2EPUA

Solution structure of the secound c2h2 type zinc finger domain of zinc finger protein 32
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
45
structure length
45
Chain Sequence
GSSGSSGTGQKPFECTHCGKSFRAKGNLVTHQRIHTGEKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the secound C2H2 type zinc finger domain of Zinc finger protein 32
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 32
total genus 6
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2epuA01
2EORA 5KL4A 2EQ3A 2YSPA 4F2JC 1NCSA 2YRHA 1BB8A 2EN7A 4FK5C 1TF3A 2EM2A 2EOHA 2LCEA 2EN8A 4M9VC 2EJ4A 2WBTA 2YRKA 4R2DA 2D9HA 2EN3A 3UK3C 2EPPA 2WBSA 2EMXA 1X3CA 2EM7A 2EQ1A 1JK1A 1RMDA 1A1HA 2YSOA 2EOEA 4IS1C 3EPHA 1DGCA 2JPAA 1A1GA 1X6EA 2EOJA 2PRTA 4GZNC 1X6HA 3M99B 2HGHA 2YTIA 2EOXA 2EE8A 2LO3A 2YU5A 2BB8A 2EM6A 2MKDA 2DGCA 2EM4A 3EPKA 2EMZA 4R2SA 2GHFA 1YUIA 2CSHA 2LT7A 2ENAA 2EOQA 2EPXA 2YTPA 2YTJA 2EPCA 3MHHC 2E72A 1BBOA 1A1JA 1P47A 1TF6A 1G2FC 2RSIA 2EMLA 2EOSA 4IJDA 2EN6A 2YTFA 2NABA 2EOIA 4R2RA 2EOOA 2EM5A 3MHSC 1B69A 2EL4A 5KL2A 2EL5A 2YTEA 2YTGA 2EMKA 3EPLA 2ENHA 1YUJA 1KJKA 2JP9A 2J7JA 2EOMA 2EMIA 2EN2A 2MKNA 2EMYA 1YSAC 1ZAAC 2LV2A 1A1IA 2M9AA 4R2QA 2EMHA 2EMGA 3VHTB 2DMIA 2LVHA 2YTOA 2EOYA 4WSGA 2ADRA 2EMBA 2DRPA 2MDGA 2EMAA 2EMCA 2EQ0A 2EPZA 4R2AA 1A1LA 2EPUA 2CTDA 2GLIA 2EP3A 2EN4A 1UBDC 2EM3A 4R2EA 2WBUA 2R1FA 2YTNA 2DLKA 1WJPA 2EMWA 4F6MA 2EOFA 2EPRA 2EM9A 2ELZA 1Z1BA 2I13A 1TN9A 1X5WA 5KL7A 2EL6A 1G2DC 1MEYC 2YRMA 2WCC3 2RPCA 2EOZA 1A1KA 2DLQA 2YU8A 1A1FA 1AAYA 1ZU1A 2CT1A 2EMFA 2ELYA 2EPAA 5KL3A 5KL6A 1JK2A 2EM0A 4R2CA 2YTQA 2YTDA 2EN1A 2VRDA 1UN6B 4X9JA 5KL5A 2A25A 1X6FA 4F6NA 1F2IG 4R2PA 3EPJA 2EM8A 2ENCA 1ZR9A 1LLMC
chains in the Genus database with same CATH superfamily
