2EPUA

Solution structure of the secound c2h2 type zinc finger domain of zinc finger protein 32
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
45
structure length
45
Chain Sequence
GSSGSSGTGQKPFECTHCGKSFRAKGNLVTHQRIHTGEKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the secound C2H2 type zinc finger domain of Zinc finger protein 32
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 32
total genus 6
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2epuA01
1A1LA 2EE8A 5KL2A 2EQ0A 2EM4A 1UBDC 3M99B 2ENAA 2M9AA 2WBSA 2ENCA 2D9HA 1RMDA 2EPAA 4R2AA 4R2DA 5KL5A 2EOJA 1A1KA 2HGHA 2EMKA 2EJ4A 2EMYA 2EM3A 2EMZA 4R2SA 4F6MA 2E72A 1BB8A 2EN4A 2RSIA 4R2EA 2EMAA 2EOEA 1ZU1A 2EN6A 2EQ3A 2LVHA 2YRMA 1A1FA 2JP9A 1A1HA 3EPJA 2ELZA 1JK1A 1B69A 2PRTA 2EOIA 2YRKA 1NCSA 1X6HA 2EMXA 1YUIA 2EM7A 4R2RA 2J7JA 4X9JA 2EPUA 2YTFA 2BB8A 2CSHA 2YTIA 2GHFA 5KL4A 3EPLA 2LV2A 1F2IG 2DLQA 2EL4A 2EPRA 2EOMA 2EMHA 4GZNC 2YSPA 1JK2A 2EPPA 2NABA 1KJKA 5KL3A 2EMLA 5KL7A 1Z1BA 3EPKA 1A1GA 2CTDA 2R1FA 2VRDA 4R2QA 1P47A 1TN9A 2YSOA 2EPZA 4R2PA 2EM0A 2YRHA 2EM2A 2ADRA 3VHTB 4IS1C 1AAYA 2MDGA 2EN2A 2EOYA 3MHSC 2EOHA 1ZAAC 2A25A 2EN1A 1X5WA 2EM6A 2EM9A 2WBUA 2YU8A 2EPXA 2EM8A 2MKDA 2YTQA 2YTDA 4WSGA 2WCC3 2EP3A 2EMFA 4F2JC 4M9VC 2CT1A 2EL5A 2EN3A 2EQ1A 2ELYA 1X6EA 2EN7A 1X3CA 3UK3C 1DGCA 2EOSA 1A1JA 2EORA 4IJDA 4R2CA 2EMBA 2I13A 3MHHC 1MEYC 2LCEA 2DRPA 1YSAC 3EPHA 1G2DC 2EOFA 2MKNA 2EMGA 2YTNA 1BBOA 2EOQA 2YTJA 2JPAA 2DGCA 1TF3A 2YTEA 4F6NA 2EOOA 4FK5C 2YTOA 1ZR9A 2LT7A 2DLKA 2EMCA 2RPCA 2YU5A 2EMIA 1A1IA 2DMIA 2EPCA 1YUJA 2WBTA 1TF6A 2EL6A 2LO3A 2EN8A 2YTGA 1X6FA 2EM5A 5KL6A 2EMWA 1WJPA 2EOXA 1LLMC 2GLIA 2EOZA 2ENHA 1G2FC 1UN6B 2YTPA
chains in the Genus database with same CATH superfamily
