2V86A

Crystal structure of rag2-phd finger in complex with h3r2me2ak4me3 peptide
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
82
structure length
82
Chain Sequence
GPLGSPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQIARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VDJ RECOMBINATION-ACTIVATING PROTEIN 2
publication title The Plant Homeodomain Finger of Rag2 Recognizes Histone H3 Methylated at Both Lysine-4 and Arginine-2.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 16
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.290 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2v86A01
2V87A 2JWOA 2V88A 2V89A 2V86A 2V85A 2V83A
chains in the Genus database with same CATH superfamily
1XNQE 4DR1E 3BIDA 5A6AA 5A69A 4DR6E 2K4VA 2B7TA 2DLQA 2CPNA 4O5GA 1BBGA 2JVAA 2MDGA 2EMWA 4NXNE 3HTXA 2UXCE 4LFAE 1A1HA 2ODRD 1KJKA 1A1GA 2EN8A 2LO3A 2GHFA 2WBUA 2YRMA 2V87A 2YRKA 1YZ9A 3J81C 3M99B 4O4KA 3J7AG 1DQ3A 5LLQA 4DV3E 2JWOA 4F9AB 3VK6A 2EMCA 2YPNA 2A25A 1SR9A 4J8ZA 1MEYC 1UN6B 2EMBA 2EMZA 2DMIA 1A1KA 2UU9E 2EMGA 2EOEA 1WRJA 2E1MA 4L8NA 4L5NC 4BHBA 5F3WA 3BF2A 2EPLX 1XMOE 1A1LA 4F54A 5AE3A 4I8OA 4WYQB 2F8BA 1N33E 2EOFA 2EMLA 2LJHA 4WXCA 4IS1C 2V85A 2EOQA 2I9IA 2EM8A 3EPLA 2EM7A 3THOB 2YTFA 2PRTA 3ADLA 3C6MA 2M7QA 4DMIA 3JAMC 4KZSA 1TF3A 2EOYA 4RHBB 4GKJE 3TQMA 1YPNA 5AE2A 2EM5A 2KHXA 4R2SA 1STUA 1T4NA 4DV4E 1N32E 2EN4A 2CTDA 4X8WA 2CT1A 1X6EA 1RQ0A 3C4BA 2K7IA 2MC6A 1IBLE 5LL6R 1X49A 1X48A 2EM9A 2NABA 2L3JA 4M9VC 2UXDE 4M0VA 4R8OA 3EPHA 2WBSA 2D9HA 2EPZA 4ZYGA 4FK5C 2M4IA 4LF7E 3OTOE 1WXRA 2EOHA 1YYKA 2LMZA 2RQLA 1PJSA 4JI5E 4R2QA 4F9CB 4NXME 2EM2A 4NHRA 1F2IG 4F9BB 2VQFE 1NCSA 5FLXC 2YSOA 2N8XA 4R2PA 2YTDA 1GTKA 2EL4A 2Q8UA 4BC9A 5IXMB 2G7HA 1T38A 1YYWA 3J7Yp 2VRDA 1I94E 1MGTA 2N3GA 2LT7A 2EPUA 4X64E 4HEIA 2DMYA 4WPYA 4JI4E 5KL5A 1PJTA 2JXPA 3C4TA 3ECRA 2EN1A 1DGCA 4MLVA 1DI2A 1QU6A 4DUYE 4ZYEA 3DF6A 4X65E 2JOXA 2YZTA 2DLKA 4X66E 2L2MA 2YU5A 2EPPA 3K6QA 1EKZA 3QG5C 4DR2E 4JI8E 2EMAA 2L8TA 1IQSA 3THNA 5A6JA 5KL3A 2ENHA 2JR1A 1PDAA 2YTPA 5ADZA 4P7DA 1P47A 1GQEA 4DV0E 