2V86A

Crystal structure of rag2-phd finger in complex with h3r2me2ak4me3 peptide
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
82
structure length
82
Chain Sequence
GPLGSPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQIARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords VDJ RECOMBINATION-ACTIVATING PROTEIN 2
publication title The Plant Homeodomain Finger of Rag2 Recognizes Histone H3 Methylated at Both Lysine-4 and Arginine-2.
pubmed doi rcsb
source organism Mus musculus
total genus 16
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.290 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2v86A01
2V83A 2V87A 2V89A 2V86A 2JWOA 2V85A 2V88A
chains in the Genus database with same CATH superfamily
4Q28A 2I9IA 4GKKE 2ENCA 1UHZA 2KONA 3M99B 1PDAA 3IWBA 4DMIA 2YWQA 2UUAE 4DR4E 1EH8A 2WZOA 3EPLA 1DGCA 2LV2A 2MC6A 2E5LE 2LT7A 2ODRD 3C4BA 1T39A 1JK1A 1HR0E 2HJJA 4BHCA 2LTSA 5LMUE 2R76A 4X62E 5KL6A 1LLMC 3JAMC 2YT4A 4DR3E 4F6MA 2EN3A 1QU6A 3L00A 4P7DA 1YSAC 1AH5A 2V89A 5A6JA 5A6KA 2EOHA 2EN7A 1GTKA 2EPPA 1XMQE 3TQMA 1L4SA 4JV5E 1BBOA 3ZOQB 4BS9A 1A1LA 1F2IG 4B3RE 4DV5E 2K7IA 1EH7A 4WXDA 2EPMX 3MSWA 4JI2E 4BBYA 4JI5E 4NHRA 1G2FC 4JI7E 4HEIA 1PKPA 4R2QA 3J7AG 2NUGA 2EN6A 2EN4A 2EL6A 2EPRA 4F2JC 2R1FA 2L33A 2V87A 4LF4E 2G7HA 4DR6E 2YTGA 1YYWA 3C6KA 1XNRE 1ZBQA 1JK2A 4DV1E 2MKNA 2EMAA 3C4TA 3F6HA 2L92A 2WBUA 1DQ3A 2JY9A 2YTDA 2ENAA 4WX9A 1A1GA 1WRJA 2DLQA 2L2KB 4B3ME 2EOOA 4X65E 3F6GA 4R03A 1X6HA 3BF2A 4X64E 1UBDC 4LF7E 3AUZA 2M7QA 4X66E 1PJTA 4B3SE 2J7JA 2HHHE 1N32E 2WBTA 5T6JA 2DRPA 2EPLX 4BMJA 4NZVA 4GZNC 2ZM6E 2PRTA 1YFHA 2CPNA 2EMZA 1TF6A 4MLQA 1T38A 2RTXA 2UXCE 4OX9E 2VRDA 4WPYA 3K6QA 4LFAE 2VE7C 3UK3C 3HTXA 2YSPA 2RQLA 2YU5A 1UN6B 1T4LB 1YYKA 2EE8A 2GPIA 1QNTA 2N3GA 2EMIA 1YUJA 2EQ1A 2EWLA 4KWYA 2YTPA 4AQYE 5KL3A 4LF5E 3QG5C 2VQEE 2B3TB 2YTNA 2M4IA 4RH8A 4IJDA 2EN2A 2LUPB 3THNA 4O24A 2M1SA 4JI3E 1A1IA 1XNQE 4J8ZA 2EOIA 4JI8E 2EPZA 2EOQA 1X47A 3VYYA 4BHBA 2I13A 1MEYC 4TUGA 2WCC3 1A1FA 2LUQA 2RS7A 3BGHA 5AE3A 1Z1BA 2L2NA 2EPNA 3DF6A 4F6NA 2EOFA 1A1HA 4O5GA 5LMNE 