1IQOA 2HJJA 2EE8A 5KL2A 3DF6A 2EM4A 1UBDC 4DR1E 2EPKX 3IWCA 4LF8E 3LMLA 3KWRA 4YY3E 3OTOE 4WXCA 5LMUE 4JI4E 2EPAA 4R2DA 2YPNA 1A1KA 4DV2E 2EPMX 2EMZA 4F6MA 1WHNA 2K7IA 2EOEA 4GKJE 3ECRA 3EQ1A 2UXCE 3BF2A 2N8XA 4O5GA 2ELZA 2L92A 2EOIA 1NCSA 2EMXA 3VYYA 4P7DA 1YUIA 3HTXA 2EM7A 3F6GA 2BB8A 2YT4A 2I9IA 4B3ME 1T4NA 2L8TA 2LV2A 2VE7C 2DLQA 2EPRA 5A6JA 4F54A 1PDAA 4DV1E 1Z1BA 1WHQA 1GQEA 1A1GA 2UXDE 4JI8E 4R2QA 4Q28A 3VHTB 2MDGA 2EN2A 4NHRA 2K4VA 2EOHA 2MC6A 2BBGA 3DJWA 1GZ6A 2EN1A 2EM6A 2EM9A 2FTXB 2EPXA 2EP3A 4DR4E 3MSWA 4F2JC 2EL5A 4DUZE 2ELYA 4DR3E 4DR2E 1X3CA 1XNRE 1A1JA 2KOUA 4LTYA 2VQEE 5DNYA 5F3WA 4JI1E 4ZYGA 3ADGA 2EPOA 1IBKE 2I13A 4JI0E 1MEYC 4BBYA 2DRPA 4I8OA 4JI3E 4JI5E 2V89A 2EOFA 1PJQA 3JTZA 2MKNA 5T6JA 1XNQE 4LF6E 2YTNA 1T4OA 2EOQA 2JPAA 2JYAA 2G7HA 1J5EE 4YHHE 2N3GA 5LMNE 4FK5C 4GEQB 4DMIA 4DUYE 3T1YE 3J7Yp 2RPCA 1HNZE 2DMIA 4ZYEA 1SR9A 3BGHA 5IXMB 2HC5A 1YUJA 5A6KA 4WSPA 3C6KA 2EN8A 4RHBB 3AV0A 3THOB 1QU6A 3C4TA 1G2FC 1UN6B 2YTPA 4JYAE 1I94E 4LF5E 2YZTA 2EQ0A 4WX9A 2LJHA 2RS6A 3THNA 3C4BA 5A6BA 5CFFE 4BC9A 2IHR1 1RMDA 4R2AA 4LU9A 5KL5A 2B7VA 2HGHA 3KZZA 1ZBTA 4R2SA 1BB8A 2EM3A 3TQMA 3FIGA 2EMAA 3J7AG 1YPNA 4F9AB 2YRMA 1EKZA 4Q35B 4X64E 2RTXA 2FGGA 4TUIA 2M4IA 2VF1A 1A1HA 1N33E 3VK6A 2HHHE 2B9DA 4LF4E 3F6HA 1HR0E 3JAMC 4BMJA 2LJUA 1X6HA 2JY9A 4R2RA 2YWQA 3ZOQB 2EPUA 2YTFA 3IWBA 5KL4A 4J8ZA 1F2IG 2EL4A 2EMHA 2V85A 4GZNC 4BHBA 4BCAA 2DB2A 2EMLA 2EWLA 4X65E 5A6BD 2UU9E 2L3CA 2UUCE 4DV5E 2R1FA 2JOXA 2RS7A 2YSOA 1WRJA 2ADRA 2EM2A 4JI7E 3MHSC 1IBME 2WBUA 2JXPA 2YTDA 4M0VA 2CT1A 4LF7E 4LFAE 2M7QA 2L3JA 1X6EA 1IMUA 5ADZA 3QG5C 4F9CB 3UK3C 1T38A 2LTSA 2EORA 1PJTA 2LUQA 4O4KA 3HPSA 3MHHC 2H36X 2L6MA 2LCEA 3EPHA 2EMGA 1N34E 2Q8UA 5AC5A 1FJGE 4JV5E 2DMYA 4WXDA 2V83A 2EOOA 4TUGA 4AQYE 2EPNA 4WYQB 2DLKA 4L5NC 3HPZA 4N4RB 1J26A 3L00A 3T1HE 2LO3A 2F8BA 1X6FA 1X49A 2LRSA 1IQSA 2B3TB 2GLIA 2EOXA 2E1MA 4DV0E 3HQ1A 4BHCA 5AASA 1A1LA 4OX9E 2JOBA 4DR7E 1DQ3A 1ZBQA 1N36E 2M9AA 2WBSA 2E5LE 2EMYA 2EJ4A 2UUAE 2EZ6A 2EPLX 1NEIA 2L2NA 2E72A 2B7TA 2NUEA 2RSIA 1ZU1A 4DV4E 1A1FA 2LBSB 2ODRD 4DR5E 2V88A 5LLQA 3EPJA 2KONA 3P1XA 1JK1A 1YYWA 2PRTA 4NXME 4NZVA 4X62E 4X9JA 1HNXE 1RC7A 2CSHA 2YTIA 2GHFA 4L8NA 2EOMA 2YSPA 