2EPUA

Solution structure of the secound c2h2 type zinc finger domain of zinc finger protein 32
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
45
structure length
45
Chain Sequence
GSSGSSGTGQKPFECTHCGKSFRAKGNLVTHQRIHTGEKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Zinc finger protein 32
publication title Solution structure of the secound C2H2 type zinc finger domain of Zinc finger protein 32
rcsb
source organism Homo sapiens
total genus 6
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2epuA01
2EMGA 2YTJA 1NCSA 2A25A 1A1KA 2LO3A 2MKNA 2DLQA 1UBDC 2D9HA 2YTNA 2NABA 2EM5A 2EM0A 2ELYA 4R2RA 2EOHA 2JP9A 4R2PA 2EMBA 1RMDA 2ELZA 2MDGA 2JPAA 2EPUA 2YTDA 1MEYC 2GHFA 4FK5C 5KL7A 2EL4A 4F6MA 2GLIA 1KJKA 2MKDA 2DMIA 2RSIA 1ZAAC 4IS1C 2EMCA 2YSPA 2YRMA 2YRHA 1G2DC 2EN2A 2PRTA 2EN1A 2EPAA 2YTQA 2HGHA 2EMIA 3EPHA 5KL6A 2EPRA 2EL6A 1A1JA 2EN7A 1TN9A 2EORA 2EMLA 2EMXA 3VHTB 2CTDA 2EOMA 3MHHC 2YU8A 1YUIA 1LLMC 2EN3A 5KL3A 1A1GA 2YSOA 2I13A 4M9VC 2ENAA 2EN6A 2EMHA 2YTOA 1A1LA 2EOQA 4GZNC 5KL4A 2EMZA 4R2AA 4R2DA 1TF3A 2EMWA 2EM9A 1ZU1A 3EPKA 2R1FA 2DRPA 1X6EA 2VRDA 2EPPA 5KL2A 3EPLA 2EP3A 2YTIA 2EM6A 2EN8A 3UK3C 2LVHA 2EM3A 2YRKA 1YSAC 2M9AA 2EM7A 2EPZA 5KL5A 2WCC3 1TF6A 2WBSA 2EPXA 4IJDA 2WBTA 1Z1BA 1AAYA 1YUJA 2YU5A 2EE8A 2EQ3A 1A1HA 2ADRA 1DGCA 1UN6B 2EQ0A 2EMKA 2EOEA 2E72A 1X6FA 4F2JC 3M99B 1X5WA 2CSHA 2EJ4A 4R2EA 2LT7A 2EMYA 2YTPA 2LV2A 2EOSA 2EPCA 2YTFA 1BB8A 2CT1A 1BBOA 4R2CA 1F2IG 2EM4A 1JK2A 2DGCA 4WSGA 2EN4A 1JK1A 1B69A 2J7JA 1A1FA 2DLKA 2EM2A 2EM8A 2EOIA 2EOJA 2EOOA 2YTGA 2ENHA 4R2SA 4R2QA 1X6HA 2EOXA 1P47A 3MHSC 2LCEA 2EOFA 3EPJA 1ZR9A 2EOZA 4F6NA 1A1IA 2ENCA 1WJPA 2RPCA 2YTEA 2WBUA 2EL5A 1G2FC 2BB8A 1X3CA 4X9JA 2EOYA 2EMAA 2EMFA 2EQ1A
chains in the Genus database with same CATH superfamily
