2V86A

Crystal structure of rag2-phd finger in complex with h3r2me2ak4me3 peptide
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
82
structure length
82
Chain Sequence
GPLGSPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQIARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Plant Homeodomain Finger of Rag2 Recognizes Histone H3 Methylated at Both Lysine-4 and Arginine-2.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords VDJ RECOMBINATION-ACTIVATING PROTEIN 2
total genus 16
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.290 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2v86A01
2V87A 2V88A 2JWOA 2V86A 2V83A 2V85A 2V89A
chains in the Genus database with same CATH superfamily
2N3HA 1G2DC 1X48A 2BBGA 2EMYA 2EQ0A 2JWOA 2L2MA 3HPZA 3OMLA 2NUGA 2V85A 4B3SE 1NEIA 4X8WA 2EPKX 3J81C 5A6JA 1YYKA 2VF1A 2EPXA 5AASA 2EE8A 2YRMA 4R2EA 1ZBQA 1FKAE 4R8OA 2HGHA 2EOMA 2EMKA 2UXDE 2YT4A 2MDRA 5F3WA 2I13A 1WHNA 2UUAE 1LLMC 2JOXA 5AE2A 2EOYA 1HR0E 2N8XA 3P1XA 4LFBE 4N4RB 4DV5E 2GLIA 2EMCA 2MKDA 4NXNE 2EM0A 3MHHC 3QG5C 2EMWA 4WFTA 1EH6A 4O4KA 2EQ1A 2B7TA 1AAYA 4JI0E 2MKNA 4F6NA 4LF7E 2RS7A 2YTQA 4X64E 4GKKE 2V89A 4X62E 4TUGA 2MC5A 4KHPE 2EMXA 3DJWA 1N36E 4DKKA 1WHQA 1PJTA 4OOGC 1IMUA 2KONA 4I8OA 3TQMA 5AE1A 2E1MA 4DMIA 2EMAA 1X49A 1A1IA 3ZOQB 2H36X 2YSPA 5A6BD 4Q28A 1P47A 2EOQA 2LTRA 2UUCE 4LF6E 2EN2A 4LTYA 3T1YE 2DB2A 1T38A 3L00A 2LV2A 2V83A 5LMUE 2YRKA 1G2FC 2DSYA 1IBME 3HQ1A 2CSHA 1TF6A 2EL6A 3BGHA 4DV7E 2EPLX 2DRPA 2EM4A 2EZ6A 2EL5A 1T4NA 4WYQB 2EN1A 2YTGA 1ZR9A 4NZVA 2EQ3A 4JI5E 2FTXB 1RC7A 1T39A 3VYYA 4WXDA 3AV0A 2VRDA 2CT1A 2EWLA 2UXCE 3C6KA 3EPKA 3ADLA 2NABA 2EOZA 2EN7A 2LJHA 2YU8A 4NHRA 5TSEA 4BS9A 4JI2E 4P7DA 2EP3A 2L33A 1IQSA 2EMIA 3HTXA 3T1HE 1A1LA 2LUQA 2L6MA 2L8TA 4DUZE 1STUA 1ZBTA 2FV4B 4IJDA 1QU6A 4M2ZA 4DR6E 4DV1E 3IWBA 5KL2A 5KL5A 1A1HA 2EPPA 2B9DA 2EPRA 1PKPA 2EN3A 5LLQA 4WSGA 2V87A 2YTOA 4WSPA 2G7HA 3VHTB 2M1SA 4RH8A 2RQLA 5KL6A 3EPLA 3DF6A 2WBUA 5A69A 3C4TA 1SFEA 2L3CA 2EJ4A 1DI2A 2DLKA 2EM9A 1EKZA 1HNZE 2BB8A 1YZ9A 4LFCE 2EPAA 2VQFE 4BBYA 5KL4A 