1JK2A 2NABA 5KL3A 3ADLA 4R03A 1P47A 2VRDA 4GKKE 4F9BB 2GPIA 3H09A 2EPZA 4R2PA 3HXLA 4KZSA 5A69A 1AAYA 4LF9E 1O0WA 1ZAAC 2UXBE 2A25A 4R8OA 1IBLE 3KZYA 2EM8A 2MKDA 4WSGA 4NXNE 2DSYA 5BR8E 4M9VC 2EN3A 2EQ1A 1HNWE 3ADJA 2EN7A 2M1SA 1EH6A 1RQ0A 1N32E 4O43A 1EH8A 1WXRA 4IJDA 4R2CA 2EMBA 3J81C 1YSAC 5AE3A 1BBOA 1YFHA 2DGCA 1TF3A 4F6NA 5TSEA 4B3RE 2LT7A 1MGTA 4DV7E 4M2ZA 4DKKA 4X66E 2EMIA 2FV4B 1A1IA 2EPCA 1STUA 2DIXA 5IWAE 5KL6A 1T4LB 1FKAE 5IT9C 1LLMC 2MDRA 2V87A 2ENHA 5FLXC 1SFEA 2L2KB 4O24A 3M99B 2UUBE 2ENAA 2V8QB 1XMOE 1PJSA 1YZ9A 2ENCA 2D9HA 2LUPB 3ADIA 5LL6R 2EOJA 3J80C 1T39A 2EMKA 4BS9A 2EN4A 2JWOA 1KYQA 2KHXA 4R2EA 3BIDA 1N3GA 2EN6A 2EQ3A 2NA2A 4DV6E 3RMPA 2LVHA 1GTKA 2JP9A 3AUZA 2JR1A 2V86A 1B69A 4LFCE 1AH5A 2ODRC 2YRKA 1L4SA 2LE2A 1YYKA 2J7JA 1X47A 2L2MA 3EPLA 2N3HA 1X48A 3JU0A 2R76A 2EPPA 1KJKA 2VQFE 5KL7A 4KWYA 2NUFA 3VYXA 3EPKA 3LLHA 4DR6E 2CTDA 2RSMA 1TN9A 1YYOA 2EM0A 2YRHA 4IS1C 2F4VE 2JVAA 3K6QA 5A6AA 4ZYHA 2L33A 2EOYA 5AC4A 2ZM6E 4M30A 1X5WA 4WPYA 2YU8A 4LFBE 4B3TE 2YTQA 2WCC3 2EMFA 4RH8A 4X8WA 5AE2A 2LMZA 3OMLA 1BBGA 2MC5A 5A2QC 4BC7A 1DGCA 2EOSA 1QNTA 4DV3E 2CPNA 5IV8B 4MLVA 4KHPE 2WZOA 1PKPA 4JI6E 1G2DC 2RQLA 2YTJA 1DI2A 3BBGA 4HTGA 2YTEA 4HEIA 1UHZA 2YTOA 1ZR9A 4ZYDA 4JI2E 2EMCA 2YU5A 3IWDA 2NUGA 4B3SE 4P78A 1EH7A 2WBTA 1TF6A 2EL6A 5AE1A 2YTGA 3C6MA 2EM5A 4WFTA 4K0KE 2EMWA 1WJPA 2EOZA 1XMQE 1UILA 2LTRA 4OOGC 4MLQA
chains in the Genus database with same CATH topology
1A1LA 2EE8A 5KL2A 2EQ0A 2EM4A 1UBDC 3M99B 2ENAA 2M9AA 2WBSA 2ENCA 2D9HA 1RMDA 2EPAA 4R2AA 4R2DA 5KL5A 2EOJA 1A1KA 2HGHA 2EMKA 2EJ4A 2EMYA 2EM3A 2EMZA 4R2SA 4F6MA 2E72A 1BB8A 2EN4A 2RSIA 4R2EA 2EMAA 2EOEA 1ZU1A 2EN6A 2EQ3A 2LVHA 2YRMA 1A1FA 2JP9A 1A1HA 3EPJA 2ELZA 1JK1A 1B69A 2PRTA 2EOIA 2YRKA 1NCSA 1X6HA 2EMXA 1YUIA 2EM7A 4R2RA 2J7JA 4X9JA 2EPUA 2YTFA 2BB8A 2CSHA 2YTIA 2GHFA 5KL4A 3EPLA 2LV2A 1F2IG 2DLQA 2EL4A 2EPRA 2EOMA 2EMHA 4GZNC 2YSPA 1JK2A 2EPPA 2NABA 1KJKA 5KL3A 2EMLA 5KL7A 1Z1BA 3EPKA 1A1GA 