1PDAA 1A1KA 3J81C 2DLQA 5F3WA 1IQOA 2YTNA 3LMLA 1QNTA 2NABA 1XMOE 2EPMX 2ELYA 1N3GA 3T1HE 1BBGA 2EMBA 4M2ZA 2VE7C 4M0VA 2YZTA 2JXPA 1EH7A 2EPUA 5AE1A 2DSYA 1HNXE 1T38A 3THNA 4DV0E 4O4KA 4F6MA 1YZ9A 2DMIA 3IWCA 1T39A 1G2DC 4BHBA 2EN2A 2EWLA 5A69A 4N4RB 2HHHE 3RMPA 2EMIA 2EPRA 2KHXA 4JI4E 2L8TA 1X49A 4KHPE 4JI7E 4I8OA 1TN9A 3VHTB 2N3HA 2YU8A 2L2MA 2FGGA 2G7HA 1KYQA 3HPZA 3C6KA 2EN6A 4L5NC 3KZZA 4DR4E 4DV5E 2EMHA 4NZVA 5KL4A 2E1MA 2LJUA 2EPNA 3BBGA 4O5GA 2EPPA 2L6MA 5KL2A 2EP3A 2K4VA 2YTIA 5A2QC 2YRKA 3AV0A 4GKKE 2N3GA 2WCC3 4F9AB 1STUA 1Z1BA 2LRSA 4JI6E 2YU5A 2EQ3A 3F6GA 2JR1A 2ADRA 4MLQA 1DGCA 3HQ1A 4LF9E 2EMKA 4DUZE 2E72A 1IBME 1YYOA 2Q8UA 5FLXC 3OTOE 2EPCA 2YTFA 4JYAE 4JI8E 1BBOA 5IXMB 3ADJA 1F2IG 4WYQB 2KOUA 2EN4A 1JK1A 2J7JA 1UILA 2DLKA 2EM2A 2EM8A 1A1FA 4R2SA 1IMUA 1X6HA 2JY9A 2YT4A 2EOZA 4B3ME 4F6NA 1PJTA 2V89A 2V86A 1ZBTA 2YTEA 5IV8B 1G2FC 3HPSA 4LTYA 2M4IA 2YRMA 4IJDA 2EMAA 4J8ZA 2EMGA 2LE2A 1NCSA 2LO3A 1UBDC 4LF7E 2EM5A 4L8NA 4JI2E 2NA2A 1EH8A 2EOHA 1HNZE 3AUZA 2EPOA 2WZOA 2FTXB 2HC5A 4O24A 1MEYC 4LFAE 1XNRE 5A6AA 5KL7A 1N34E 2EL4A 2VQEE 3DJWA 1FJGE 2HJJA 3HTXA 1KJKA 4DR6E 4DR5E 4DUYE 3ZOQB 2EMCA 5CFFE 2YRHA 2B7VA 2B7TA 2LMZA 4LFBE 4X8WA 3TQMA 2B9DA 2CPNA 2HGHA 4BS9A 1WXRA 2NUGA 2GPIA 4GKJE 4MLVA 4NXNE 2EMXA 5IT9C 4BHCA 1YYKA 2K7IA 5A6KA 1QU6A 1N32E 2LJHA 1PKPA 3HXLA 4DV4E 3BF2A 4JI5E 4DV6E 4X65E 2YTOA 4DKKA 2NUFA 3ECRA 4R2AA 2DMYA 3THOB 1TF3A 5AC5A 4P78A 1X6EA 3EPLA 2NUEA 3VK6A 4NXME 4DV1E 4LFCE 2UU9E 4K0KE 5KL5A 2EPZA 2WBSA 2EPXA 2WBTA 2UXBE 3ADLA 2L3JA 2RS7A 4BBYA 3FIGA 1X6FA 4F2JC 2JOXA 1YFHA 2RTXA 1T4LB 4ZYGA 1X5WA 2I9IA 2LT7A 4Q28A 3J7Yp 4B3SE 2LV2A 2EOSA 4YY3E 2L2NA 2CT1A 4R2CA 3J80C 5DNYA 4BMJA 2DGCA 4WSGA 4ZYEA 1AH5A 3QG5C 1SFEA 1IBKE 4NHRA 4WFTA 1GZ6A 4AQYE 1YPNA 4JI1E 4R2QA 4WXDA 1HR0E 1P47A 3MSWA 2KONA 1N36E 1PJQA 2E5LE 3EPJA 3ADIA 2JYAA 3EQ1A 1RQ0A 5A6JA 2WBUA 2EL5A 1X3CA 4LF8E 2EOYA 2A25A 2JWOA 4HTGA 1IBLE 5LLQA 2B3TB 2L3CA 4R2RA 3KZYA 4R2PA 2MDGA 4KZSA 2YTDA 1PJSA 2YPNA 2GHFA 4FK5C 2F8BA 4OOGC 4HEIA 4ZYHA 2ODRC 2DB2A 2L92A 3F6HA 4BC9A 2M1SA 5AE3A 2IHR1 4DR3E 1J26A 3JAMC 2EN1A 2YTQA 2UXCE 1RC7A 3EPHA 5KL6A 4X62E 2EPLX 1WRJA 1A1JA 4F54A 4BCAA 