1N34E 5AE3A 3IWBA 5A6BD 2ODRC 3F6GA 4DKKA 2UXBE 1NEIA 2MC6A 1I94E 4OX9E 2KONA 4JV5E 3K6QA 4R8OA 2EM2A 2RSMA 5F3WA 5IT9C 2WBTA 4R2DA 2UXCE 2D9HA 2EN3A 4LFBE 4BCAA 1EH7A 2B9DA 1EKZA 2L3JA 1A1HA 4DR2E 2VF1A 2YSOA 3EPHA 4WYQB 2ODRD 1A1GA 1XNRE 4GZNC 1X6HA 1N36E 5TSEA 1IQSA 2EOXA 2EE8A 5A6JA 2YU5A 1RQ0A 2BB8A 4GKKE 2NUEA 2UU9E 4JI6E 2CSHA 4BC7A 2EPKX 4WXCA 3LMLA 2EPCA 4F9AB 2JY9A 2EPMX 2EMLA 2YTFA 4B3SE 2EM5A 3ECRA 5A6KA 5AC4A 2YTEA 2V83A 2ENHA 4X62E 2JP9A 3KZZA 4JI8E 3FIGA 2F4VE 4R2QA 4Q28A 2EMHA 1HNWE 2MDGA 2L3CA 2CTDA 2EPUA 2RS7A 4O4KA 4TUIA 1T4OA 4LFCE 2EN4A 4R2EA 2WBUA 2YTNA 4X65E 1IMUA 2YZTA 1QU6A 1TN9A 4BMJA 1DQ3A 1KYQA 4DMIA 1X48A 2WCC3 4JI3E 1A1KA 1A1FA 2CT1A 2EPAA 4NHRA 3AV0A 2EM0A 4NXME 2YTQA 4X9JA 2A25A 4R2PA 1PKPA 1XNQE 3EPJA 2M1SA 1HNZE 1YYKA 2EORA 5LMUE 3AUZA 5KL4A 1GTKA 2JXPA 4F2JC 3J81C 1FJGE 1BB8A 4FK5C 3JU0A 1ZBTA 2EN8A 2LCEA 1T4NA 4YY3E 4MLQA 2R76A 4JYAE 2L2KB 4B3RE 5A69A 3HQ1A 2V88A 1X3CA 2V8QB 4DV1E 2JR1A 4IS1C 2NUFA 2LMZA 2M7QA 5A6AA 1GZ6A 4TUGA 2KOUA 1DGCA 3H09A 2JPAA 1X6EA 2PRTA 2HC5A 4B3ME 2E5LE 4NXNE 1YPNA 3ADLA 2G7HA 2YTIA 5FLXC 1N32E 5LL6R 2EWLA 2DGCA 2EM4A 4R2SA 4J8ZA 3THNA 2ENAA 3DF6A 2EOQA 4ZYEA 4DV7E 2EZ6A 1BBOA 4HEIA 1TF6A 1HNXE 1G2FC 3OMLA 2EN6A 4LF6E 2JOBA 1AH5A 4JI0E 1BBGA 2EL4A 2L6MA 4X66E 2EL5A 4WFTA 3THOB 4P78A 1KJKA 1N3GA 1WRJA 2EMIA 1YSAC 4DUZE 2LUPB 2FV4B 2M9AA 4DV0E 2EMGA 2V86A 4M0VA 2DMIA 2UUBE 2YTOA 2DMYA 3ADJA 2ADRA 2EMBA 4DV6E 2UUAE 2EQ0A 3KZYA 2IHR1 3BF2A 4LF7E 1UBDC 2NA2A 4R03A 2LE2A 1WJPA 4F6MA 1Z1BA 3HPZA 1X5WA 2RQLA 2EL6A 1G2DC 2YWQA 2H36X 2EOZA 5T6JA 1ZU1A 2ELYA 4WPYA 3ADGA 2B3TB 5ADZA 1JK2A 4DV4E 4R2CA 4O43A 4GKJE 2EN1A 2VRDA 1PJSA 4F6NA 1X6FA 2KHXA 5AE1A 2ENCA 4O5GA 5IV8B 3VYXA 1YYWA 4F9CB 5A2QC 4GEQB 2NUGA 2LTRA 4BBYA 4YHHE 4KHPE 2LJHA 2BBGA 4BS9A 3C4TA 1TF3A 2N3HA 4JI5E 1IBME 2DB2A 4DR3E 2N8XA 4ZYHA 5LMNE 2EPPA 2WBSA 4NZVA 2EM7A 1JK1A 1T39A 2LBSB 3T1HE 2V89A 2FTXB 1YZ9A 1IBKE 2LJUA 2RS6A 3M99B 5CFFE 2LO3A 2N3GA 3JTZA 3P1XA 2MKDA 4P7DA 2EMZA 1YUIA 2Q8UA 2LT7A 3BBGA 3J7AG 2EPXA 4LF5E 2YTJA 2VQEE 2E72A 4JI7E 2YT4A 3KWRA 1P47A 3LLHA 4KWYA 4IJDA 2EOIA 2EPLX 4R2RA 3C6KA 3MHSC 5KL2A 2RTXA 2EMKA 3EPLA 1UILA 2J7JA 2EOMA 2WZOA 4M30A 2EMYA 1ZAAC 4WSPA 