4O5GA 4JYAE 1X6FA 1SR9A 2EN8A 2JOBA 2GPIA 4Q35B 1YFHA 2V86A 3K6QA 3HPSA 4JI3E 2EL4A 2LE2A 4DV2E 1JK2A 2WZOA 2EM5A 4M9VC 5IXMB 3EPHA 2UXBE 3M99B 2ZM6E 2V8QB 1A1GA 1A1KA 2YRHA 4BHBA 3ADIA 1EH8A 1IQOA 1B69A 1IBLE 4L5NC 2RSIA 5IWAE 2IHR1 4R2SA 5A6AA 3F6GA 3EQ1A 1TN9A 4TUIA 4OX9E 4ZYDA 2JR1A 2R1FA 1PDAA 3IWCA 3EPJA 1YYWA 5AE3A 2DGCA 1JK1A 4LF5E 3HXLA 2YZTA 2LTSA 1WXRA 1N34E 1UBDC 1WRJA 4LF4E 1EH7A 1GQEA 2LJUA 4GZNC 4BC9A 4JV5E 2Q8UA 2ENAA 2EPUA 4F2JC 2EM3A 2EN6A 4WX9A 2LBSB 3VK6A 1MGTA 4F6MA 2LUPB 3BIDA 2EOXA 2N3GA 2K7IA 2LMZA 3JTZA 1TF3A 1YYOA 2EPOA 3MHSC 1DGCA 1GZ6A 2A25A 4BCAA 3UK3C 2K4VA 4HTGA 2EM6A 1A1FA 5KL7A 2EORA 4BC7A 3JU0A 4HEIA 4R03A 1XNRE 2EM8A 2YPNA 4R2RA 2EMBA 3AUZA 4MLVA 2CTDA 1X47A 4DR5E 3RMPA 3FIGA 3J7AG 4M30A 4YY3E 2YTEA 3F6HA 2JY9A 4JI7E 4X66E 2JYAA 2NUEA 1X6HA 2M9AA 5BR8E 2EM7A 2YTDA 2D9HA 4FK5C 5DNYA 2NUFA 2CPNA 2RSMA 2EPCA 2HHHE 4JI1E 2L2NA 3KZYA 4M0VA 4B3ME 1N32E 1YUIA 1XMQE 1MEYC 2R76A 1X5WA 4DR2E 1HNWE 1J5EE 4F9BB 1PJSA 4DV4E 5CFFE 1YPNA 2I9IA 4ZYEA 2ELYA 1UN6B 1KYQA 2ENCA 2YTPA 4K0KE 2ELZA 2F8BA 3C4BA 3IWDA 1WJPA 1FJGE 2V88A 2ENHA 4B3RE 3LLHA 2UUBE 4IS1C 1DQ3A 5AC4A 1O0WA 4R2PA 5IV8B 1XNQE 4RHBB 4AQYE 3VYXA 4L8NA 4DR1E 4X65E 1BBOA 3J80C 3MSWA 2YTIA 5KL3A 4LF8E 2YTNA 3LMLA 2EMZA 2EPZA 2B7VA 3JAMC 5ADZA 1RQ0A 2VE7C 1X3CA 4LFAE 1QNTA 2EOJA 2UU9E 1I94E 3THNA 4DV6E 4JI8E 1RMDA 2MC6A 2HJJA 2DIXA 2EMFA 2EOHA 1N33E 2EMHA 2EMLA 1HNXE 1PJQA 2YTJA 2WBSA 2RPCA 4LU9A 2L92A 2HC5A 1T4LB 2EOFA 1ZAAC 4YHHE 2GHFA 3BF2A 5AC5A 5A6BA 4DR4E 5LL6R 4JI6E 3ADGA 2VQEE 3OTOE 2EMGA 2L2KB 4DUYE 1KJKA 1UILA 3KWRA 2E72A 2DMYA 2ADRA 3C6MA 2KHXA 3H09A 1A1JA 2E5LE 3THOB 2L3JA 2NA2A 4DR3E 5A2QC 2LVHA 2RS6A 2MDGA 2YTFA 1N3GA 1BB8A 4KZSA 2DMIA 1UHZA 4F9CB 2WCC3 2EOSA 2YSOA 1XMOE 2M4IA 2WBTA 4R2QA 2FGGA 2EPNA 4MLQA 1F2IG 3ADJA 2DLQA 4R2AA 4B3TE 1IBKE 1T4OA 4GEQB 2EM2A 2EOOA 2EPMX 4KWYA 4X9JA 4R2DA 2LT7A 2JXPA 1NCSA 1YSAC 1YUJA 2LRSA 1Z1BA 2JP9A 4BHCA 1X6EA 2PRTA 2J7JA 4NXME 2F4VE 3J7Yp 3BBGA 4O43A 4BMJA 2EN4A 2YU5A 2KOUA 5IT9C 2ODRD 1GTKA 2EOIA 4JI4E 5FLXC 4F9AB 5LMNE 2RTXA 2LCEA 4WXCA 4F54A 2EOEA 2JVAA 4DV0E 2B3TB 1BBGA 2YWQA 1AH5A 4R2CA 4GKJE 4O24A 4DV3E 3KZZA 4P78A 1ZU1A 2ODRC 5T6JA 4J8ZA 1L4SA 4LF9E 5A6KA 4ZYGA 1J26A 4ZYHA 2LO3A 4DR7E 2JPAA 3ECRA 2M7QA 4WPYA