1YYWA 2CTDA 2EOMA 2MDRA 2MC5A 4JI0E 1EKZA 4OX9E 4P7DA 1LLMC 5KL3A 1A1GA 4DV3E 2YSOA 4F9BB 2LTSA 2I13A 4M9VC 2ENAA 4LF4E 3KWRA 2EOQA 4Q35B 2EMZA 1L4SA 2RSMA 3EPKA 4B3RE 3J7AG 2DRPA 1X48A 1SR9A 2EM6A 2EN8A 3UK3C 2EM3A 4R8OA 1YSAC 2UUBE 1AAYA 2R76A 4GEQB 2VF1A 1A1HA 4DR1E 5T6JA 2YWQA 4JV5E 5LMUE 4R03A 5AE2A 3BIDA 4F9CB 3M99B 2CSHA 2EJ4A 4R2EA 1HNWE 2UXDE 2V8QB 1BB8A 2EZ6A 4KWYA 2UUCE 2EM4A 2EPKX 4BC7A 1JK2A 1B69A 3JU0A 4LF5E 5AASA 2EOIA 2EOOA 1N33E 1EH6A 4ZYDA 2EOXA 2FV4B 3H09A 2V87A 3MHSC 2LCEA 2M7QA 4YHHE 3L00A 1A1IA 2ENCA 4LU9A 2RPCA 3P1XA 1GQEA 1XNQE 2EMFA 2EQ1A 3BGHA 1I94E 2YTJA 2N8XA 2MKNA 4WSPA 1UHZA 2D9HA 4B3TE 2EM0A 4X66E 1DQ3A 2JP9A 4TUIA 5IWAE 2UUAE 3VYYA 1RMDA 2ELZA 2LUQA 2JPAA 3JTZA 5LMNE 4LF6E 1X47A 3K6QA 5LL6R 1T4NA 2LUPB 4M30A 2GLIA 2DIXA 2MKDA 1WHQA 2RSIA 1ZAAC 4IS1C 2YSPA 1T4OA 1IQSA 4DV7E 2PRTA 2EPAA 1DI2A 2H36X 2ODRD 3LLHA 1GTKA 2RS6A 2EL6A 2EN7A 4DV2E 2EORA 2EMLA 1ZBQA 3IWDA 3MHHC 1YUIA 2BBGA 2EN3A 3IWBA 4JI3E 3DF6A 3ADGA 5AC4A 2F4VE 3OMLA 1A1LA 2V83A 1MGTA 4GZNC 1WHNA 2JVAA 4R2DA 2RQLA 2EMWA 2EM9A 1ZU1A 4O43A 2R1FA 4DR2E 2VRDA 2LTRA 2LVHA 5A6BA 1J5EE 4RHBB 4RH8A 5BR8E 2M9AA 2EM7A 1TF6A 3C4TA 1YUJA 3T1YE 4WPYA 1XMQE 2EE8A 1UN6B 2EQ0A 2EOEA 5ADZA 5TSEA 2VQFE 4TUGA 2EMYA 2YTPA 2ZM6E 2V85A 4WXCA 2LBSB 2L33A 2EOJA 2YTGA 2ENHA 5A6BD 1NEIA 1O0WA 2EOFA 1ZR9A 3C4BA 4WX9A 1FKAE 4X64E 2L2KB 1WJPA 3C6MA 4DR7E 2V88A 2MC6A 2JOBA 3VYXA 2BB8A 4DMIA 4X9JA
chains in the Genus database with same CATH topology
2EMGA 2YTJA 1NCSA 2A25A 1A1KA 2LO3A 2MKNA 2DLQA 1UBDC 2D9HA 2YTNA 2NABA 2EM5A 2EM0A 2ELYA 4R2RA 2EOHA 2JP9A 4R2PA 2EMBA 1RMDA 2ELZA 2MDGA 2JPAA 2EPUA 2YTDA 1MEYC 2GHFA 4FK5C 5KL7A 2EL4A 4F6MA 2GLIA 1KJKA 2MKDA 2DMIA 2RSIA 1ZAAC 4IS1C 2EMCA 2YSPA 2YRMA 2YRHA 1G2DC 2EN2A 2PRTA 2EN1A 2EPAA 2YTQA 2HGHA 2EMIA 3EPHA 5KL6A 2EPRA 2EL6A 1A1JA 2EN7A 1TN9A 2EORA 2EMLA 2EMXA 3VHTB 2CTDA 2EOMA 3MHHC 2YU8A 1YUIA 1LLMC 2EN3A 5KL3A 1A1GA 2YSOA 2I13A 4M9VC 2ENAA 2EN6A 2EMHA 2YTOA 1A1LA 2EOQA 