2CTDA 2R1FA 2VRDA 4R2QA 1P47A 1TN9A 2YSOA 2EPZA 4R2PA 2EM0A 2YRHA 2EM2A 2ADRA 3VHTB 4IS1C 1AAYA 2MDGA 2EN2A 2EOYA 3MHSC 2EOHA 1ZAAC 2A25A 2EN1A 1X5WA 2EM6A 2EM9A 2WBUA 2YU8A 2EPXA 2EM8A 2MKDA 2YTQA 2YTDA 4WSGA 2WCC3 2EP3A 2EMFA 4F2JC 4M9VC 2CT1A 2EL5A 2EN3A 2EQ1A 2ELYA 1X6EA 2EN7A 1X3CA 3UK3C 1DGCA 2EOSA 1A1JA 2EORA 4IJDA 4R2CA 2EMBA 2I13A 3MHHC 1MEYC 2LCEA 2DRPA 1YSAC 3EPHA 1G2DC 2EOFA 2MKNA 2EMGA 2YTNA 1BBOA 2EOQA 2YTJA 2JPAA 2DGCA 1TF3A 2YTEA 4F6NA 2EOOA 4FK5C 2YTOA 1ZR9A 2LT7A 2DLKA 2EMCA 2RPCA 2YU5A 2EMIA 1A1IA 2DMIA 2EPCA 1YUJA 2WBTA 1TF6A 2EL6A 2LO3A 2EN8A 2YTGA 1X6FA 2EM5A 5KL6A 2EMWA 1WJPA 2EOXA 1LLMC 2GLIA 2EOZA 2ENHA 1G2FC 1UN6B 2YTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A1L A;  2EE8 A;  5KL2 A;  2EQ0 A;  2EM4 A;  1UBD C;  3M99 B;  2ENA A;  2M9A A;  2WBS A;  2ENC A;  2D9H A;  1RMD A;  2EPA A;  4R2A A;  4R2D A;  5KL5 A;  2EOJ A;  1A1K A;  2HGH A;  2EMK A;  2EJ4 A;  2EMY A;  2EM3 A;  2EMZ A;  4R2S A;  4F6M A;  2E72 A;  1BB8 A;  2EN4 A;  2RSI A;  4R2E A;  2EMA A;  2EOE A;  1ZU1 A;  2EN6 A;  2EQ3 A;  2LVH A;  2YRM A;  1A1F A;  2JP9 A;  1A1H A;  3EPJ A;  2ELZ A;  1JK1 A;  1B69 A;  2PRT A;  2EOI A;  2YRK A;  1NCS A;  1X6H A;  2EMX A;  1YUI A;  2EM7 A;  4R2R A;  2J7J A;  4X9J A;  2EPU A;  2YTF A;  2BB8 A;  2CSH A;  2YTI A;  2GHF A;  5KL4 A;  3EPL A;  2LV2 A;  1F2I G;  2DLQ A;  2EL4 A;  2EPR A;  2EOM A;  2EMH A;  4GZN C;  2YSP A;  1JK2 A;  2EPP A;  2NAB A;  1KJK A;  5KL3 A;  2EML A;  5KL7 A;  1Z1B A;  3EPK A;  1A1G A;  2CTD A;  2R1F A;  2VRD A;  4R2Q A;  1P47 A;  1TN9 A;  2YSO A;  2EPZ A;  4R2P A;  2EM0 A;  2YRH A;  2EM2 A;  2ADR A;  3VHT B;  4IS1 C;  1AAY A;  2MDG A;  2EN2 A;  2EOY A;  3MHS C;  2EOH A;  1ZAA C;  2A25 A;  2EN1 A;  1X5W A;  2EM6 A;  2EM9 A;  2WBU A;  2YU8 A;  2EPX A;  2EM8 A;  2MKD A;  2YTQ A;  2YTD A;  4WSG A;  2WCC 3;  2EP3 A;  2EMF A;  4F2J C;  4M9V C;  2CT1 A;  2EL5 A;  2EN3 A;  2EQ1 A;  2ELY A;  1X6E A;  2EN7 A;  1X3C A;  3UK3 C;  1DGC A;  2EOS