chains in the Genus database with same CATH topology
2B7VA 2N3HA 3JAMC 5ADZA 1X48A 1RQ0A 2VE7C 2JWOA 2L2MA 3HPZA 3OMLA 2LBSB 4JI5E 2FTXB 2NUGA 2V85A 3VK6A 1RC7A 4LFAE 4B3SE 2UU9E 3VYYA 2LUPB 1I94E 3AV0A 4DV6E 2N3GA 2EWLA 4JI8E 4X8WA 2UXCE 2LMZA 3ADLA 2M7QA 2LJHA 2MC6A 3JTZA 4BS9A 3J81C 2DIXA 1YYOA 4JI2E 4P7DA 2L33A 1YYKA 2VF1A 1N33E 2UXDE 1HNXE 5AASA 1GZ6A 3HTXA 4BCAA 3T1HE 1ZBQA 4LU9A 2L92A 2LUQA 1T4LB 1FKAE 2K4VA 2L6MA 2L8TA 4R8OA 4DUZE 4YHHE 1STUA 2FV4B 1ZBTA 4BC7A 1QU6A 2YT4A 4M2ZA 2MDRA 4DR6E 4DV1E 3JU0A 4R03A 4DR4E 1XNRE 3IWBA 5LL6R 4JI6E 5F3WA 2B9DA 3ADGA 1PKPA 1WHNA 3OTOE 2VQEE 4LF8E 2L2KB 4DUYE 3AUZA 2UUAE 2V87A 1UILA 2JOXA 1X47A 3KWRA 4WSPA 2G7HA 5AE2A 3FIGA 4DR5E 3RMPA 4M30A 2DMYA 1HR0E 3J7AG 4YY3E 2M1SA 3F6HA 2KHXA 3H09A 3P1XA 2JY9A 2E5LE 3DF6A 4JI7E 4LFBE 4X66E 2L3JA 2NUEA 2NA2A 4DV5E 5BR8E 4DR3E 5A2QC 3C4TA 2RS6A 4NXNE 2L3CA 4WFTA 5DNYA 2NUFA 1DI2A 2CPNA 2RSMA 4KZSA 1UHZA 4F9CB 2HHHE 1EKZA 2B7TA 2L2NA 1XMOE 1HNZE 4JI1E 4JI0E 1YZ9A 2M4IA 4M0VA 4LFCE 2VQFE 4BBYA 4LF7E 2RS7A 4JYAE 4X64E 4B3ME 2FGGA 1N32E 2V89A 4GKKE 1SR9A 1XMQE 3LMLA 4X62E 3ADJA 2JOBA 4DR2E 4TUGA 4B3TE 2MC5A 1HNWE 1T4OA 4KHPE 4GEQB 2V86A 3K6QA 1J5EE 4F9BB 3HPSA 4JI3E 3DJWA 4DV4E 1N36E 5CFFE 4DV2E 2LE2A 4DKKA 2LRSA 2WZOA 2F4VE 4NXME 3J7Yp 1WHQA 4BMJA 4OOGC 2KOUA 2KONA 5IT9C 4K0KE 2UXBE 2ZM6E 2ODRD 2V8QB 4I8OA 5AE1A 2F8BA 2E1MA 3C4BA 3ADIA 4DMIA 1IBLE 4L5NC 4JI4E 5FLXC 1X49A 3IWDA 3VYXA 5IWAE 4F9AB 5LMNE 2IHR1 3ZOQB 2RTXA 4F54A 2H36X 2V88A 1FJGE 2JVAA 4B3RE 3LLHA 4Q28A 4DV0E 2UUBE 2B3TB 1DQ3A 3F6GA 2LTRA 2UUCE 4GKJE 4LF6E 4TUIA 4DV3E 1O0WA 4LTYA 4OX9E 4P78A 2JR1A 3T1YE 3IWCA 1XNQE 2ODRC 5T6JA 2DB2A 4J8ZA 5AE3A 4AQYE 4LF5E 4LF9E 5LMUE 2V83A 3HXLA 1YYWA 2YZTA 2LTSA 2DSYA 4L8NA 1WXRA 4X65E 4DR1E 3HQ1A 1N34E 1IBME 1J26A 3J80C 1GQEA 4LF4E 3MSWA 4DR7E 4BC9A 4DV7E 4JV5E 2EZ6A 1IBKE 1T4NA 4WYQB 4WPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V87 A;  2V88 A;  2JWO A;  2V86 A;  2V83 A;  2V85 A;  2V89 A; 