4GZNC 5KL4A 2EMZA 4R2AA 4R2DA 1TF3A 2EMWA 2EM9A 1ZU1A 3EPKA 2R1FA 2DRPA 1X6EA 2VRDA 2EPPA 5KL2A 3EPLA 2EP3A 2YTIA 2EM6A 2EN8A 3UK3C 2LVHA 2EM3A 2YRKA 1YSAC 2M9AA 2EM7A 2EPZA 5KL5A 2WCC3 1TF6A 2WBSA 2EPXA 4IJDA 2WBTA 1Z1BA 1AAYA 1YUJA 2YU5A 2EE8A 2EQ3A 1A1HA 2ADRA 1DGCA 1UN6B 2EQ0A 2EMKA 2EOEA 2E72A 1X6FA 4F2JC 3M99B 1X5WA 2CSHA 2EJ4A 4R2EA 2LT7A 2EMYA 2YTPA 2LV2A 2EOSA 2EPCA 2YTFA 1BB8A 2CT1A 1BBOA 4R2CA 1F2IG 2EM4A 1JK2A 2DGCA 4WSGA 2EN4A 1JK1A 1B69A 2J7JA 1A1FA 2DLKA 2EM2A 2EM8A 2EOIA 2EOJA 2EOOA 2YTGA 2ENHA 4R2SA 4R2QA 1X6HA 2EOXA 1P47A 3MHSC 2LCEA 2EOFA 3EPJA 1ZR9A 2EOZA 4F6NA 1A1IA 2ENCA 1WJPA 2RPCA 2YTEA 2WBUA 2EL5A 1G2FC 2BB8A 1X3CA 4X9JA 2EOYA 2EMAA 2EMFA 2EQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMG A;  2YTJ A;  1NCS A;  2A25 A;  1A1K A;  2LO3 A;  2MKN A;  2DLQ A;  1UBD C;  2D9H A;  2YTN A;  2NAB A;  2EM5 A;  2EM0 A;  2ELY A;  4R2R A;  2EOH A;  2JP9 A;  4R2P A;  2EMB A;  1RMD A;  2ELZ A;  2MDG A;  2JPA A;  2EPU A;  2YTD A;  1MEY C;  2GHF A;  4FK5 C;  5KL7 A;  2EL4 A;  4F6M A;  2GLI A;  1KJK A;  2MKD A;  2DMI A;  2RSI A;  1ZAA C;  4IS1 C;  2EMC A;  2YSP A;  2YRM A;  2YRH A;  1G2D C;  2EN2 A;  2PRT A;  2EN1 A;  2EPA A;  2YTQ A;  2HGH A;  2EMI A;  3EPH A;  5KL6 A;  2EPR A;  2EL6 A;  1A1J A;  2EN7 A;  1TN9 A;  2EOR A;  2EML A;  2EMX A;  3VHT B;  2CTD A;  2EOM A;  3MHH C;  2YU8 A;  1YUI A;  1LLM C;  2EN3 A;  5KL3 A;  1A1G A;  2YSO A;  2I13 A;  4M9V C;  2ENA A;  2EN6 A;  2EMH A;  2YTO A;  1A1L A;  2EOQ A;  4GZN C;  5KL4 A;  2EMZ A;  4R2A A;  4R2D A;  1TF3 A;  2EMW A;  2EM9 A;  1ZU1 A;  3EPK A;  2R1F A;  2DRP A;  1X6E A;  2VRD A;  2EPP A;  5KL2 A;  3EPL A;  2EP3 A;  2YTI A;  2EM6 A;  2EN8 A;  3UK3 C;  2LVH A;  2EM3 A;  2YRK A;  1YSA C;  2M9A A;  2EM7 A;  2EPZ A;  5KL5 A;  2WCC 3;  1TF6 A;  2WBS A;  2EPX A;  4IJD A;  2WBT A;  1Z1B A;  1AAY A;  1YUJ A;  2YU5 A;  2EE8 A;  2EQ3 A;  1A1H A;  2ADR A;  1DGC A;  1UN6 B;  2EQ0 A;  2EMK A;  2EOE A;  2E72 A;  1X6F A;  4F2J C;  3M99 