A;  1A1J A;  2EOR A;  4IJD A;  4R2C A;  2EMB A;  2I13 A;  3MHH C;  1MEY C;  2LCE A;  2DRP A;  1YSA C;  3EPH A;  1G2D C;  2EOF A;  2MKN A;  2EMG A;  2YTN A;  1BBO A;  2EOQ A;  2YTJ A;  2JPA A;  2DGC A;  1TF3 A;  2YTE A;  4F6N A;  2EOO A;  4FK5 C;  2YTO A;  1ZR9 A;  2LT7 A;  2DLK A;  2EMC A;  2RPC A;  2YU5 A;  2EMI A;  1A1I A;  2DMI A;  2EPC A;  1YUJ A;  2WBT A;  1TF6 A;  2EL6 A;  2LO3 A;  2EN8 A;  2YTG A;  1X6F A;  2EM5 A;  5KL6 A;  2EMW A;  1WJP A;  2EOX A;  1LLM C;  2GLI A;  2EOZ A;  2ENH A;  1G2F C;  1UN6 B;  2YTP A; 
#chains in the Genus database with same CATH topology
 1IQO A;  2HJJ A;  2EE8 A;  5KL2 A;  3DF6 A;  2EM4 A;  1UBD C;  4DR1 E;  2EPK X;  3IWC A;  4LF8 E;  3LML A;  3KWR A;  4YY3 E;  3OTO E;  4WXC A;  5LMU E;  4JI4 E;  2EPA A;  4R2D A;  2YPN A;  1A1K A;  4DV2 E;  2EPM X;  2EMZ A;  4F6M A;  1WHN A;  2K7I A;  2EOE A;  4GKJ E;  3ECR A;  3EQ1 A;  2UXC E;  3BF2 A;  2N8X A;  4O5G A;  2ELZ A;  2L92 A;  2EOI A;  1NCS A;  2EMX A;  3VYY A;  4P7D A;  1YUI A;  3HTX A;  2EM7 A;  3F6G A;  2BB8 A;  2YT4 A;  2I9I A;  4B3M E;  1T4N A;  2L8T A;  2LV2 A;  2VE7 C;  2DLQ A;  2EPR A;  5A6J A;  4F54 A;  1PDA A;  4DV1 E;  1Z1B A;  1WHQ A;  1GQE A;  1A1G A;  2UXD E;  4JI8 E;  4R2Q A;  4Q28 A;  3VHT B;  2MDG A;  2EN2 A;  4NHR A;  2K4V A;  2EOH A;  2MC6 A;  2BBG A;  3DJW A;  1GZ6 A;  2EN1 A;  2EM6 A;  2EM9 A;  2FTX B;  2EPX A;  2EP3 A;  4DR4 E;  3MSW A;  4F2J C;  2EL5 A;  4DUZ E;  2ELY A;  4DR3 E;  4DR2 E;  1X3C A;  1XNR E;  1A1J A;  2KOU A;  4LTY A;  2VQE E;  5DNY A;  5F3W A;  4JI1 E;  4ZYG A;  3ADG A;  2EPO A;  1IBK E;  2I13 A;  4JI0 E;  1MEY C;  4BBY A;  2DRP A;  4I8O A;  4JI3 E;  4JI5 E;  2V89 A;  2EOF A;  1PJQ A;  3JTZ A;  2MKN A;  5T6J A;  1XNQ E;  4LF6 E;  2YTN A;  1T4O A;  2EOQ A;  2JPA A;  2JYA A;  2G7H A;  1J5E E;  4YHH E;  2N3G A;  5LMN E;  4FK5 C;  4GEQ B;  4DMI A;  4DUY E;  3T1Y E;  3J7Y p;  2RPC A;  1HNZ E;  2DMI A;  4ZYE A;  1SR9 A;  3BGH A;  5IXM B;  2HC5 A;  1YUJ A;  5A6K