#chains in the Genus database with same CATH topology
 2N3H A;  1G2D C;  1X48 A;  2BBG A;  2EMY A;  2EQ0 A;  2JWO A;  2L2M A;  3HPZ A;  3OML A;  2NUG A;  2V85 A;  4B3S E;  1NEI A;  4X8W A;  2EPK X;  3J81 C;  5A6J A;  1YYK A;  2VF1 A;  2EPX A;  5AAS A;  2EE8 A;  2YRM A;  4R2E A;  1ZBQ A;  1FKA E;  4R8O A;  2HGH A;  2EOM A;  2EMK A;  2UXD E;  2YT4 A;  2MDR A;  5F3W A;  2I13 A;  1WHN A;  2UUA E;  1LLM C;  2JOX A;  5AE2 A;  2EOY A;  1HR0 E;  2N8X A;  3P1X A;  4LFB E;  4N4R B;  4DV5 E;  2GLI A;  2EMC A;  2MKD A;  4NXN E;  2EM0 A;  3MHH C;  3QG5 C;  2EMW A;  4WFT A;  1EH6 A;  4O4K A;  2EQ1 A;  2B7T A;  1AAY A;  4JI0 E;  2MKN A;  4F6N A;  4LF7 E;  2RS7 A;  2YTQ A;  4X64 E;  4GKK E;  2V89 A;  4X62 E;  4TUG A;  2MC5 A;  4KHP E;  2EMX A;  3DJW A;  1N36 E;  4DKK A;  1WHQ A;  1PJT A;  4OOG C;  1IMU A;  2KON A;  4I8O A;  3TQM A;  5AE1 A;  2E1M A;  4DMI A;  2EMA A;  1X49 A;  1A1I A;  3ZOQ B;  2H36 X;  2YSP A;  5A6B D;  4Q28 A;  1P47 A;  2EOQ A;  2LTR A;  2UUC E;  4LF6 E;  2EN2 A;  4LTY A;  3T1Y E;  2DB2 A;  1T38 A;  3L00 A;  2LV2 A;  2V83 A;  5LMU E;  2YRK A;  1G2F C;  2DSY A;  1IBM E;  3HQ1 A;  2CSH A;  1TF6 A;  2EL6 A;  3BGH A;  4DV7 E;  2EPL X;  2DRP A;  2EM4 A;  2EZ6 A;  2EL5 A;  1T4N A;  4WYQ B;  2EN1 A;  2YTG A;  1ZR9 A;  4NZV A;  2EQ3 A;  4JI5 E;  2FTX B;  1RC7 A;  1T39 A;  3VYY A;  4WXD A;  3AV0 A;  2VRD A;  2CT1 A;  2EWL A;  2UXC E;  3C6K A;  3EPK A;  3ADL A;  2NAB A;  2EOZ A;  2EN7 A;  2LJH A;  2YU8 A;  4NHR A;  5TSE A;  4BS9 A;  4JI2 E;  4P7D A;  2EP3 A;  2L33 A;  1IQS A;  2EMI A;  3HTX A;  3T1H E;  1A1L A;  2LUQ A;  2L6M A;  2L8T A;  4DUZ E;  1STU A;  1ZBT A;  2FV4 B;  4IJD A;  1QU6 A;  4M2Z A;  4DR6 E;  4DV1 E;  3IWB A;  5KL2 A;  5KL5 A;  1A1H A;  2EPP A;  2B9D A;  2EPR A;  1PKP A;  2EN3 A;  5LLQ A;  4WSG A;  2V87 A;  2YTO A;  4WSP A;  2G7H A;  3VHT B;  2M1S A;  4RH8 A;  2RQL A;  5KL6 A;  3EPL A;  3DF6 A;  2WBU A;  5A69 A;  3C4T A;  1SFE A;  2L3C A;  2EJ4 A;  1DI2 A;  2DLK A;  2EM9 A;  1EKZ A;  1HNZ E;  2BB8 A;  1YZ9 A;  