B;  1X5W A;  2CSH A;  2EJ4 A;  4R2E A;  2LT7 A;  2EMY A;  2YTP A;  2LV2 A;  2EOS A;  2EPC A;  2YTF A;  1BB8 A;  2CT1 A;  1BBO A;  4R2C A;  1F2I G;  2EM4 A;  1JK2 A;  2DGC A;  4WSG A;  2EN4 A;  1JK1 A;  1B69 A;  2J7J A;  1A1F A;  2DLK A;  2EM2 A;  2EM8 A;  2EOI A;  2EOJ A;  2EOO A;  2YTG A;  2ENH A;  4R2S A;  4R2Q A;  1X6H A;  2EOX A;  1P47 A;  3MHS C;  2LCE A;  2EOF A;  3EPJ A;  1ZR9 A;  2EOZ A;  4F6N A;  1A1I A;  2ENC A;  1WJP A;  2RPC A;  2YTE A;  2WBU A;  2EL5 A;  1G2F C;  2BB8 A;  1X3C A;  4X9J A;  2EOY A;  2EMA A;  2EMF A;  2EQ1 A; 
#chains in the Genus database with same CATH topology
 1PDA A;  1A1K A;  3J81 C;  2DLQ A;  5F3W A;  1IQO A;  2YTN A;  3LML A;  1QNT A;  2NAB A;  1XMO E;  2EPM X;  2ELY A;  1N3G A;  3T1H E;  1BBG A;  2EMB A;  4M2Z A;  2VE7 C;  4M0V A;  2YZT A;  2JXP A;  1EH7 A;  2EPU A;  5AE1 A;  2DSY A;  1HNX E;  1T38 A;  3THN A;  4DV0 E;  4O4K A;  4F6M A;  1YZ9 A;  2DMI A;  3IWC A;  1T39 A;  1G2D C;  4BHB A;  2EN2 A;  2EWL A;  5A69 A;  4N4R B;  2HHH E;  3RMP A;  2EMI A;  2EPR A;  2KHX A;  4JI4 E;  2L8T A;  1X49 A;  4KHP E;  4JI7 E;  4I8O A;  1TN9 A;  3VHT B;  2N3H A;  2YU8 A;  2L2M A;  2FGG A;  2G7H A;  1KYQ A;  3HPZ A;  3C6K A;  2EN6 A;  4L5N C;  3KZZ A;  4DR4 E;  4DV5 E;  2EMH A;  4NZV A;  5KL4 A;  2E1M A;  2LJU A;  2EPN A;  3BBG A;  4O5G A;  2EPP A;  2L6M A;  5KL2 A;  2EP3 A;  2K4V A;  2YTI A;  5A2Q C;  2YRK A;  3AV0 A;  4GKK E;  2N3G A;  2WCC 3;  4F9A B;  1STU A;  1Z1B A;  2LRS A;  4JI6 E;  2YU5 A;  2EQ3 A;  3F6G A;  2JR1 A;  2ADR A;  4MLQ A;  1DGC A;  3HQ1 A;  4LF9 E;  2EMK A;  4DUZ E;  2E72 A;  1IBM E;  1YYO A;  2Q8U A;  5FLX C;  3OTO E;  2EPC A;  2YTF A;  4JYA E;  4JI8 E;  1BBO A;  5IXM B;  3ADJ A;  1F2I G;  4WYQ B;  2KOU A;  2EN4 A;  1JK1 A;  2J7J A;  1UIL A;  2DLK A;  2EM2 A;  2EM8 A;  1A1F A;  4R2S A;  1IMU A;  1X6H A;  2JY9 A;  2YT4 A;  2EOZ A;  4B3M E;  4F6N A;  1PJT A;  2V89 A;  2V86 A;  1ZBT A;  2YTE A;  5IV8 B;  1G2F C;  3HPS A;  4LTY A;  2M4I A;  