5AE1A 4TUIA 2DMIA 2RPCA 1A1KA 1YZ9A 1SR9A 2EM3A 3P1XA 4DV7E 1GQEA 2ENHA 2EL4A 5DNYA 2CSHA 1X49A 1O0WA 3DJWA 3KZZA 5LL6R 1YPNA 5IT9C 2JOBA 3HQ1A 3LMLA 2N3HA 4IS1C 2ELZA 4M9VC 2LJHA 4L8NA 3THOB 1DI2A 2BB8A 2L3CA 2MKDA 1NEIA 1WJPA 5A6BA 1I94E 4LFBE 4KZSA 2EPAA 4JI6E 1KYQA 3ADLA 2DB2A 4F9AB 2JXPA 2V88A 1X6EA 5A2QC 4DR1E 2EMLA 2EMCA 2LMZA 1HNWE 2ADRA 2EMXA 4BC7A 3EPKA 2V83A 2JP9A 3EPHA 1FJGE 2JR1A 1HNXE 4WSGA 4NXNE 2MDRA 2EMWA 3J80C 2JYAA 2EM9A 2EOSA 3MHHC 1IQOA 2ODRC 2CTDA 5KL5A 4R2AA 5FLXC 4R2CA 2LJUA 2JVAA 4P78A 4LF6E 1A1JA 1IBKE 2FTXB 4DR2E 4ZYDA 4HTGA 4R2EA 1NCSA 1SFEA 4L5NC 4LF8E 2HC5A 4YY3E 2L6MA 5AC4A 1UILA 3VK6A 3KZYA 4ZYHA 2EN8A 4DR7E 4M30A 5LLQA 1ZU1A 4MLVA 4LFCE 2IHR1 3IWDA 2YTEA 1J5EE 1IMUA 1XMOE 4WSPA 5BR8E 2RSIA 2L3JA 2V85A 1WHQA 2EOMA 4DV2E 1IBME 2E72A 4BC9A 2RS6A 1X6FA 1EKZA 2YZTA 4WXCA 2A25A 3BBGA 2YTOA 2LBSB 4DV4E 5F3WA 5AC5A 2UUBE 4Q35B 5IXMB 4X9JA 4DUYE 2KHXA 2WBSA 1ZBTA 2EN1A 4DV3E 2NUFA 4B3TE 4DUZE 4GKJE 2EMGA 4LF9E 2VF1A 2L2MA 4YHHE 3HPSA 2Q8UA 2RSMA 1T4NA 4K0KE 2YTJA 4JI1E 5ADZA 3J7Yp 5IWAE 1RMDA 2YRKA 1IBLE 2EMBA 2NUEA 1N3GA 1P47A 1X3CA 1N34E 2EPKX 1WHNA 2B7TA 4R2RA 2YPNA 2EM2A 1AAYA 3EPJA 2YU8A 2EM5A 1N36E 2LO3A 5TSEA 2EOZA 2JWOA 2LTRA 5KL4A 4JI4E 2UXBE 2EOYA 1RQ0A 1G2DC 1HNZE 2NABA 2V86A 2VQFE 2F4VE 4M2ZA 2EQ0A 4M0VA 2EMHA 2EL5A 3OTOE 2EOJA 2GHFA 4NXME 1IQSA 2ELYA 2F8BA 2N8XA 2DMYA 2UXDE 4ZYGA 1ZR9A 2YRHA 4I8OA 2UUCE 2H36X 2MC5A 1N33E 2EM8A 2V8QB 1PJSA 2EPOA 5AASA 2EM7A 2EM6A 2MDGA 1FKAE 2E1MA 1MGTA 1EH6A 2YTQA 3AV0A 2K4VA 2YTFA 2DGCA 4DV0E 4LTYA 3VYXA 2CT1A 2DSYA 3EQ1A 3T1YE 3ADIA 4R8OA 1BB8A 3JTZA 2YSOA 2M9AA 4GEQB 2LE2A 5A6AA 2LRSA 3KWRA 2EORA 4F9CB 4LU9A 1YUIA 2EPUA 4R2PA 2HGHA 1T4OA 2FV4B 2B9DA 3LLHA 4DV6E 2EPXA 1B69A 5A6BD 3ECRA 2LCEA 3JU0A 3MHSC 1WXRA 4OOGC 2BBGA 1ZAAC 3HXLA 3J81C 5CFFE 3HPZA 2GLIA 1YYOA 3VHTB 4WFTA 1KJKA 2YTIA 2B7VA 4FK5C 2EMKA 1RC7A 5A69A 1X48A 2DIXA 4R2SA 2LVHA 2EQ3A 4JYAE 4WYQB 3OMLA 4ZYEA 2NA2A 4X8WA 4O43A 1GZ6A 3C6MA 4DKKA 2EJ4A 2FGGA 1J26A 3ADGA 2EOEA 4F9BB 2DLKA 3RMPA 2EP3A 3ADJA 2YRMA 2EOXA 5IV8B 3T1HE 3H09A 4KHPE 1TN9A 3BIDA 2KOUA 2EZ6A 1STUA 5AE2A 3FIGA 4O4KA 1TF3A 5KL2A 4F54A 5KL7A 2EM4A 2EPCA 2EMFA 2L8TA 2D9HA 4BCAA 2JPAA 1PJQA 4JI0E 4R2DA 1BBGA 4N4RB 1X5WA 2EMYA 2EM0A 2JOXA 3IWCA 2UU9E 4DR5E 4RHBB