4LF6E 2NUGA 4JI0E 5LMNE 2B9DA 2YRHA 1N36E 3HPZA 1HNXE 2FTXB 2L92A 2J7JA 4DV5E 2E72A 2WCC3 3F6GA 1A1FA 3MHHC 1BB8A 1BBOA 1WJPA 2EM6A 2R1FA 4P78A 4BBYA 2V88A 4DR5E 3KWRA 1EH7A 3ADJA 2EP3A 2VQEE 5IT9C 1X6FA 5AC5A 1N34E 4DR3E 3MHSC 4R03A 4BS9A 4OX9E 1KYQA 1ZR9A 2JYAA 5KL7A 2FGGA 2EN2A 4B3ME 2EL6A 2ENCA 2LRSA 2EPAA 5BR8E 2EQ3A 4O43A 4R2CA 1T4OA 2L6MA 5KL4A 1EH6A 1JK2A 4LU9A 2E5LE 1UBDC 4R2AA 4GKKE 1TF6A 2WZOA 1AAYA 4BHCA 2HJJA 3FIGA 4GZNC 4JV5E 4BMJA 2RS7A 2VE7C 2EM0A 2NUFA 2ENAA 1IBME 4WSPA 4X9JA 2KOUA 2UUAE 1IMUA 2EPNA 3VYYA 2CSHA 2UXBE 4GEQB 2RPCA 1X3CA 3VYXA 1RC7A 4DV1E 2LCEA 1FJGE 5KL2A 2L3CA 2ZM6E 2FV4B 2KONA 2GLIA 1UHZA 1PJQA 4RH8A 4WFTA 2EOJA 1EH8A 3UK3C 5DNYA 1N3GA 3MSWA 2RTXA 2EPCA 1J5EE 5CFFE 1ZBQA 1JK1A 2VF1A 2EORA 3JU0A 4F2JC 4Q28A 2LE2A 2EN6A 2EPRA 4M2ZA 4ZYDA 4OOGC 2V8QB 2EMKA 2MC5A 2HHHE 2B3TB 2B7VA 2RSMA 3IWCA 3HPSA 5A2QC 2LBSB 2EZ6A 4B3TE 1RMDA 2M9AA 4K0KE 2JOBA 4NZVA 2M1SA 1LLMC 2EMIA 2JP9A 1FKAE 1YUIA 4TUIA 2UUCE 4DR7E 2ODRC 2EMHA 5AE1A 2YTJA 1ZBTA 4BC7A 2EPKX 3KZYA 2F4VE 2EOIA 2R76A 2EOSA 1L4SA 4KWYA 2EOXA 4LTYA 1J26A 1HR0E 2IHR1 2HGHA 1T4LB 3C6KA 4KHPE 3KZZA 4Q35B 4B3SE 4WXDA 3VHTB 3IWDA 3P1XA 3F6HA 2EOZA 2HC5A 2NUEA 4JI7E 1XNRE 2ELYA 1B69A 2EPXA 4LF5E 1IQOA 2YU8A 3HXLA 1ZU1A 4WX9A 4B3RE 5TSEA 4ZYHA 4F6NA 2YTNA 2ELZA 1UILA 2BBGA 2DB2A 2DIXA 5A6BA 2LJUA 1G2FC 1O0WA 2GPIA 2N3HA 2YSPA 1G2DC 1QNTA 2RSIA 5IWAE 4DV2E 2JPAA 5KL6A 1IBKE 4WSGA 2V83A 4N4RB 2YTOA 2JY9A 3LMLA 2EMXA 2UUBE 2L33A 1WHQA 2V86A 3OMLA 5A6BD 1AH5A 3BGHA 4X62E 4JYAE 5AC4A 2L2KB 2DSYA 2ADRA 5T6JA 2LUPB 3BBGA 1A1IA 5IV8B 2MKDA 2RS6A 1X6HA 2EE8A 4YHHE 3T1YE 3RMPA 2EM4A 2YWQA 2YT4A 4R2DA 3AUZA 4MLQA 2NA2A 4IJDA 3T1HE 1XMQE 1X5WA 3L00A 3EQ1A 2EL5A 2EQ1A 4F6MA 2LTRA 2H36X 2EPOA 1Z1BA 3ADGA 2L2NA 2EMFA 2I13A 2YTQA 2EJ4A 4JI1E 2EOOA 3HQ1A 4JI2E 1NEIA 2EMYA 2EWLA 4DV6E 4JI6E 4LFCE 4LF8E 2LUQA 4O24A 2YTEA 2EPMX 2EN7A 2YTIA 3ADIA 4DUZE 3IWBA 3ZOQB 5LMUE 1SFEA 1YSAC 4TUGA 3LLHA 2WBTA 1YUJA 3H09A 1TN9A 2MKNA 2EOMA 2EN3A 4R2RA 5A6KA 2LV2A 2LTSA 2LVHA 3EPKA 4LFBE 2MDRA 3DJWA 3AV0A 2V89A 4YY3E 1A1JA 1WHNA 3JTZA 4JI3E 4LF4E 3EPJA 4AQYE 2YTGA 3J80C 4DR4E 1YFHA 1HNZE 4HTGA 2DGCA 2BB8A 4BCAA 2DRPA 4M30A 1X47A 4DV7E 2EQ0A 2EM3A 4DKKA 1HNWE 1YYOA 4LF9E 1GZ6A 4R2EA 1PKPA 5AASA 1ZAAC 1T39A