4LF9E 3VHTB 4BC9A 2EPNA 2LVHA 1SFEA 4WSGA 2UUCE 1WHNA 2EPOA 4WX9A 4LF8E 1MGTA 4R2AA 2GLIA 2JWOA 2R1FA 1J5EE 3L00A 4LTYA 3RMPA 4OOGC 4DR7E 2EOFA 2EPRA 2HJJA 2EM9A 2ELZA 2I13A 3F6HA 5KL7A 4DR6E 2B7TA 2RPCA 4Q35B 3HTXA 4BHCA 1WXRA 4MLVA 1X47A 1T38A 1AAYA 5AASA 3DJWA 3JAMC 2UXDE 3IWCA 2K7IA 2YTDA 1UN6B 5KL5A 5A6BA 3T1YE 2F8BA 1GQEA 2B7VA 1IBLE 2EQ3A 2YSPA 1FKAE 3EQ1A 2MDRA 3IWDA 1NCSA 2VE7C 2YRHA 2L33A 4DUYE 2E1MA 2EN7A 1PJQA 3C6MA 2EOHA 3J7Yp 4M9VC 1O0WA 2EJ4A 4LFAE 2JOXA 2V87A 2YRKA 5IWAE 3UK3C 1HR0E 2EMXA 3C4BA 2EQ1A 1RMDA 2EOEA 2M4IA 4JI1E 1SR9A 2CPNA 3TQMA 4DR4E 2MC5A 1STUA 4BHBA 2EOJA 1YYOA 2V85A 1EH8A 2HGHA 4RH8A 4KZSA 4I8OA 1DI2A 4DR5E 4RHBB 2EM6A 3HXLA 4L8NA 4LU9A 3EPKA 1YFHA 2GHFA 1XMQE 4JI4E 2I9IA 4DV2E 4X8WA 4ZYGA 2YTPA 1EH6A 1PDAA 3MHHC 2JVAA 1A1JA 4M2ZA 2GPIA 2RSIA 2LRSA 2EOSA 4N4RB 3VK6A 5AE2A 5BR8E 1IQOA 2NABA 2EOOA 4LF4E 3J80C 1B69A 1RC7A 4DV3E 1J26A 2YTGA 2DIXA 2YPNA 3OTOE 2LUQA 4ZYDA 1YUJA 1WHQA 2VQFE 2LTSA 3ADIA 3BGHA 1N33E 5LLQA 2EN2A 4F54A 2MKNA 2LV2A 4X64E 1A1IA 5DNYA 3BIDA 5IXMB 2L2NA 1T4LB 3HPSA 4O24A 2DSYA 2FGGA 2EOYA 4K0KE 4L5NC 2JYAA 2DRPA 4DR1E 2EMAA 2EMCA 1UHZA 2EPZA 1A1LA 4WXDA 2EP3A 2L8TA 2EM3A 2DLKA 5AC5A 2EMWA 1QNTA 4HTGA 3ZOQB 1MEYC 2YRMA 1X49A 1ZBQA 2DLQA 2YU8A 4B3TE 4F9BB 2EMFA 2ZM6E 2HHHE 2L92A 3MSWA 5KL3A 5KL6A 1XMOE 4JI2E 4DV5E 2L2MA 2K4VA 4AQYE 1F2IG 1L4SA 1PJTA 2EM8A 3QG5C 1ZR9A 3VYYA 1LLMC
chains in the Genus database with same CATH topology
2EORA 5KL4A 2EQ3A 2YSPA 4F2JC 1NCSA 2YRHA 1BB8A 2EN7A 4FK5C 1TF3A 2EM2A 2EOHA 2LCEA 2EN8A 4M9VC 2EJ4A 2WBTA 2YRKA 4R2DA 2D9HA 2EN3A 3UK3C 2EPPA 2WBSA 2EMXA 1X3CA 2EM7A 2EQ1A 1JK1A 1RMDA 1A1HA 2YSOA 2EOEA 4IS1C 3EPHA 1DGCA 2JPAA 1A1GA 1X6EA 2EOJA 2PRTA 4GZNC 1X6HA 3M99B 2HGHA 2YTIA 2EOXA 2EE8A 2LO3A 2YU5A 2BB8A 2EM6A 2MKDA 2DGCA 2EM4A 3EPKA 2EMZA 4R2SA 2GHFA 1YUIA 2CSHA 2LT7A 2ENAA 2EOQA 2EPXA 2YTPA 2YTJA 2EPCA 3MHHC 2E72A 1BBOA 1A1JA 1P47A 1TF6A 1G2FC 2RSIA 2EMLA 2EOSA 4IJDA 2EN6A 2YTFA 2NABA 2EOIA 