chains in the Genus database with same CATH topology
4Q28A 4NXNE 3OTOE 2MDRA 4GKKE 1UHZA 3J80C 4NXME 2KONA 2RTXA 2UXCE 4OX9E 3IWBA 4DMIA 2F8BA 2UUAE 2DMYA 2ODRC 3K6QA 4WPYA 2UXDE 5FLXC 4DR4E 2WZOA 4LFAE 2VE7C 4I8OA 2UUCE 2H36X 2JVAA 2MC5A 4P78A 2MC6A 3HTXA 2E5LE 1N33E 2ODRD 3C4BA 1HR0E 4LF6E 2V8QB 1T4LB 1IBKE 5AASA 2LTSA 2FTXB 5LMUE 4DR2E 1YYKA 4X62E 1FKAE 2E1MA 4L5NC 2N3GA 4LF8E 3AV0A 4YY3E 2K4VA 2L6MA 3JAMC 2YT4A 2EWLA 1UILA 3VK6A 4DR3E 4DV0E 4LTYA 3VYXA 4AQYE 1QU6A 4P7DA 4DR7E 4M30A 2V89A 2DSYA 3T1YE 2VQEE 2IHR1 2B3TB 3IWDA 4LF5E 4LFCE 4R8OA 3ADIA 3JTZA 2LUPB 1XMQE 1J5EE 4GEQB 2LE2A 1XMOE 4WSPA 5BR8E 2LRSA 2L3JA 2M1SA 3KWRA 2V85A 4JI3E 4JV5E 1XNQE 4F9CB 1WHQA 3ZOQB 4J8ZA 4LU9A 4BS9A 4DV2E 1IBME 4JI8E 4B3RE 4BC9A 1T4OA 2FV4B 2B9DA 2RS6A 1X47A 3LLHA 3VYYA 4DV5E 4DV6E 1EKZA 2YZTA 4TUGA 3JU0A 2LUQA 2RS7A 2LBSB 1WXRA 4OOGC 3MSWA 5AE3A 4DV4E 5F3WA 4JI2E 4BBYA 2UUBE 4JI5E 3HXLA 3J81C 2L2NA 5CFFE 3DF6A 3HPZA 2KHXA 4JI7E 4DUYE 5LMNE 1PKPA 1YYOA 4WFTA 5AE1A 3J7AG 2NUGA 4TUIA 2B7VA 1ZBTA 4DV3E 1RC7A 2NUFA 4B3TE 1SR9A 4DUZE 1YZ9A 1X48A 2DIXA 2L33A 2V87A 4LF4E 4GKJE 2G7HA 4JYAE 3P1XA 4DV7E 1GQEA 4LF9E 4WYQB 3OMLA 4DR6E 2VF1A 2NA2A 1YYWA 5DNYA 4X8WA 2L2MA 4YHHE 1XNRE 1GZ6A 1X49A 1O0WA 3DJWA 3HPSA 2RSMA 1ZBQA 4DKKA 1T4NA 5LL6R 4DV1E 4K0KE 4JI1E 5IT9C 2JOBA 3C4TA 2FGGA 3HQ1A 3LMLA 5ADZA 1J26A 3F6HA 2L92A 3J7Yp 3ADGA 5IWAE 2N3HA 4F9BB 1IBLE 1DQ3A 3RMPA 3ADJA 2JY9A 2LJHA 4L8NA 2NUEA 1DI2A 2L3CA 1I94E 4LFBE 3T1HE 3H09A 4KZSA 1N34E 4KHPE 1WHNA 2B7TA 2L2KB 4B3ME 4JI6E 2KOUA 2EZ6A 4X65E 1STUA 2DB2A 4F9AB 3F6GA 3FIGA 5AE2A 3ADLA 4R03A 2V88A 4F54A 4X64E 5A2QC 4DR1E 4LF7E 3AUZA 2LMZA 2L8TA 1N36E 2M7QA 4BCAA 4X66E 3IWCA 4JI0E 1HNWE 2JWOA 4B3SE 2LTRA 2HHHE 4JI4E 4BC7A 1N32E 2UXBE 2V83A 5T6JA 1RQ0A 4BMJA 1HNZE 1FJGE 2V86A 2JOXA 2VQFE 2JR1A 2ZM6E 2F4VE 2M4IA 4M2ZA 1HNXE 2CPNA 2UU9E 4DR5E 4M0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V83 A;  2V87 A;  2V89 A;  2V86 A;  2JWO A;  2V85 A;  2V88 A; 