chains in the Genus database with same CATH topology
3OTOE 1XNQE 4DR1E 1WXRA 1UILA 2DB2A 2NUFA 1YYKA 2LMZA 1IBME 4DR6E 2DIXA 4WSPA 2K4VA 4JI5E 2B7TA 1O0WA 2CPNA 2N3HA 2KOUA 4F9CB 4DV2E 5IWAE 2UUAE 4NXME 1IBKE 4F9BB 2VQFE 2JVAA 2V83A 5FLXC 3VYYA 4NXNE 3HTXA 2UXBE 2JY9A 4GEQB 4BC9A 2UXCE 3LMLA 4LFAE 2G7HA 2ODRD 3VYXA 1YYWA 3J7Yp 4DV1E 1RC7A 2L33A 1WHQA 2V86A 3OMLA 2N3GA 1I94E 2UUBE 2L3CA 4X64E 2ZM6E 4X62E 4JYAE 2FV4B 2V87A 2KONA 2DMYA 4WPYA 4JI4E 1YZ9A 2L2KB 2DSYA 3J81C 3C4TA 3J7AG 1UHZA 5T6JA 2LUPB 1DQ3A 4DV3E 4WFTA 2RS6A 2JWOA 5DNYA 4F9AB 1DI2A 3MSWA 3VK6A 1QU6A 4YHHE 4DUYE 3RMPA 2RTXA 2YT4A 3T1YE 3DF6A 3AUZA 1J5EE 4X65E 1SR9A 4J8ZA 5CFFE 1ZBQA 2NA2A 2JOXA 2VF1A 2YZTA 3JU0A 4X66E 3T1HE 2L2MA 1XMQE 4Q28A 2LE2A 2UU9E 3K6QA 1EKZA 2LTRA 2H36X 4DR2E 4JI8E 4M2ZA 2L8TA 3ADGA 2E1MA 2V8QB 4OOGC 2L2NA 2MC5A 2JR1A 4L5NC 4L8NA 5F3WA 2HHHE 2B3TB 2B7VA 4JI1E 2RSMA 5ADZA 3IWCA 3HQ1A 4P7DA 4JI2E 3HPSA 5A2QC 2LBSB 2EWLA 4DV6E 1XMOE 2EZ6A 1GQEA 4DV0E 4B3TE 4JI6E 4JI0E 4F54A 5AE3A 4I8OA 4LF6E 4WYQB 5LMNE 4LFCE 2B9DA 1N36E 2F8BA 4LF8E 4K0KE 1N33E 2JOBA 3HPZA 1HNXE 2LUQA 2M1SA 2FTXB 2LJHA 2L92A 4DV5E 3ADIA 4DUZE 1FKAE 3IWBA 2V85A 4TUIA 2UUCE 3ZOQB 2ODRC 4DR7E 3F6GA 5LMUE 4TUGA 5AE1A 3ADLA 3LLHA 4P78A 4BBYA 2V88A 1ZBTA 3H09A 2M7QA 4DR5E 4DMIA 3KWRA 3JAMC 4BC7A 3ADJA 4KZSA 2VQEE 5IT9C 2F4VE 4GKJE 1N34E 4DR3E 2LTSA 4R03A 4BS9A 4OX9E 4LFBE 2MDRA 4LTYA 3DJWA 3AV0A 1HR0E 1J26A 2IHR1 2FGGA 2V89A 5AE2A 4YY3E 2NUGA 1T4LB 4B3ME 2KHXA 1WHNA 4KHPE 1STUA 1T4NA 2LRSA 3JTZA 5BR8E 4JI3E 4LF4E 4AQYE 4DV4E 4B3SE 1N32E 3J80C 3IWDA 1T4OA 2L6MA 3P1XA 3F6HA 4DR4E 1HNZE 1FJGE 4X8WA 2NUEA 4LU9A 2E5LE 4JI7E 1RQ0A 3C4BA 2MC6A 4M30A 1X47A 5LL6R 4BCAA 4DV7E 1X49A 1XNRE 1HNWE 4DKKA 4GKKE 1X48A 2VE7C 4LF5E 2WZOA 1YYOA 4LF9E 3FIGA 2L3JA 1IBLE 2UXDE 4M0VA 1GZ6A 4R8OA 1PKPA 5AASA 4BMJA 4JV5E 3HXLA 2RS7A 4B3RE 4LF7E 2M4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V87 A;  2JWO A;  2V88 A;  2V89 A;  2V86 A;  2V85 A;  2V83 A; 