A;  4WSP A;  3C6K A;  2EN8 A;  4RHB B;  3AV0 A;  3THO B;  1QU6 A;  3C4T A;  1G2F C;  1UN6 B;  2YTP A;  4JYA E;  1I94 E;  4LF5 E;  2YZT A;  2EQ0 A;  4WX9 A;  2LJH A;  2RS6 A;  3THN A;  3C4B A;  5A6B A;  5CFF E;  4BC9 A;  2IHR 1;  1RMD A;  4R2A A;  4LU9 A;  5KL5 A;  2B7V A;  2HGH A;  3KZZ A;  1ZBT A;  4R2S A;  1BB8 A;  2EM3 A;  3TQM A;  3FIG A;  2EMA A;  3J7A G;  1YPN A;  4F9A B;  2YRM A;  1EKZ A;  4Q35 B;  4X64 E;  2RTX A;  2FGG A;  4TUI A;  2M4I A;  2VF1 A;  1A1H A;  1N33 E;  3VK6 A;  2HHH E;  2B9D A;  4LF4 E;  3F6H A;  1HR0 E;  3JAM C;  4BMJ A;  2LJU A;  1X6H A;  2JY9 A;  4R2R A;  2YWQ A;  3ZOQ B;  2EPU A;  2YTF A;  3IWB A;  5KL4 A;  4J8Z A;  1F2I G;  2EL4 A;  2EMH A;  2V85 A;  4GZN C;  4BHB A;  4BCA A;  2DB2 A;  2EML A;  2EWL A;  4X65 E;  5A6B D;  2UU9 E;  2L3C A;  2UUC E;  4DV5 E;  2R1F A;  2JOX A;  2RS7 A;  2YSO A;  1WRJ A;  2ADR A;  2EM2 A;  4JI7 E;  3MHS C;  1IBM E;  2WBU A;  2JXP A;  2YTD A;  4M0V A;  2CT1 A;  4LF7 E;  4LFA E;  2M7Q A;  2L3J A;  1X6E A;  1IMU A;  5ADZ A;  3QG5 C;  4F9C B;  3UK3 C;  1T38 A;  2LTS A;  2EOR A;  1PJT A;  2LUQ A;  4O4K A;  3HPS A;  3MHH C;  2H36 X;  2L6M A;  2LCE A;  3EPH A;  2EMG A;  1N34 E;  2Q8U A;  5AC5 A;  1FJG E;  4JV5 E;  2DMY A;  4WXD A;  2V83 A;  2EOO A;  4TUG A;  4AQY E;  2EPN A;  4WYQ B;  2DLK A;  4L5N C;  3HPZ A;  4N4R B;  1J26 A;  3L00 A;  3T1H E;  2LO3 A;  2F8B A;  1X6F A;  1X49 A;  2LRS A;  1IQS A;  2B3T B;  2GLI A;  2EOX A;  2E1M A;  4DV0 E;  3HQ1 A;  4BHC A;  5AAS A;  1A1L A;  4OX9 E;  2JOB A;  4DR7 E;  1DQ3 A;  1ZBQ A;  1N36 E;  2M9A A;  2WBS A;  2E5L E;  2EMY A;  2EJ4 A;  2UUA E;  2EZ6 A;  2EPL X;  1NEI A;  2L2N A;  2E72 A;  2B7T A;  2NUE A;  2RSI A;  1ZU1 A;  4DV4 E;  1A1F A;  2LBS B;  2ODR D;  4DR5 E;  2V88 A;  5LLQ A;  3EPJ A;  2KON A;  3P1X A;  1JK1 A;  1YYW A;  2PRT A;  4NXM E;  4NZV A;  4X62 E;  4X9J A;  1HNX E;  1RC7 A;  2CSH A;  2YTI A;  2GHF A;  4L8N A;  2EOM A;  2YSP A;  1JK2 A;  2NAB A;  5KL3 A;  3ADL A;  4R03 A;  