4LFC E;  2EPA A;  2VQF E;  4BBY A;  5KL4 A;  4O5G A;  4JYA E;  1X6F A;  1SR9 A;  2EN8 A;  2JOB A;  2GPI A;  4Q35 B;  1YFH A;  2V86 A;  3K6Q A;  3HPS A;  4JI3 E;  2EL4 A;  2LE2 A;  4DV2 E;  1JK2 A;  2WZO A;  2EM5 A;  4M9V C;  5IXM B;  3EPH A;  2UXB E;  3M99 B;  2ZM6 E;  2V8Q B;  1A1G A;  1A1K A;  2YRH A;  4BHB A;  3ADI A;  1EH8 A;  1IQO A;  1B69 A;  1IBL E;  4L5N C;  2RSI A;  5IWA E;  2IHR 1;  4R2S A;  5A6A A;  3F6G A;  3EQ1 A;  1TN9 A;  4TUI A;  4OX9 E;  4ZYD A;  2JR1 A;  2R1F A;  1PDA A;  3IWC A;  3EPJ A;  1YYW A;  5AE3 A;  2DGC A;  1JK1 A;  4LF5 E;  3HXL A;  2YZT A;  2LTS A;  1WXR A;  1N34 E;  1UBD C;  1WRJ A;  4LF4 E;  1EH7 A;  1GQE A;  2LJU A;  4GZN C;  4BC9 A;  4JV5 E;  2Q8U A;  2ENA A;  2EPU A;  4F2J C;  2EM3 A;  2EN6 A;  4WX9 A;  2LBS B;  3VK6 A;  1MGT A;  4F6M A;  2LUP B;  3BID A;  2EOX A;  2N3G A;  2K7I A;  2LMZ A;  3JTZ A;  1TF3 A;  1YYO A;  2EPO A;  3MHS C;  1DGC A;  1GZ6 A;  2A25 A;  4BCA A;  3UK3 C;  2K4V A;  4HTG A;  2EM6 A;  1A1F A;  5KL7 A;  2EOR A;  4BC7 A;  3JU0 A;  4HEI A;  4R03 A;  1XNR E;  2EM8 A;  2YPN A;  4R2R A;  2EMB A;  3AUZ A;  4MLV A;  2CTD A;  1X47 A;  4DR5 E;  3RMP A;  3FIG A;  3J7A G;  4M30 A;  4YY3 E;  2YTE A;  3F6H A;  2JY9 A;  4JI7 E;  4X66 E;  2JYA A;  2NUE A;  1X6H A;  2M9A A;  5BR8 E;  2EM7 A;  2YTD A;  2D9H A;  4FK5 C;  5DNY A;  2NUF A;  2CPN A;  2RSM A;  2EPC A;  2HHH E;  4JI1 E;  2L2N A;  3KZY A;  4M0V A;  4B3M E;  1N32 E;  1YUI A;  1XMQ E;  1MEY C;  2R76 A;  1X5W A;  4DR2 E;  1HNW E;  1J5E E;  4F9B B;  1PJS A;  4DV4 E;  5CFF E;  1YPN A;  2I9I A;  4ZYE A;  2ELY A;  1UN6 B;  1KYQ A;  2ENC A;  2YTP A;  4K0K E;  2ELZ A;  2F8B A;  3C4B A;  3IWD A;  1WJP A;  1FJG E;  2V88 A;  2ENH A;  4B3R E;  3LLH A;  2UUB E;  4IS1 C;  1DQ3 A;  5AC4 A;  1O0W A;  4R2P A;  5IV8 B;  1XNQ E;  4RHB B;  4AQY E;  3VYX A;  4L8N A;  4DR1 E;  4X65 E;  1BBO A;  3J80 C;  3MSW A;  2YTI A;  5KL3 A;  4LF8 E;  2YTN A;  3LML A;  2EMZ A;  2EPZ A;  2B7V A;  3JAM C;  5ADZ A;  1RQ0 A;  2VE7 C;  1X3C A;  4LFA E;  1QNT A;  2EOJ A;  2UU9 E;  1I94 E;  3THN A;  4DV6 E;  4JI8 E;  1RMD A;  