#chains in the Genus database with same CATH topology
 1XNQ E;  4DR1 E;  3BID A;  5A6A A;  5A69 A;  4DR6 E;  2K4V A;  2B7T A;  2DLQ A;  2CPN A;  4O5G A;  1BBG A;  2JVA A;  2MDG A;  2EMW A;  4NXN E;  3HTX A;  2UXC E;  4LFA E;  1A1H A;  2ODR D;  1KJK A;  1A1G A;  2EN8 A;  2LO3 A;  2GHF A;  2WBU A;  2YRM A;  2V87 A;  2YRK A;  1YZ9 A;  3J81 C;  3M99 B;  4O4K A;  3J7A G;  1DQ3 A;  5LLQ A;  4DV3 E;  2JWO A;  4F9A B;  3VK6 A;  2EMC A;  2YPN A;  2A25 A;  1SR9 A;  4J8Z A;  1MEY C;  1UN6 B;  2EMB A;  2EMZ A;  2DMI A;  1A1K A;  2UU9 E;  2EMG A;  2EOE A;  1WRJ A;  2E1M A;  4L8N A;  4L5N C;  4BHB A;  5F3W A;  3BF2 A;  2EPL X;  1XMO E;  1A1L A;  4F54 A;  5AE3 A;  4I8O A;  4WYQ B;  2F8B A;  1N33 E;  2EOF A;  2EML A;  2LJH A;  4WXC A;  4IS1 C;  2V85 A;  2EOQ A;  2I9I A;  2EM8 A;  3EPL A;  2EM7 A;  3THO B;  2YTF A;  2PRT A;  3ADL A;  3C6M A;  2M7Q A;  4DMI A;  3JAM C;  4KZS A;  1TF3 A;  2EOY A;  4RHB B;  4GKJ E;  3TQM A;  1YPN A;  5AE2 A;  2EM5 A;  2KHX A;  4R2S A;  1STU A;  1T4N A;  4DV4 E;  1N32 E;  2EN4 A;  2CTD A;  4X8W A;  2CT1 A;  1X6E A;  1RQ0 A;  3C4B A;  2K7I A;  2MC6 A;  1IBL E;  5LL6 R;  1X49 A;  1X48 A;  2EM9 A;  2NAB A;  2L3J A;  4M9V C;  2UXD E;  4M0V A;  4R8O A;  3EPH A;  2WBS A;  2D9H A;  2EPZ A;  4ZYG A;  4FK5 C;  2M4I A;  4LF7 E;  3OTO E;  1WXR A;  2EOH A;  1YYK A;  2LMZ A;  2RQL A;  1PJS A;  4JI5 E;  4R2Q A;  4F9C B;  4NXM E;  2EM2 A;  4NHR A;  1F2I G;  4F9B B;  2VQF E;  1NCS A;  5FLX C;  2YSO A;  2N8X A;  4R2P A;  2YTD A;  1GTK A;  2EL4 A;  2Q8U A;  4BC9 A;  5IXM B;  2G7H A;  1T38 A;  1YYW A;  3J7Y p;  2VRD A;  1I94 E;  1MGT A;  2N3G A;  2LT7 A;  2EPU A;  4X64 E;  4HEI A;  2DMY A;  4WPY A;  4JI4 E;  5KL5 A;  1PJT A;  2JXP A;  3C4T A;  3ECR A;  2EN1 A;  1DGC A;  4MLV A;  1DI2 A;  1QU6 A;  4DUY E;  4ZYE A;  3DF6 A;  4X65 E;  2JOX A;  2YZT A;  2DLK A;  4X66 E;  2L2M A;  2YU5 A;  2EPP A;  3K6Q A;  1EKZ A;  3QG5 C;  4DR2 E;  4JI8 E;  2EMA A;  2L8T A;  1IQS A;  3THN A;  5A6J A;  5KL3 A;  2ENH A;  2JR1 A;  1PDA A;  2YTP