1P47 A;  2VRD A;  4GKK E;  4F9B B;  2GPI A;  3H09 A;  2EPZ A;  4R2P A;  3HXL A;  4KZS A;  5A69 A;  1AAY A;  4LF9 E;  1O0W A;  1ZAA C;  2UXB E;  2A25 A;  4R8O A;  1IBL E;  3KZY A;  2EM8 A;  2MKD A;  4WSG A;  4NXN E;  2DSY A;  5BR8 E;  4M9V C;  2EN3 A;  2EQ1 A;  1HNW E;  3ADJ A;  2EN7 A;  2M1S A;  1EH6 A;  1RQ0 A;  1N32 E;  4O43 A;  1EH8 A;  1WXR A;  4IJD A;  4R2C A;  2EMB A;  3J81 C;  1YSA C;  5AE3 A;  1BBO A;  1YFH A;  2DGC A;  1TF3 A;  4F6N A;  5TSE A;  4B3R E;  2LT7 A;  1MGT A;  4DV7 E;  4M2Z A;  4DKK A;  4X66 E;  2EMI A;  2FV4 B;  1A1I A;  2EPC A;  1STU A;  2DIX A;  5IWA E;  5KL6 A;  1T4L B;  1FKA E;  5IT9 C;  1LLM C;  2MDR A;  2V87 A;  2ENH A;  5FLX C;  1SFE A;  2L2K B;  4O24 A;  3M99 B;  2UUB E;  2ENA A;  2V8Q B;  1XMO E;  1PJS A;  1YZ9 A;  2ENC A;  2D9H A;  2LUP B;  3ADI A;  5LL6 R;  2EOJ A;  3J80 C;  1T39 A;  2EMK A;  4BS9 A;  2EN4 A;  2JWO A;  1KYQ A;  2KHX A;  4R2E A;  3BID A;  1N3G A;  2EN6 A;  2EQ3 A;  2NA2 A;  4DV6 E;  3RMP A;  2LVH A;  1GTK A;  2JP9 A;  3AUZ A;  2JR1 A;  2V86 A;  1B69 A;  4LFC E;  1AH5 A;  2ODR C;  2YRK A;  1L4S A;  2LE2 A;  1YYK A;  2J7J A;  1X47 A;  2L2M A;  3EPL A;  2N3H A;  1X48 A;  3JU0 A;  2R76 A;  2EPP A;  1KJK A;  2VQF E;  5KL7 A;  4KWY A;  2NUF A;  3VYX A;  3EPK A;  3LLH A;  4DR6 E;  2CTD A;  2RSM A;  1TN9 A;  1YYO A;  2EM0 A;  2YRH A;  4IS1 C;  2F4V E;  2JVA A;  3K6Q A;  5A6A A;  4ZYH A;  2L33 A;  2EOY A;  5AC4 A;  2ZM6 E;  4M30 A;  1X5W A;  4WPY A;  2YU8 A;  4LFB E;  4B3T E;  2YTQ A;  2WCC 3;  2EMF A;  4RH8 A;  4X8W A;  5AE2 A;  2LMZ A;  3OML A;  1BBG A;  2MC5 A;  5A2Q C;  4BC7 A;  1DGC A;  2EOS A;  1QNT A;  4DV3 E;  2CPN A;  5IV8 B;  4MLV A;  4KHP E;  2WZO A;  1PKP A;  4JI6 E;  1G2D C;  2RQL A;  2YTJ A;  1DI2 A;  3BBG A;  4HTG A;  2YTE A;  4HEI A;  1UHZ A;  2YTO A;  1ZR9 A;  4ZYD A;  4JI2 E;  2EMC A;  2YU5 A;  3IWD A;  2NUG A;  4B3S E;  4P78 A;  1EH7 A;  2WBT A;  1TF6 A;  2EL6 A;  5AE1 A;  2YTG A;  3C6M A;  2EM5 A;  4WFT A;  4K0K E;  2EMW A;  1WJP A;  2EOZ A;  1XMQ E;  1UIL A;  2LTR A;  4OOG C;  4MLQ A; 