2MC6 A;  2HJJ A;  2DIX A;  2EMF A;  2EOH A;  1N33 E;  2EMH A;  2EML A;  1HNX E;  1PJQ A;  2YTJ A;  2WBS A;  2RPC A;  4LU9 A;  2L92 A;  2HC5 A;  1T4L B;  2EOF A;  1ZAA C;  4YHH E;  2GHF A;  3BF2 A;  5AC5 A;  5A6B A;  4DR4 E;  5LL6 R;  4JI6 E;  3ADG A;  2VQE E;  3OTO E;  2EMG A;  2L2K B;  4DUY E;  1KJK A;  1UIL A;  3KWR A;  2E72 A;  2DMY A;  2ADR A;  3C6M A;  2KHX A;  3H09 A;  1A1J A;  2E5L E;  3THO B;  2L3J A;  2NA2 A;  4DR3 E;  5A2Q C;  2LVH A;  2RS6 A;  2MDG A;  2YTF A;  1N3G A;  1BB8 A;  4KZS A;  2DMI A;  1UHZ A;  4F9C B;  2WCC 3;  2EOS A;  2YSO A;  1XMO E;  2M4I A;  2WBT A;  4R2Q A;  2FGG A;  2EPN A;  4MLQ A;  1F2I G;  3ADJ A;  2DLQ A;  4R2A A;  4B3T E;  1IBK E;  1T4O A;  4GEQ B;  2EM2 A;  2EOO A;  2EPM X;  4KWY A;  4X9J A;  4R2D A;  2LT7 A;  2JXP A;  1NCS A;  1YSA C;  1YUJ A;  2LRS A;  1Z1B A;  2JP9 A;  4BHC A;  1X6E A;  2PRT A;  2J7J A;  4NXM E;  2F4V E;  3J7Y p;  3BBG A;  4O43 A;  4BMJ A;  2EN4 A;  2YU5 A;  2KOU A;  5IT9 C;  2ODR D;  1GTK A;  2EOI A;  4JI4 E;  5FLX C;  4F9A B;  5LMN E;  2RTX A;  2LCE A;  4WXC A;  4F54 A;  2EOE A;  2JVA A;  4DV0 E;  2B3T B;  1BBG A;  2YWQ A;  1AH5 A;  4R2C A;  4GKJ E;  4O24 A;  4DV3 E;  3KZZ A;  4P78 A;  1ZU1 A;  2ODR C;  5T6J A;  4J8Z A;  1L4S A;  4LF9 E;  5A6K A;  4ZYG A;  1J26 A;  4ZYH A;  2LO3 A;  4DR7 E;  2JPA A;  3ECR A;  2M7Q A;  4WPY A; 
#chains in the Genus database with same CATH homology
 2B7V A;  2N3H A;  3JAM C;  5ADZ A;  1X48 A;  1RQ0 A;  2VE7 C;  2JWO A;  2L2M A;  3HPZ A;  3OML A;  2LBS B;  4JI5 E;  2FTX B;  2NUG A;  2V85 A;  3VK6 A;  1RC7 A;  4LFA E;  4B3S E;  2UU9 E;  3VYY A;  2LUP B;  1I94 E;  3AV0 A;  4DV6 E;  2N3G A;  2EWL A;  4JI8 E;  4X8W A;  2UXC E;  2LMZ A;  3ADL A;  2M7Q A;  2LJH A;  2MC6 A;  3JTZ A;  4BS9 A;  3J81 C;  2DIX A;  1YYO A;  4JI2 E;  4P7D A;  2L33 A;  1YYK A;  2VF1 A;  1N33 E;  2UXD E;  1HNX E;  5AAS A;  1GZ6 A;  3HTX A;  4BCA A;  3T1H E;  1ZBQ A;  4LU9 A;  2L92 A;  2LUQ A;  1T4L B;  1FKA E;  2K4V A;  2L6M A;  2L8T A;  4R8O A;  4DUZ E;  4YHH E;  1STU A;  2FV4 B;  1ZBT A;  4BC7 A;  1QU6 A;  2YT4 A;  4M2Z