#chains in the Genus database with same CATH topology
 4Q28 A;  2I9I A;  4GKK E;  2ENC A;  1UHZ A;  2KON A;  3M99 B;  1PDA A;  3IWB A;  4DMI A;  2YWQ A;  2UUA E;  4DR4 E;  1EH8 A;  2WZO A;  3EPL A;  1DGC A;  2LV2 A;  2MC6 A;  2E5L E;  2LT7 A;  2ODR D;  3C4B A;  1T39 A;  1JK1 A;  1HR0 E;  2HJJ A;  4BHC A;  2LTS A;  5LMU E;  2R76 A;  4X62 E;  5KL6 A;  1LLM C;  3JAM C;  2YT4 A;  4DR3 E;  4F6M A;  2EN3 A;  1QU6 A;  3L00 A;  4P7D A;  1YSA C;  1AH5 A;  2V89 A;  5A6J A;  5A6K A;  2EOH A;  2EN7 A;  1GTK A;  2EPP A;  1XMQ E;  3TQM A;  1L4S A;  4JV5 E;  1BBO A;  3ZOQ B;  4BS9 A;  1A1L A;  1F2I G;  4B3R E;  4DV5 E;  2K7I A;  1EH7 A;  4WXD A;  2EPM X;  3MSW A;  4JI2 E;  4BBY A;  4JI5 E;  4NHR A;  1G2F C;  4JI7 E;  4HEI A;  1PKP A;  4R2Q A;  3J7A G;  2NUG A;  2EN6 A;  2EN4 A;  2EL6 A;  2EPR A;  4F2J C;  2R1F A;  2L33 A;  2V87 A;  4LF4 E;  2G7H A;  4DR6 E;  2YTG A;  1YYW A;  3C6K A;  1XNR E;  1ZBQ A;  1JK2 A;  4DV1 E;  2MKN A;  2EMA A;  3C4T A;  3F6H A;  2L92 A;  2WBU A;  1DQ3 A;  2JY9 A;  2YTD A;  2ENA A;  4WX9 A;  1A1G A;  1WRJ A;  2DLQ A;  2L2K B;  4B3M E;  2EOO A;  4X65 E;  3F6G A;  4R03 A;  1X6H A;  3BF2 A;  4X64 E;  1UBD C;  4LF7 E;  3AUZ A;  2M7Q A;  4X66 E;  1PJT A;  4B3S E;  2J7J A;  2HHH E;  1N32 E;  2WBT A;  5T6J A;  2DRP A;  2EPL X;  4BMJ A;  4NZV A;  4GZN C;  2ZM6 E;  2PRT A;  1YFH A;  2CPN A;  2EMZ A;  1TF6 A;  4MLQ A;  1T38 A;  2RTX A;  2UXC E;  4OX9 E;  2VRD A;  4WPY A;  3K6Q A;  4LFA E;  2VE7 C;  3UK3 C;  3HTX A;  2YSP A;  2RQL A;  2YU5 A;  1UN6 B;  1T4L B;  1YYK A;  2EE8 A;  2GPI A;  1QNT A;  2N3G A;  2EMI A;  1YUJ A;  2EQ1 A;  2EWL A;  4KWY A;  2YTP A;  4AQY E;  5KL3 A;  4LF5 E;  3QG5 C;  2VQE E;  2B3T B;  2YTN A;  2M4I A;  4RH8 A;  4IJD A;  2EN2 A;  2LUP B;  3THN A;  4O24 A;  2M1S A;  4JI3 E;  1A1I A;  1XNQ E;  4J8Z A;  2EOI A;  4JI8 E;  2EPZ A;  2EOQ A;  1X47 A;  3VYY A;  4BHB A;  2I13 A;  1MEY C;  4TUG A;  2WCC 3;  1A1F A;  2LUQ A;  2RS7 A;  3BGH A;  5AE3 A;  1Z1B A;  2L2N A;  2EPN A;  3DF6 A;  4F6N A;  2EOF A;  1A1H A;  4O5G A;  5LMN E;  5AE1 A;  4TUI A;  2DMI A;  2RPC A;  1A1K A;  1YZ9 A;  1SR9 A;  2EM3 A;  3P1X A;  4DV7 E;  1GQE A;  2ENH A;  2EL4 A;  5DNY A;  2CSH A;  1X49 A;  1O0W A;  3DJW A;  3KZZ A;  5LL6 R;  1YPN A;  5IT9 C;  2JOB A;  3HQ1 A;  3LML A;  2N3H A;  4IS1 C;  2ELZ A;  4M9V C;  2LJH A;  4L8N A;  3THO B;  1DI2 A;  2BB8 A;  2L3C A;  2MKD A;  1NEI A;  1WJP A;  5A6B A;  1I94 E;  4LFB E;  4KZS A;  2EPA A;  4JI6 E;  1KYQ A;  3ADL A;  2DB2 A;  4F9A B;  2JXP A;  2V88 A;  1X6E A;  5A2Q C;  4DR1 E;  2EML A;  2EMC A;  2LMZ A;  1HNW E;  2ADR A;  2EMX A;  4BC7 A;  3EPK A;  2V83 A;  2JP9 A;  3EPH A;  1FJG E;  2JR1 A;  1HNX E;  4WSG A;  4NXN E;  2MDR A;  2EMW A;  3J80 C;  2JYA A;  2EM9 A;  2EOS A;  3MHH C;  1IQO A;  2ODR C;  2CTD A;  5KL5 A;  4R2A A;  5FLX C;  4R2C A;  2LJU A;  2JVA A;  4P78 A;  4LF6 E;  1A1J A;  1IBK E;  2FTX B;  4DR2 E;  4ZYD A;  4HTG A;  4R2E A;  1NCS A;  1SFE A;  4L5N C;  4LF8 E;  2HC5 A;  4YY3 E;  2L6M A;  5AC4 A;  1UIL A;  3VK6 A;  3KZY A;  4ZYH A;  2EN8 A;  4DR7 E;  4M30 A;  5LLQ A;  1ZU1 A;  4MLV A;  4LFC E;  2IHR 1;  3IWD A;  2YTE A;  1J5E E;  1IMU A;  1XMO E;  4WSP A;  5BR8 E;  2RSI A;  2L3J A;  2V85 A;  1WHQ A;  2EOM A;  4DV2 E;  1IBM E;  2E72 A;  4BC9 A;  2RS6 A;  1X6F A;  1EKZ A;  2YZT A;  4WXC A;  2A25 A;  3BBG A;  2YTO A;  2LBS B;  4DV4 E;  5F3W A;  5AC5 A;  2UUB E;  4Q35 B;  5IXM B;  4X9J A;  4DUY E;  2KHX A;  2WBS A;  1ZBT A;  2EN1 A;  4DV3 E;  2NUF A;  4B3T E;  4DUZ E;  4GKJ E;  2EMG A;  4LF9 E;  2VF1 A;  2L2M A;  4YHH E;  3HPS A;  2Q8U A;  2RSM A;  1T4N A;  4K0K E;  2YTJ A;  4JI1 E;  5ADZ A;  3J7Y p;  5IWA E;  1RMD A;  2YRK A;  1IBL E;  2EMB A;  2NUE A;  1N3G A;  1P47 A;  1X3C A;  1N34 E;  2EPK X;  1WHN A;  2B7T A;  4R2R A;  2YPN A;  2EM2 A;  1AAY A;  3EPJ A;  2YU8 A;  2EM5 A;  1N36 E;  2LO3 A;  5TSE A;  2EOZ A;  2JWO A;  2LTR A;  5KL4 A;  4JI4 E;  2UXB E;  2EOY A;  1RQ0 A;  1G2D C;  1HNZ E;  2NAB A;  2V86 A;  2VQF E;  2F4V E;  4M2Z A;  2EQ0 A;  4M0V A;  2EMH A;  2EL5 A;  3OTO E;  2EOJ A;  2GHF A;  4NXM E;  1IQS A;  2ELY A;  2F8B A;  2N8X A;  2DMY