#chains in the Genus database with same CATH homology
 1A1L A;  2EE8 A;  5KL2 A;  2EQ0 A;  2EM4 A;  1UBD C;  3M99 B;  2ENA A;  2M9A A;  2WBS A;  2ENC A;  2D9H A;  1RMD A;  2EPA A;  4R2A A;  4R2D A;  5KL5 A;  2EOJ A;  1A1K A;  2HGH A;  2EMK A;  2EJ4 A;  2EMY A;  2EM3 A;  2EMZ A;  4R2S A;  4F6M A;  2E72 A;  1BB8 A;  2EN4 A;  2RSI A;  4R2E A;  2EMA A;  2EOE A;  1ZU1 A;  2EN6 A;  2EQ3 A;  2LVH A;  2YRM A;  1A1F A;  2JP9 A;  1A1H A;  3EPJ A;  2ELZ A;  1JK1 A;  1B69 A;  2PRT A;  2EOI A;  2YRK A;  1NCS A;  1X6H A;  2EMX A;  1YUI A;  2EM7 A;  4R2R A;  2J7J A;  4X9J A;  2EPU A;  2YTF A;  2BB8 A;  2CSH A;  2YTI A;  2GHF A;  5KL4 A;  3EPL A;  2LV2 A;  1F2I G;  2DLQ A;  2EL4 A;  2EPR A;  2EOM A;  2EMH A;  4GZN C;  2YSP A;  1JK2 A;  2EPP A;  2NAB A;  1KJK A;  5KL3 A;  2EML A;  5KL7 A;  1Z1B A;  3EPK A;  1A1G A;  2CTD A;  2R1F A;  2VRD A;  4R2Q A;  1P47 A;  1TN9 A;  2YSO A;  2EPZ A;  4R2P A;  2EM0 A;  2YRH A;  2EM2 A;  2ADR A;  3VHT B;  4IS1 C;  1AAY A;  2MDG A;  2EN2 A;  2EOY A;  3MHS C;  2EOH A;  1ZAA C;  2A25 A;  2EN1 A;  1X5W A;  2EM6 A;  2EM9 A;  2WBU A;  2YU8 A;  2EPX A;  2EM8 A;  2MKD A;  2YTQ A;  2YTD A;  4WSG A;  2WCC 3;  2EP3 A;  2EMF A;  4F2J C;  4M9V C;  2CT1 A;  2EL5 A;  2EN3 A;  2EQ1 A;  2ELY A;  1X6E A;  2EN7 A;  1X3C A;  3UK3 C;  1DGC A;  2EOS A;  1A1J A;  2EOR A;  4IJD A;  4R2C A;  2EMB A;  2I13 A;  3MHH C;  1MEY C;  2LCE A;  2DRP A;  1YSA C;  3EPH A;  1G2D C;  2EOF A;  2MKN A;  2EMG A;  2YTN A;  1BBO A;  2EOQ A;  2YTJ A;  2JPA A;  2DGC A;  1TF3 A;  2YTE A;  4F6N A;  2EOO A;  4FK5 C;  2YTO A;  1ZR9 A;  2LT7 A;  2DLK A;  2EMC A;  2RPC A;  2YU5 A;  2EMI A;  1A1I A;  2DMI A;  2EPC A;  1YUJ A;  2WBT A;  1TF6 A;  2EL6 A;  2LO3 A;  2EN8 A;  2YTG A;  1X6F A;  2EM5 A;  5KL6 A;  2EMW A;  1WJP A;  2EOX A;  1LLM C;  2GLI A;  2EOZ A;  2ENH A;  1G2F C;  1UN6 B;  2YTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...