EN1 A;  1WJP A;  1TF3 A;  2DLQ A;  4R2C A;  3M99 B;  1YUJ A;  2R1F A;  2EP3 A;  3EPJ A;  4IJD A;  2EQ3 A;  3VHT B;  2LV2 A;  2EN8 A;  2EOY A;  1TN9 A;  2ADR A;  2EPC A;  2EPU A;  2EM4 A;  2MDG A;  1NCS A;  3MHH C;  2EMY A;  1DGC A;  4M9V C;  2ENA A;  2EMG A;  2EM9 A;  1KJK A;  1ZR9 A;  2E72 A;  2YTJ A;  2VRD A;  2YTF A;  2WBS A;  1A1J A;  2YRH A;  1X6F A;  2EMH A;  2MKD A;  1YSA C;  2YTE A;  2J7J A;  2LCE A;  2YU8 A;  2YU5 A;  1LLM C;  5KL6 A;  2HGH A;  2EPX A;  2EMF A;  4R2S A;  2MKN A;  2EOX A;  4R2R A;  1JK1 A;  4X9J A;  4WSG A;  1G2D C;  2EOS A;  2EM3 A;  1X6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...