4R2RA 2EOOA 2EM5A 3MHSC 1B69A 2EL4A 5KL2A 2EL5A 2YTEA 2YTGA 2EMKA 3EPLA 2ENHA 1YUJA 1KJKA 2JP9A 2J7JA 2EOMA 2EMIA 2EN2A 2MKNA 2EMYA 1YSAC 1ZAAC 2LV2A 1A1IA 2M9AA 4R2QA 2EMHA 2EMGA 3VHTB 2DMIA 2LVHA 2YTOA 2EOYA 4WSGA 2ADRA 2EMBA 2DRPA 2MDGA 2EMAA 2EMCA 2EQ0A 2EPZA 4R2AA 1A1LA 2EPUA 2CTDA 2GLIA 2EP3A 2EN4A 1UBDC 2EM3A 4R2EA 2WBUA 2R1FA 2YTNA 2DLKA 1WJPA 2EMWA 4F6MA 2EOFA 2EPRA 2EM9A 2ELZA 1Z1BA 2I13A 1TN9A 1X5WA 5KL7A 2EL6A 1G2DC 1MEYC 2YRMA 2WCC3 2RPCA 2EOZA 1A1KA 2DLQA 2YU8A 1A1FA 1AAYA 1ZU1A 2CT1A 2EMFA 2ELYA 2EPAA 5KL3A 5KL6A 1JK2A 2EM0A 4R2CA 2YTQA 2YTDA 2EN1A 2VRDA 1UN6B 4X9JA 5KL5A 2A25A 1X6FA 4F6NA 1F2IG 4R2PA 3EPJA 2EM8A 2ENCA 1ZR9A 1LLMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOR A;  5KL4 A;  2EQ3 A;  2YSP A;  4F2J C;  1NCS A;  2YRH A;  1BB8 A;  2EN7 A;  4FK5 C;  1TF3 A;  2EM2 A;  2EOH A;  2LCE A;  2EN8 A;  4M9V C;  2EJ4 A;  2WBT A;  2YRK A;  4R2D A;  2D9H A;  2EN3 A;  3UK3 C;  2EPP A;  2WBS A;  2EMX A;  1X3C A;  2EM7 A;  2EQ1 A;  1JK1 A;  1RMD A;  1A1H A;  2YSO A;  2EOE A;  4IS1 C;  3EPH A;  1DGC A;  2JPA A;  1A1G A;  1X6E A;  2EOJ A;  2PRT A;  4GZN C;  1X6H A;  3M99 B;  2HGH A;  2YTI A;  2EOX A;  2EE8 A;  2LO3 A;  2YU5 A;  2BB8 A;  2EM6 A;  2MKD A;  2DGC A;  2EM4 A;  3EPK A;  2EMZ A;  4R2S A;  2GHF A;  1YUI A;  2CSH A;  2LT7 A;  2ENA A;  2EOQ A;  2EPX A;  2YTP A;  2YTJ A;  2EPC A;  3MHH C;  2E72 A;  1BBO A;  1A1J A;  1P47 A;  1TF6 A;  1G2F C;  2RSI A;  2EML A;  2EOS A;  4IJD A;  2EN6 A;  2YTF A;  2NAB A;  2EOI A;  4R2R A;  2EOO A;  2EM5 A;  3MHS C;  1B69 A;  2EL4 A;  5KL2 A;  2EL5 A;  2YTE A;  2YTG A;  2EMK A;  3EPL A;  2ENH A;  1YUJ A;  1KJK A;  2JP9 A;  2J7J A;  2EOM A;  2EMI A;  2EN2 A;  2MKN A;  2EMY A;  1YSA C;  1ZAA C;  2LV2 A;  1A1I A;  2M9A A;  4R2Q A;  2EMH A;  2EMG A;  3VHT B;  2DMI A;  2LVH A;  2YTO A;  2EOY A;  4WSG A;  2ADR A;  2EMB A;  2DRP A;  2MDG A;  2EMA A;  2EMC A;  2EQ0 A;  2EPZ A;  4R2A A;  1A1L A;  2EPU A;  2CTD A;  2GLI A;  2EP3 A;  2EN4 