A;  5ADZ A;  4P7D A;  1P47 A;  1GQE A;  4DV0 E;  4LF6 E;  2NUG A;  4JI0 E;  5LMN E;  2B9D A;  2YRH A;  1N36 E;  3HPZ A;  1HNX E;  2FTX B;  2L92 A;  2J7J A;  4DV5 E;  2E72 A;  2WCC 3;  3F6G A;  1A1F A;  3MHH C;  1BB8 A;  1BBO A;  1WJP A;  2EM6 A;  2R1F A;  4P78 A;  4BBY A;  2V88 A;  4DR5 E;  3KWR A;  1EH7 A;  3ADJ A;  2EP3 A;  2VQE E;  5IT9 C;  1X6F A;  5AC5 A;  1N34 E;  4DR3 E;  3MHS C;  4R03 A;  4BS9 A;  4OX9 E;  1KYQ A;  1ZR9 A;  2JYA A;  5KL7 A;  2FGG A;  2EN2 A;  4B3M E;  2EL6 A;  2ENC A;  2LRS A;  2EPA A;  5BR8 E;  2EQ3 A;  4O43 A;  4R2C A;  1T4O A;  2L6M A;  5KL4 A;  1EH6 A;  1JK2 A;  4LU9 A;  2E5L E;  1UBD C;  4R2A A;  4GKK E;  1TF6 A;  2WZO A;  1AAY A;  4BHC A;  2HJJ A;  3FIG A;  4GZN C;  4JV5 E;  4BMJ A;  2RS7 A;  2VE7 C;  2EM0 A;  2NUF A;  2ENA A;  1IBM E;  4WSP A;  4X9J A;  2KOU A;  2UUA E;  1IMU A;  2EPN A;  3VYY A;  2CSH A;  2UXB E;  4GEQ B;  2RPC A;  1X3C A;  3VYX A;  1RC7 A;  4DV1 E;  2LCE A;  1FJG E;  5KL2 A;  2L3C A;  2ZM6 E;  2FV4 B;  2KON A;  2GLI A;  1UHZ A;  1PJQ A;  4RH8 A;  4WFT A;  2EOJ A;  1EH8 A;  3UK3 C;  5DNY A;  1N3G A;  3MSW A;  2RTX A;  2EPC A;  1J5E E;  5CFF E;  1ZBQ A;  1JK1 A;  2VF1 A;  2EOR A;  3JU0 A;  4F2J C;  4Q28 A;  2LE2 A;  2EN6 A;  2EPR A;  4M2Z A;  4ZYD A;  4OOG C;  2V8Q B;  2EMK A;  2MC5 A;  2HHH E;  2B3T B;  2B7V A;  2RSM A;  3IWC A;  3HPS A;  5A2Q C;  2LBS B;  2EZ6 A;  4B3T E;  1RMD A;  2M9A A;  4K0K E;  2JOB A;  4NZV A;  2M1S A;  1LLM C;  2EMI A;  2JP9 A;  1FKA E;  1YUI A;  4TUI A;  2UUC E;  4DR7 E;  2ODR C;  2EMH A;  5AE1 A;  2YTJ A;  1ZBT A;  4BC7 A;  2EPK X;  3KZY A;  2F4V E;  2EOI A;  2R76 A;  2EOS A;  1L4S A;  4KWY A;  2EOX A;  4LTY A;  1J26 A;  1HR0 E;  2IHR 1;  2HGH A;  1T4L B;  3C6K A;  4KHP E;  3KZZ A;  4Q35 B;  4B3S E;  4WXD A;  3VHT B;  3IWD A;  3P1X A;  3F6H A;  2EOZ A;  2HC5 A;  2NUE A;  4JI7 E;  1XNR E;  2ELY A;  1B69 A;  2EPX A;  4LF5 E;  1IQO A;  2YU8 A;  3HXL A;  1ZU1 A;  4WX9 A;  4B3R E;  5TSE A;  4ZYH A;  4F6N A;  2YTN A;  2ELZ A;  1UIL A;  2BBG A;  2DB2 A;  2DIX A;  5A6B A;  2LJU A;  1G2F C;  1O0W A;  2GPI A;  2N3H