A;  2UXD E;  4ZYG A;  1ZR9 A;  2YRH A;  4I8O A;  2UUC E;  2H36 X;  2MC5 A;  1N33 E;  2EM8 A;  2V8Q B;  1PJS A;  2EPO A;  5AAS A;  2EM7 A;  2EM6 A;  2MDG A;  1FKA E;  2E1M A;  1MGT A;  1EH6 A;  2YTQ A;  3AV0 A;  2K4V A;  2YTF A;  2DGC A;  4DV0 E;  4LTY A;  3VYX A;  2CT1 A;  2DSY A;  3EQ1 A;  3T1Y E;  3ADI A;  4R8O A;  1BB8 A;  3JTZ A;  2YSO A;  2M9A A;  4GEQ B;  2LE2 A;  5A6A A;  2LRS A;  3KWR A;  2EOR A;  4F9C B;  4LU9 A;  1YUI A;  2EPU A;  4R2P A;  2HGH A;  1T4O A;  2FV4 B;  2B9D A;  3LLH A;  4DV6 E;  2EPX A;  1B69 A;  5A6B D;  3ECR A;  2LCE A;  3JU0 A;  3MHS C;  1WXR A;  4OOG C;  2BBG A;  1ZAA C;  3HXL A;  3J81 C;  5CFF E;  3HPZ A;  2GLI A;  1YYO A;  3VHT B;  4WFT A;  1KJK A;  2YTI A;  2B7V A;  4FK5 C;  2EMK A;  1RC7 A;  5A69 A;  1X48 A;  2DIX A;  4R2S A;  2LVH A;  2EQ3 A;  4JYA E;  4WYQ B;  3OML A;  4ZYE A;  2NA2 A;  4X8W A;  4O43 A;  1GZ6 A;  3C6M A;  4DKK A;  2EJ4 A;  2FGG A;  1J26 A;  3ADG A;  2EOE A;  4F9B B;  2DLK A;  3RMP A;  2EP3 A;  3ADJ A;  2YRM A;  2EOX A;  5IV8 B;  3T1H E;  3H09 A;  4KHP E;  1TN9 A;  3BID A;  2KOU A;  2EZ6 A;  1STU A;  5AE2 A;  3FIG A;  4O4K A;  1TF3 A;  5KL2 A;  4F54 A;  5KL7 A;  2EM4 A;  2EPC A;  2EMF A;  2L8T A;  2D9H A;  4BCA A;  2JPA A;  1PJQ A;  4JI0 E;  4R2D A;  1BBG A;  4N4R B;  1X5W A;  2EMY A;  2EM0 A;  2JOX A;  3IWC A;  2UU9 E;  4DR5 E;  4RHB B; 
#chains in the Genus database with same CATH homology
 4Q28 A;  4NXN E;  3OTO E;  2MDR A;  4GKK E;  1UHZ A;  3J80 C;  4NXM E;  2KON A;  2RTX A;  2UXC E;  4OX9 E;  3IWB A;  4DMI A;  2F8B A;  2UUA E;  2DMY A;  2ODR C;  3K6Q A;  4WPY A;  2UXD E;  5FLX C;  4DR4 E;  2WZO A;  4LFA E;  2VE7 C;  4I8O A;  2UUC E;  2H36 X;  2JVA A;  2MC5 A;  4P78 A;  2MC6 A;  3HTX A;  2E5L E;  1N33 E;  2ODR D;  3C4B A;  1HR0 E;  4LF6 E;  2V8Q B;  1T4L B;  1IBK E;  5AAS A;  2LTS A;  2FTX B;  5LMU E;  4DR2 E;  1YYK A;  4X62 E;  1FKA E;  2E1M A;  4L5N C;  2N3G A;  4LF8 E;  3AV0 A;  4YY3 E;  2K4V A;  2L6M A;  3JAM C;  2YT4 A;  2EWL A;  1UIL A;  3VK6 A;  4DR3 E;  4DV0 E;  4LTY A;  3VYX A;  4AQY E;  1QU6 A;  4P7D A;  4DR7 E;  4M30 