A;  1UBD C;  2EM3 A;  4R2E A;  2WBU A;  2R1F A;  2YTN A;  2DLK A;  1WJP A;  2EMW A;  4F6M A;  2EOF A;  2EPR A;  2EM9 A;  2ELZ A;  1Z1B A;  2I13 A;  1TN9 A;  1X5W A;  5KL7 A;  2EL6 A;  1G2D C;  1MEY C;  2YRM A;  2WCC 3;  2RPC A;  2EOZ A;  1A1K A;  2DLQ A;  2YU8 A;  1A1F A;  1AAY A;  1ZU1 A;  2CT1 A;  2EMF A;  2ELY A;  2EPA A;  5KL3 A;  5KL6 A;  1JK2 A;  2EM0 A;  4R2C A;  2YTQ A;  2YTD A;  2EN1 A;  2VRD A;  1UN6 B;  4X9J A;  5KL5 A;  2A25 A;  1X6F A;  4F6N A;  1F2I G;  4R2P A;  3EPJ A;  2EM8 A;  2ENC A;  1ZR9 A;  1LLM C; 
#chains in the Genus database with same CATH topology
 1N34 E;  5AE3 A;  3IWB A;  5A6B D;  2ODR C;  3F6G A;  4DKK A;  2UXB E;  1NEI A;  2MC6 A;  1I94 E;  4OX9 E;  2KON A;  4JV5 E;  3K6Q A;  4R8O A;  2EM2 A;  2RSM A;  5F3W A;  5IT9 C;  2WBT A;  4R2D A;  2UXC E;  2D9H A;  2EN3 A;  4LFB E;  4BCA A;  1EH7 A;  2B9D A;  1EKZ A;  2L3J A;  1A1H A;  4DR2 E;  2VF1 A;  2YSO A;  3EPH A;  4WYQ B;  2ODR D;  1A1G A;  1XNR E;  4GZN C;  1X6H A;  1N36 E;  5TSE A;  1IQS A;  2EOX A;  2EE8 A;  5A6J A;  2YU5 A;  1RQ0 A;  2BB8 A;  4GKK E;  2NUE A;  2UU9 E;  4JI6 E;  2CSH A;  4BC7 A;  2EPK X;  4WXC A;  3LML A;  2EPC A;  4F9A B;  2JY9 A;  2EPM X;  2EML A;  2YTF A;  4B3S E;  2EM5 A;  3ECR A;  5A6K A;  5AC4 A;  2YTE A;  2V83 A;  2ENH A;  4X62 E;  2JP9 A;  3KZZ A;  4JI8 E;  3FIG A;  2F4V E;  4R2Q A;  4Q28 A;  2EMH A;  1HNW E;  2MDG A;  2L3C A;  2CTD A;  2EPU A;  2RS7 A;  4O4K A;  4TUI A;  1T4O A;  4LFC E;  2EN4 A;  4R2E A;  2WBU A;  2YTN A;  4X65 E;  1IMU A;  2YZT A;  1QU6 A;  1TN9 A;  4BMJ A;  1DQ3 A;  1KYQ A;  4DMI A;  1X48 A;  2WCC 3;  4JI3 E;  1A1K A;  1A1F A;  2CT1 A;  2EPA A;  4NHR A;  3AV0 A;  2EM0 A;  4NXM E;  2YTQ A;  4X9J A;  2A25 A;  4R2P A;  1PKP A;  1XNQ E;  3EPJ A;  2M1S A;  1HNZ E;  1YYK A;  2EOR A;  5LMU E;  3AUZ A;  5KL4 A;  1GTK A;  2JXP A;  4F2J C;  3J81 C;  1FJG E;  1BB8 A;  4FK5 C;  3JU0 A;  1ZBT A;  2EN8 A;  2LCE A;  1T4N A;  4YY3 E;  4MLQ A;  2R76 A;  4JYA E;  2L2K