A;  2MDR A;  4DR6 E;  4DV1 E;  3JU0 A;  4R03 A;  4DR4 E;  1XNR E;  3IWB A;  5LL6 R;  4JI6 E;  5F3W A;  2B9D A;  3ADG A;  1PKP A;  1WHN A;  3OTO E;  2VQE E;  4LF8 E;  2L2K B;  4DUY E;  3AUZ A;  2UUA E;  2V87 A;  1UIL A;  2JOX A;  1X47 A;  3KWR A;  4WSP A;  2G7H A;  5AE2 A;  3FIG A;  4DR5 E;  3RMP A;  4M30 A;  2DMY A;  1HR0 E;  3J7A G;  4YY3 E;  2M1S A;  3F6H A;  2KHX A;  3H09 A;  3P1X A;  2JY9 A;  2E5L E;  3DF6 A;  4JI7 E;  4LFB E;  4X66 E;  2L3J A;  2NUE A;  2NA2 A;  4DV5 E;  5BR8 E;  4DR3 E;  5A2Q C;  3C4T A;  2RS6 A;  4NXN E;  2L3C A;  4WFT A;  5DNY A;  2NUF A;  1DI2 A;  2CPN A;  2RSM A;  4KZS A;  1UHZ A;  4F9C B;  2HHH E;  1EKZ A;  2B7T A;  2L2N A;  1XMO E;  1HNZ E;  4JI1 E;  4JI0 E;  1YZ9 A;  2M4I A;  4M0V A;  4LFC E;  2VQF E;  4BBY A;  4LF7 E;  2RS7 A;  4JYA E;  4X64 E;  4B3M E;  2FGG A;  1N32 E;  2V89 A;  4GKK E;  1SR9 A;  1XMQ E;  3LML A;  4X62 E;  3ADJ A;  2JOB A;  4DR2 E;  4TUG A;  4B3T E;  2MC5 A;  1HNW E;  1T4O A;  4KHP E;  4GEQ B;  2V86 A;  3K6Q A;  1J5E E;  4F9B B;  3HPS A;  4JI3 E;  3DJW A;  4DV4 E;  1N36 E;  5CFF E;  4DV2 E;  2LE2 A;  4DKK A;  2LRS A;  2WZO A;  2F4V E;  4NXM E;  3J7Y p;  1WHQ A;  4BMJ A;  4OOG C;  2KOU A;  2KON A;  5IT9 C;  4K0K E;  2UXB E;  2ZM6 E;  2ODR D;  2V8Q B;  4I8O A;  5AE1 A;  2F8B A;  2E1M A;  3C4B A;  3ADI A;  4DMI A;  1IBL E;  4L5N C;  4JI4 E;  5FLX C;  1X49 A;  3IWD A;  3VYX A;  5IWA E;  4F9A B;  5LMN E;  2IHR 1;  3ZOQ B;  2RTX A;  4F54 A;  2H36 X;  2V88 A;  1FJG E;  2JVA A;  4B3R E;  3LLH A;  4Q28 A;  4DV0 E;  2UUB E;  2B3T B;  1DQ3 A;  3F6G A;  2LTR A;  2UUC E;  4GKJ E;  4LF6 E;  4TUI A;  4DV3 E;  1O0W A;  4LTY A;  4OX9 E;  4P78 A;  2JR1 A;  3T1Y E;  3IWC A;  1XNQ E;  2ODR C;  5T6J A;  2DB2 A;  4J8Z A;  5AE3 A;  4AQY E;  4LF5 E;  4LF9 E;  5LMU E;  2V83 A;  3HXL A;  1YYW A;  2YZT A;  2LTS A;  2DSY A;  4L8N A;  1WXR A;  4X65 E;  4DR1 E;  3HQ1 A;  1N34 E;  1IBM E;  1J26 A;  3J80 C;  1GQE A;  4LF4 E;  3MSW A;  4DR7 E;  4BC9 A;  4DV7 E;  4JV5 E;  2EZ6 A;  1IBK E;  1T4N A;  4WYQ B;  4WPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...