A;  2YSP A;  1G2D C;  1QNT A;  2RSI A;  5IWA E;  4DV2 E;  2JPA A;  5KL6 A;  1IBK E;  4WSG A;  2V83 A;  4N4R B;  2YTO A;  2JY9 A;  3LML A;  2EMX A;  2UUB E;  2L33 A;  1WHQ A;  2V86 A;  3OML A;  5A6B D;  1AH5 A;  3BGH A;  4X62 E;  4JYA E;  5AC4 A;  2L2K B;  2DSY A;  2ADR A;  5T6J A;  2LUP B;  3BBG A;  1A1I A;  5IV8 B;  2MKD A;  2RS6 A;  1X6H A;  2EE8 A;  4YHH E;  3T1Y E;  3RMP A;  2EM4 A;  2YWQ A;  2YT4 A;  4R2D A;  3AUZ A;  4MLQ A;  2NA2 A;  4IJD A;  3T1H E;  1XMQ E;  1X5W A;  3L00 A;  3EQ1 A;  2EL5 A;  2EQ1 A;  4F6M A;  2LTR A;  2H36 X;  2EPO A;  1Z1B A;  3ADG A;  2L2N A;  2EMF A;  2I13 A;  2YTQ A;  2EJ4 A;  4JI1 E;  2EOO A;  3HQ1 A;  4JI2 E;  1NEI A;  2EMY A;  2EWL A;  4DV6 E;  4JI6 E;  4LFC E;  4LF8 E;  2LUQ A;  4O24 A;  2YTE A;  2EPM X;  2EN7 A;  2YTI A;  3ADI A;  4DUZ E;  3IWB A;  3ZOQ B;  5LMU E;  1SFE A;  1YSA C;  4TUG A;  3LLH A;  2WBT A;  1YUJ A;  3H09 A;  1TN9 A;  2MKN A;  2EOM A;  2EN3 A;  4R2R A;  5A6K A;  2LV2 A;  2LTS A;  2LVH A;  3EPK A;  4LFB E;  2MDR A;  3DJW A;  3AV0 A;  2V89 A;  4YY3 E;  1A1J A;  1WHN A;  3JTZ A;  4JI3 E;  4LF4 E;  3EPJ A;  4AQY E;  2YTG A;  3J80 C;  4DR4 E;  1YFH A;  1HNZ E;  4HTG A;  2DGC A;  2BB8 A;  4BCA A;  2DRP A;  4M30 A;  1X47 A;  4DV7 E;  2EQ0 A;  2EM3 A;  4DKK A;  1HNW E;  1YYO A;  4LF9 E;  1GZ6 A;  4R2E A;  1PKP A;  5AAS A;  1ZAA C;  1T39 A; 
#chains in the Genus database with same CATH homology
 3OTO E;  1XNQ E;  4DR1 E;  1WXR A;  1UIL A;  2DB2 A;  2NUF A;  1YYK A;  2LMZ A;  1IBM E;  4DR6 E;  2DIX A;  4WSP A;  2K4V A;  4JI5 E;  2B7T A;  1O0W A;  2CPN A;  2N3H A;  2KOU A;  4F9C B;  4DV2 E;  5IWA E;  2UUA E;  4NXM E;  1IBK E;  4F9B B;  2VQF E;  2JVA A;  2V83 A;  5FLX C;  3VYY A;  4NXN E;  3HTX A;  2UXB E;  2JY9 A;  4GEQ B;  4BC9 A;  2UXC E;  3LML A;  4LFA E;  2G7H A;  2ODR D;  3VYX A;  1YYW A;  3J7Y p;  4DV1 E;  1RC7 A;  2L33 A;  1WHQ A;  2V86 A;  3OML A;  2N3G A;  1I94 E;  2UUB E;  2L3C A;  4X64 E;  2ZM6 E;  4X62 E;  4JYA E;  2FV4 B;  2V87 A;  2KON A;  2DMY A;  4WPY A;  4JI4 E;  1YZ9 A;  2L2K B;  2DSY A;  3J81 C;  3C4T A;  3J7A G;  1UHZ A;  5T6J A;  2LUP B;  1DQ3 A;  4DV3 E;  4WFT A;  2RS6 A;  2JWO A;  5DNY A;  4F9A B;  1DI2 A;  3MSW A;  3VK6 A;  1QU6 A;  4YHH E;  4DUY E;  3RMP A;  2RTX A;  2YT4 A;  3T1Y E;  3DF6 A;  3AUZ A;  1J5E E;  4X65 E;  1SR9 A;  4J8Z A;  5CFF E;  1ZBQ A;  2NA2 A;  2JOX A;  2VF1 A;  2YZT A;  3JU0 A;  4X66 E;  3T1H E;  2L2M A;  1XMQ E;  4Q28 A;  2LE2 A;  2UU9 E;  3K6Q A;  1EKZ A;  2LTR A;  2H36 X;  4DR2 E;  4JI8 E;  4M2Z A;  2L8T A;  3ADG A;  2E1M A;  2V8Q B;  4OOG C;  2L2N A;  2MC5 A;  2JR1 A;  4L5N C;  4L8N A;  5F3W A;  2HHH E;  2B3T B;  2B7V A;  4JI1 E;  2RSM A;  5ADZ A;  3IWC A;  3HQ1 A;  4P7D A;  4JI2 E;  3HPS A;  5A2Q C;  2LBS B;  2EWL A;  4DV6 E;  1XMO E;  2EZ6 A;  1GQE A;  4DV0 E;  4B3T E;  4JI6 E;  4JI0 E;  4F54 A;  5AE3 A;  4I8O A;  4LF6 E;  4WYQ B;  5LMN E;  4LFC E;  2B9D A;  1N36 E;  2F8B A;  4LF8 E;  4K0K E;  1N33 E;  2JOB A;  3HPZ A;  1HNX E;  2LUQ A;  2M1S A;  2FTX B;  2LJH A;  2L92 A;  4DV5 E;  3ADI A;  4DUZ E;  1FKA E;  3IWB A;  2V85 A;  4TUI A;  2UUC E;  3ZOQ B;  2ODR C;  4DR7 E;  3F6G A;  5LMU E;  4TUG A;  5AE1 A;  3ADL A;  3LLH A;  4P78 A;  4BBY A;  2V88 A;  1ZBT A;  3H09 A;  2M7Q A;  4DR5 E;  4DMI A;  3KWR A;  3JAM C;  4BC7 A;  3ADJ A;  4KZS A;  2VQE E;  5IT9 C;  2F4V E;  4GKJ E;  1N34 E;  4DR3 E;  2LTS A;  4R03 A;  4BS9 A;  4OX9 E;  4LFB E;  2MDR A;  4LTY A;  3DJW A;  3AV0 A;  1HR0 E;  1J26 A;  2IHR 1;  2FGG A;  2V89 A;  5AE2 A;  4YY3 E;  2NUG A;  1T4L B;  4B3M E;  2KHX A;  1WHN A;  4KHP E;  1STU A;  1T4N A;  2LRS A;  3JTZ A;  5BR8 E;  4JI3 E;  4LF4 E;  4AQY E;  4DV4 E;  4B3S E;  1N32 E;  3J80 C;  3IWD A;  1T4O A;  2L6M A;  3P1X A;  3F6H A;  4DR4 E;  1HNZ E;  1FJG E;  4X8W A;  2NUE A;  4LU9 A;  2E5L E;  4JI7 E;  1RQ0 A;  3C4B A;  2MC6 A;  4M30 A;  1X47 A;  5LL6 R;  4BCA A;  4DV7 E;  1X49 A;  1XNR E;  1HNW E;  4DKK A;  4GKK E;  1X48 A;  2VE7 C;  4LF5 E;  2WZO A;  1YYO A;  4LF9 E;  3FIG A;  2L3J A;  1IBL E;  2UXD E;  4M0V A;  1GZ6 A;  4R8O A;  1PKP A;  5AAS A;  4BMJ A;  4JV5 E;  3HXL A;  2RS7 A;  4B3R E;  4LF7 E;  2M4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...