B;  4B3R E;  5A69 A;  3HQ1 A;  2V88 A;  1X3C A;  2V8Q B;  4DV1 E;  2JR1 A;  4IS1 C;  2NUF A;  2LMZ A;  2M7Q A;  5A6A A;  1GZ6 A;  4TUG A;  2KOU A;  1DGC A;  3H09 A;  2JPA A;  1X6E A;  2PRT A;  2HC5 A;  4B3M E;  2E5L E;  4NXN E;  1YPN A;  3ADL A;  2G7H A;  2YTI A;  5FLX C;  1N32 E;  5LL6 R;  2EWL A;  2DGC A;  2EM4 A;  4R2S A;  4J8Z A;  3THN A;  2ENA A;  3DF6 A;  2EOQ A;  4ZYE A;  4DV7 E;  2EZ6 A;  1BBO A;  4HEI A;  1TF6 A;  1HNX E;  1G2F C;  3OML A;  2EN6 A;  4LF6 E;  2JOB A;  1AH5 A;  4JI0 E;  1BBG A;  2EL4 A;  2L6M A;  4X66 E;  2EL5 A;  4WFT A;  3THO B;  4P78 A;  1KJK A;  1N3G A;  1WRJ A;  2EMI A;  1YSA C;  4DUZ E;  2LUP B;  2FV4 B;  2M9A A;  4DV0 E;  2EMG A;  2V86 A;  4M0V A;  2DMI A;  2UUB E;  2YTO A;  2DMY A;  3ADJ A;  2ADR A;  2EMB A;  4DV6 E;  2UUA E;  2EQ0 A;  3KZY A;  2IHR 1;  3BF2 A;  4LF7 E;  1UBD C;  2NA2 A;  4R03 A;  2LE2 A;  1WJP A;  4F6M A;  1Z1B A;  3HPZ A;  1X5W A;  2RQL A;  2EL6 A;  1G2D C;  2YWQ A;  2H36 X;  2EOZ A;  5T6J A;  1ZU1 A;  2ELY A;  4WPY A;  3ADG A;  2B3T B;  5ADZ A;  1JK2 A;  4DV4 E;  4R2C A;  4O43 A;  4GKJ E;  2EN1 A;  2VRD A;  1PJS A;  4F6N A;  1X6F A;  2KHX A;  5AE1 A;  2ENC A;  4O5G A;  5IV8 B;  3VYX A;  1YYW A;  4F9C B;  5A2Q C;  4GEQ B;  2NUG A;  2LTR A;  4BBY A;  4YHH E;  4KHP E;  2LJH A;  2BBG A;  4BS9 A;  3C4T A;  1TF3 A;  2N3H A;  4JI5 E;  1IBM E;  2DB2 A;  4DR3 E;  2N8X A;  4ZYH A;  5LMN E;  2EPP A;  2WBS A;  4NZV A;  2EM7 A;  1JK1 A;  1T39 A;  2LBS B;  3T1H E;  2V89 A;  2FTX B;  1YZ9 A;  1IBK E;  2LJU A;  2RS6 A;  3M99 B;  5CFF E;  2LO3 A;  2N3G A;  3JTZ A;  3P1X A;  2MKD A;  4P7D A;  2EMZ A;  1YUI A;  2Q8U A;  2LT7 A;  3BBG A;  3J7A G;  2EPX A;  4LF5 E;  2YTJ A;  2VQE E;  2E72 A;  4JI7 E;  2YT4 A;  3KWR A;  1P47 A;  3LLH A;  4KWY A;  4IJD A;  2EOI A;  2EPL X;  4R2R A;  3C6K A;  3MHS C;  5KL2 A;  2RTX A;  2EMK A;  3EPL A;  1UIL A;  2J7J A;  2EOM A;  2WZO A;  4M30 A;  2EMY A;  1ZAA C;  4WSP A;  4LF9 E;  3VHT B;  4BC9 A;  2EPN A;  2LVH A;  