A;  2V89 A;  2DSY A;  3T1Y E;  2VQE E;  2IHR 1;  2B3T B;  3IWD A;  4LF5 E;  4LFC E;  4R8O A;  3ADI A;  3JTZ A;  2LUP B;  1XMQ E;  1J5E E;  4GEQ B;  2LE2 A;  1XMO E;  4WSP A;  5BR8 E;  2LRS A;  2L3J A;  2M1S A;  3KWR A;  2V85 A;  4JI3 E;  4JV5 E;  1XNQ E;  4F9C B;  1WHQ A;  3ZOQ B;  4J8Z A;  4LU9 A;  4BS9 A;  4DV2 E;  1IBM E;  4JI8 E;  4B3R E;  4BC9 A;  1T4O A;  2FV4 B;  2B9D A;  2RS6 A;  1X47 A;  3LLH A;  3VYY A;  4DV5 E;  4DV6 E;  1EKZ A;  2YZT A;  4TUG A;  3JU0 A;  2LUQ A;  2RS7 A;  2LBS B;  1WXR A;  4OOG C;  3MSW A;  5AE3 A;  4DV4 E;  5F3W A;  4JI2 E;  4BBY A;  2UUB E;  4JI5 E;  3HXL A;  3J81 C;  2L2N A;  5CFF E;  3DF6 A;  3HPZ A;  2KHX A;  4JI7 E;  4DUY E;  5LMN E;  1PKP A;  1YYO A;  4WFT A;  5AE1 A;  3J7A G;  2NUG A;  4TUI A;  2B7V A;  1ZBT A;  4DV3 E;  1RC7 A;  2NUF A;  4B3T E;  1SR9 A;  4DUZ E;  1YZ9 A;  1X48 A;  2DIX A;  2L33 A;  2V87 A;  4LF4 E;  4GKJ E;  2G7H A;  4JYA E;  3P1X A;  4DV7 E;  1GQE A;  4LF9 E;  4WYQ B;  3OML A;  4DR6 E;  2VF1 A;  2NA2 A;  1YYW A;  5DNY A;  4X8W A;  2L2M A;  4YHH E;  1XNR E;  1GZ6 A;  1X49 A;  1O0W A;  3DJW A;  3HPS A;  2RSM A;  1ZBQ A;  4DKK A;  1T4N A;  5LL6 R;  4DV1 E;  4K0K E;  4JI1 E;  5IT9 C;  2JOB A;  3C4T A;  2FGG A;  3HQ1 A;  3LML A;  5ADZ A;  1J26 A;  3F6H A;  2L92 A;  3J7Y p;  3ADG A;  5IWA E;  2N3H A;  4F9B B;  1IBL E;  1DQ3 A;  3RMP A;  3ADJ A;  2JY9 A;  2LJH A;  4L8N A;  2NUE A;  1DI2 A;  2L3C A;  1I94 E;  4LFB E;  3T1H E;  3H09 A;  4KZS A;  1N34 E;  4KHP E;  1WHN A;  2B7T A;  2L2K B;  4B3M E;  4JI6 E;  2KOU A;  2EZ6 A;  4X65 E;  1STU A;  2DB2 A;  4F9A B;  3F6G A;  3FIG A;  5AE2 A;  3ADL A;  4R03 A;  2V88 A;  4F54 A;  4X64 E;  5A2Q C;  4DR1 E;  4LF7 E;  3AUZ A;  2LMZ A;  2L8T A;  1N36 E;  2M7Q A;  4BCA A;  4X66 E;  3IWC A;  4JI0 E;  1HNW E;  2JWO A;  4B3S E;  2LTR A;  2HHH E;  4JI4 E;  4BC7 A;  1N32 E;  2UXB E;  2V83 A;  5T6J A;  1RQ0 A;  4BMJ A;  1HNZ E;  1FJG E;  2V86 A;  2JOX A;  2VQF E;  2JR1 A;  2ZM6 E;  2F4V E;  2M4I A;  4M2Z A;  1HNX E;  2CPN A;  2UU9 E;  4DR5 E;  4M0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...