2YRM A;  4IJD A;  2EMA A;  4J8Z A;  2EMG A;  2LE2 A;  1NCS A;  2LO3 A;  1UBD C;  4LF7 E;  2EM5 A;  4L8N A;  4JI2 E;  2NA2 A;  1EH8 A;  2EOH A;  1HNZ E;  3AUZ A;  2EPO A;  2WZO A;  2FTX B;  2HC5 A;  4O24 A;  1MEY C;  4LFA E;  1XNR E;  5A6A A;  5KL7 A;  1N34 E;  2EL4 A;  2VQE E;  3DJW A;  1FJG E;  2HJJ A;  3HTX A;  1KJK A;  4DR6 E;  4DR5 E;  4DUY E;  3ZOQ B;  2EMC A;  5CFF E;  2YRH A;  2B7V A;  2B7T A;  2LMZ A;  4LFB E;  4X8W A;  3TQM A;  2B9D A;  2CPN A;  2HGH A;  4BS9 A;  1WXR A;  2NUG A;  2GPI A;  4GKJ E;  4MLV A;  4NXN E;  2EMX A;  5IT9 C;  4BHC A;  1YYK A;  2K7I A;  5A6K A;  1QU6 A;  1N32 E;  2LJH A;  1PKP A;  3HXL A;  4DV4 E;  3BF2 A;  4JI5 E;  4DV6 E;  4X65 E;  2YTO A;  4DKK A;  2NUF A;  3ECR A;  4R2A A;  2DMY A;  3THO B;  1TF3 A;  5AC5 A;  4P78 A;  1X6E A;  3EPL A;  2NUE A;  3VK6 A;  4NXM E;  4DV1 E;  4LFC E;  2UU9 E;  4K0K E;  5KL5 A;  2EPZ A;  2WBS A;  2EPX A;  2WBT A;  2UXB E;  3ADL A;  2L3J A;  2RS7 A;  4BBY A;  3FIG A;  1X6F A;  4F2J C;  2JOX A;  1YFH A;  2RTX A;  1T4L B;  4ZYG A;  1X5W A;  2I9I A;  2LT7 A;  4Q28 A;  3J7Y p;  4B3S E;  2LV2 A;  2EOS A;  4YY3 E;  2L2N A;  2CT1 A;  4R2C A;  3J80 C;  5DNY A;  4BMJ A;  2DGC A;  4WSG A;  4ZYE A;  1AH5 A;  3QG5 C;  1SFE A;  1IBK E;  4NHR A;  4WFT A;  1GZ6 A;  4AQY E;  1YPN A;  4JI1 E;  4R2Q A;  4WXD A;  1HR0 E;  1P47 A;  3MSW A;  2KON A;  1N36 E;  1PJQ A;  2E5L E;  3EPJ A;  3ADI A;  2JYA A;  3EQ1 A;  1RQ0 A;  5A6J A;  2WBU A;  2EL5 A;  1X3C A;  4LF8 E;  2EOY A;  2A25 A;  2JWO A;  4HTG A;  1IBL E;  5LLQ A;  2B3T B;  2L3C A;  4R2R A;  3KZY A;  4R2P A;  2MDG A;  4KZS A;  2YTD A;  1PJS A;  2YPN A;  2GHF A;  4FK5 C;  2F8B A;  4OOG C;  4HEI A;  4ZYH A;  2ODR C;  2DB2 A;  2L92 A;  3F6H A;  4BC9 A;  2M1S A;  5AE3 A;  2IHR 1;  4DR3 E;  1J26 A;  3JAM C;  2EN1 A;  2YTQ A;  2UXC E;  1RC7 A;  3EPH A;  5KL6 A;  4X62 E;  2EPL X;  1WRJ A;  1A1J A;  4F54 A;  4BCA A;  1YYW A;  2CTD A;  2EOM A;  2MDR A;  2MC5 A;  4JI0 E;  1EKZ A;  4OX9 E;  4P7D A;  