1SFE A;  4WSG A;  2UUC E;  1WHN A;  2EPO A;  4WX9 A;  4LF8 E;  1MGT A;  4R2A A;  2GLI A;  2JWO A;  2R1F A;  1J5E E;  3L00 A;  4LTY A;  3RMP A;  4OOG C;  4DR7 E;  2EOF A;  2EPR A;  2HJJ A;  2EM9 A;  2ELZ A;  2I13 A;  3F6H A;  5KL7 A;  4DR6 E;  2B7T A;  2RPC A;  4Q35 B;  3HTX A;  4BHC A;  1WXR A;  4MLV A;  1X47 A;  1T38 A;  1AAY A;  5AAS A;  3DJW A;  3JAM C;  2UXD E;  3IWC A;  2K7I A;  2YTD A;  1UN6 B;  5KL5 A;  5A6B A;  3T1Y E;  2F8B A;  1GQE A;  2B7V A;  1IBL E;  2EQ3 A;  2YSP A;  1FKA E;  3EQ1 A;  2MDR A;  3IWD A;  1NCS A;  2VE7 C;  2YRH A;  2L33 A;  4DUY E;  2E1M A;  2EN7 A;  1PJQ A;  3C6M A;  2EOH A;  3J7Y p;  4M9V C;  1O0W A;  2EJ4 A;  4LFA E;  2JOX A;  2V87 A;  2YRK A;  5IWA E;  3UK3 C;  1HR0 E;  2EMX A;  3C4B A;  2EQ1 A;  1RMD A;  2EOE A;  2M4I A;  4JI1 E;  1SR9 A;  2CPN A;  3TQM A;  4DR4 E;  2MC5 A;  1STU A;  4BHB A;  2EOJ A;  1YYO A;  2V85 A;  1EH8 A;  2HGH A;  4RH8 A;  4KZS A;  4I8O A;  1DI2 A;  4DR5 E;  4RHB B;  2EM6 A;  3HXL A;  4L8N A;  4LU9 A;  3EPK A;  1YFH A;  2GHF A;  1XMQ E;  4JI4 E;  2I9I A;  4DV2 E;  4X8W A;  4ZYG A;  2YTP A;  1EH6 A;  1PDA A;  3MHH C;  2JVA A;  1A1J A;  4M2Z A;  2GPI A;  2RSI A;  2LRS A;  2EOS A;  4N4R B;  3VK6 A;  5AE2 A;  5BR8 E;  1IQO A;  2NAB A;  2EOO A;  4LF4 E;  3J80 C;  1B69 A;  1RC7 A;  4DV3 E;  1J26 A;  2YTG A;  2DIX A;  2YPN A;  3OTO E;  2LUQ A;  4ZYD A;  1YUJ A;  1WHQ A;  2VQF E;  2LTS A;  3ADI A;  3BGH A;  1N33 E;  5LLQ A;  2EN2 A;  4F54 A;  2MKN A;  2LV2 A;  4X64 E;  1A1I A;  5DNY A;  3BID A;  5IXM B;  2L2N A;  1T4L B;  3HPS A;  4O24 A;  2DSY A;  2FGG A;  2EOY A;  4K0K E;  4L5N C;  2JYA A;  2DRP A;  4DR1 E;  2EMA A;  2EMC A;  1UHZ A;  2EPZ A;  1A1L A;  4WXD A;  2EP3 A;  2L8T A;  2EM3 A;  2DLK A;  5AC5 A;  2EMW A;  1QNT A;  4HTG A;  3ZOQ B;  1MEY C;  2YRM A;  1X49 A;  1ZBQ A;  2DLQ A;  2YU8 A;  4B3T E;  4F9B B;  2EMF A;  2ZM6 E;  2HHH E;  2L92 A;  3MSW A;  5KL3 A;  5KL6 A;  1XMO E;  4JI2 E;  4DV5 E;  2L2M A;  2K4V A;  4AQY E;  1F2I G;  1L4S A;  1PJT A;  2EM8 A;  3QG5 C;  1ZR9 A;  3VYY A;  1LLM C; 
#chains in the Genus database with same CATH homology
 2EOR A;  5KL4 A;  2EQ3 A;  2YSP A;  4F2J C;  1NCS A;  2YRH A;  1BB8 A;  2EN7 A;  4FK5 C;  1TF3 A;  2EM2 A;  2EOH A;  2LCE A;  2EN8 A;  4M9V C;  2EJ4 A;  2WBT A;  2YRK A;  4R2D A;  2D9H A;  2EN3 A;  3UK3 C;  2EPP A;  2WBS A;  2EMX A;  1X3C A;  2EM7 A;  2EQ1 A;  1JK1 A;  1RMD A;  1A1H A;  2YSO A;  2EOE A;  4IS1 C;  3EPH A;  1DGC A;  2JPA A;  1A1G A;  1X6E A;  2EOJ A;  2PRT A;  4GZN C;  1X6H A;  3M99 B;  2HGH A;  2YTI A;  2EOX A;  2EE8 A;  2LO3 A;  2YU5 A;  2BB8 A;  2EM6 A;  2MKD A;  2DGC A;  2EM4 A;  3EPK A;  2EMZ A;  4R2S A;  2GHF A;  1YUI A;  2CSH A;  2LT7 A;  2ENA A;  2EOQ A;  2EPX A;  2YTP A;  2YTJ A;  2EPC A;  3MHH C;  2E72 A;  1BBO A;  1A1J A;  1P47 A;  1TF6 A;  1G2F C;  2RSI A;  2EML A;  2EOS A;  4IJD A;  2EN6 A;  2YTF A;  2NAB A;  2EOI A;  4R2R A;  2EOO A;  2EM5 A;  3MHS C;  1B69 A;  2EL4 A;  5KL2 A;  2EL5 A;  2YTE A;  2YTG A;  2EMK A;  3EPL A;  2ENH A;  1YUJ A;  1KJK A;  2JP9 A;  2J7J A;  2EOM A;  2EMI A;  2EN2 A;  2MKN A;  2EMY A;  1YSA C;  1ZAA C;  2LV2 A;  1A1I A;  2M9A A;  4R2Q A;  2EMH A;  2EMG A;  3VHT B;  2DMI A;  2LVH A;  2YTO A;  2EOY A;  4WSG A;  2ADR A;  2EMB A;  2DRP A;  2MDG A;  2EMA A;  2EMC A;  2EQ0 A;  2EPZ A;  4R2A A;  1A1L A;  2EPU A;  2CTD A;  2GLI A;  2EP3 A;  2EN4 A;  1UBD C;  2EM3 A;  4R2E A;  2WBU A;  2R1F A;  2YTN A;  2DLK A;  1WJP A;  2EMW A;  4F6M A;  2EOF A;  2EPR A;  2EM9 A;  2ELZ A;  1Z1B A;  2I13 A;  1TN9 A;  1X5W A;  5KL7 A;  2EL6 A;  1G2D C;  1MEY C;  2YRM A;  2WCC 3;  2RPC A;  2EOZ A;  1A1K A;  2DLQ A;  2YU8 A;  1A1F A;  1AAY A;  1ZU1 A;  2CT1 A;  2EMF A;  2ELY A;  2EPA A;  5KL3 A;  5KL6 A;  1JK2 A;  2EM0 A;  4R2C A;  2YTQ A;  2YTD A;  2EN1 A;  2VRD A;  1UN6 B;  4X9J A;  5KL5 A;  2A25 A;  1X6F A;  4F6N A;  1F2I G;  4R2P A;  3EPJ A;  2EM8 A;  2ENC A;  1ZR9 A;  1LLM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...