1LLM C;  5KL3 A;  1A1G A;  4DV3 E;  2YSO A;  4F9B B;  2LTS A;  2I13 A;  4M9V C;  2ENA A;  4LF4 E;  3KWR A;  2EOQ A;  4Q35 B;  2EMZ A;  1L4S A;  2RSM A;  3EPK A;  4B3R E;  3J7A G;  2DRP A;  1X48 A;  1SR9 A;  2EM6 A;  2EN8 A;  3UK3 C;  2EM3 A;  4R8O A;  1YSA C;  2UUB E;  1AAY A;  2R76 A;  4GEQ B;  2VF1 A;  1A1H A;  4DR1 E;  5T6J A;  2YWQ A;  4JV5 E;  5LMU E;  4R03 A;  5AE2 A;  3BID A;  4F9C B;  3M99 B;  2CSH A;  2EJ4 A;  4R2E A;  1HNW E;  2UXD E;  2V8Q B;  1BB8 A;  2EZ6 A;  4KWY A;  2UUC E;  2EM4 A;  2EPK X;  4BC7 A;  1JK2 A;  1B69 A;  3JU0 A;  4LF5 E;  5AAS A;  2EOI A;  2EOO A;  1N33 E;  1EH6 A;  4ZYD A;  2EOX A;  2FV4 B;  3H09 A;  2V87 A;  3MHS C;  2LCE A;  2M7Q A;  4YHH E;  3L00 A;  1A1I A;  2ENC A;  4LU9 A;  2RPC A;  3P1X A;  1GQE A;  1XNQ E;  2EMF A;  2EQ1 A;  3BGH A;  1I94 E;  2YTJ A;  2N8X A;  2MKN A;  4WSP A;  1UHZ A;  2D9H A;  4B3T E;  2EM0 A;  4X66 E;  1DQ3 A;  2JP9 A;  4TUI A;  5IWA E;  2UUA E;  3VYY A;  1RMD A;  2ELZ A;  2LUQ A;  2JPA A;  3JTZ A;  5LMN E;  4LF6 E;  1X47 A;  3K6Q A;  5LL6 R;  1T4N A;  2LUP B;  4M30 A;  2GLI A;  2DIX A;  2MKD A;  1WHQ A;  2RSI A;  1ZAA C;  4IS1 C;  2YSP A;  1T4O A;  1IQS A;  4DV7 E;  2PRT A;  2EPA A;  1DI2 A;  2H36 X;  2ODR D;  3LLH A;  1GTK A;  2RS6 A;  2EL6 A;  2EN7 A;  4DV2 E;  2EOR A;  2EML A;  1ZBQ A;  3IWD A;  3MHH C;  1YUI A;  2BBG A;  2EN3 A;  3IWB A;  4JI3 E;  3DF6 A;  3ADG A;  5AC4 A;  2F4V E;  3OML A;  1A1L A;  2V83 A;  1MGT A;  4GZN C;  1WHN A;  2JVA A;  4R2D A;  2RQL A;  2EMW A;  2EM9 A;  1ZU1 A;  4O43 A;  2R1F A;  4DR2 E;  2VRD A;  2LTR A;  2LVH A;  5A6B A;  1J5E E;  4RHB B;  4RH8 A;  5BR8 E;  2M9A A;  2EM7 A;  1TF6 A;  3C4T A;  1YUJ A;  3T1Y E;  4WPY A;  1XMQ E;  2EE8 A;  1UN6 B;  2EQ0 A;  2EOE A;  5ADZ A;  5TSE A;  2VQF E;  4TUG A;  2EMY A;  2YTP A;  2ZM6 E;  2V85 A;  4WXC A;  2LBS B;  2L33 A;  2EOJ A;  2YTG A;  2ENH A;  5A6B D;  1NEI A;  1O0W A;  2EOF A;  1ZR9 A;  3C4B A;  4WX9 A;  1FKA E;  4X64 E;  2L2K B;  1WJP A;  3C6M A;  4DR7 E;  2V88 A;  2MC6 A;  2JOB A;  3VYX A;  2BB8 A;  4DMI A;  4X9J A; 
#chains in the Genus database with same CATH homology
 2EMG A;  2YTJ A;  1NCS A;  2A25 A;  1A1K A;  2LO3 A;  2MKN A;  2DLQ A;  1UBD C;  2D9H A;  2YTN A;  2NAB A;  2EM5 A;  2EM0 A;  2ELY A;  4R2R A;  2EOH A;  2JP9 A;  4R2P A;  2EMB A;  1RMD A;  2ELZ A;  2MDG A;  2JPA A;  2EPU A;  2YTD A;  1MEY C;  2GHF A;  4FK5 C;  5KL7 A;  2EL4 A;  4F6M A;  2GLI A;  1KJK A;  2MKD A;  2DMI A;  2RSI A;  1ZAA C;  4IS1 C;  2EMC A;  2YSP A;  2YRM A;  2YRH A;  1G2D C;  2EN2 A;  2PRT A;  2EN1 A;  2EPA A;  2YTQ A;  2HGH A;  2EMI A;  3EPH A;  5KL6 A;  2EPR A;  2EL6 A;  1A1J A;  2EN7 A;  1TN9 A;  2EOR A;  2EML A;  2EMX A;  3VHT B;  2CTD A;  2EOM A;  3MHH C;  2YU8 A;  1YUI A;  1LLM C;  2EN3 A;  5KL3 A;  1A1G A;  2YSO A;  2I13 A;  4M9V C;  2ENA A;  2EN6 A;  2EMH A;  2YTO A;  1A1L A;  2EOQ A;  4GZN C;  5KL4 A;  2EMZ A;  4R2A A;  4R2D A;  1TF3 A;  2EMW A;  2EM9 A;  1ZU1 A;  3EPK A;  2R1F A;  2DRP A;  1X6E A;  2VRD A;  2EPP A;  5KL2 A;  3EPL A;  2EP3 A;  2YTI A;  2EM6 A;  2EN8 A;  3UK3 C;  2LVH A;  2EM3 A;  2YRK A;  1YSA C;  2M9A A;  2EM7 A;  2EPZ A;  5KL5 A;  2WCC 3;  1TF6 A;  2WBS A;  2EPX A;  4IJD A;  2WBT A;  1Z1B A;  1AAY A;  1YUJ A;  2YU5 A;  2EE8 A;  2EQ3 A;  1A1H A;  2ADR A;  1DGC A;  1UN6 B;  2EQ0 A;  2EMK A;  2EOE A;  2E72 A;  1X6F A;  4F2J C;  3M99 B;  1X5W A;  2CSH A;  2EJ4 A;  4R2E A;  2LT7 A;  2EMY A;  2YTP A;  2LV2 A;  2EOS A;  2EPC A;  2YTF A;  1BB8 A;  2CT1 A;  1BBO A;  4R2C A;  1F2I G;  2EM4 A;  1JK2 A;  2DGC A;  4WSG A;  2EN4 A;  1JK1 A;  1B69 A;  2J7J A;  1A1F A;  2DLK A;  2EM2 A;  2EM8 A;  2EOI A;  2EOJ A;  2EOO A;  2YTG A;  2ENH A;  4R2S A;  4R2Q A;  1X6H A;  2EOX A;  1P47 A;  3MHS C;  2LCE A;  2EOF A;  3EPJ A;  1ZR9 A;  2EOZ A;  4F6N A;  1A1I A;  2ENC A;  1WJP A;  2RPC A;  2YTE A;  2WBU A;  2EL5 A;  1G2F C;  2BB8 A;  1X3C A;  4X9J A;  2EOY A;  2EMA A;  2EMF A;  2EQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...