2EPUA

Solution structure of the secound c2h2 type zinc finger domain of zinc finger protein 32
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
45
structure length
45
Chain Sequence
GSSGSSGTGQKPFECTHCGKSFRAKGNLVTHQRIHTGEKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Zinc finger protein 32
publication title Solution structure of the secound C2H2 type zinc finger domain of Zinc finger protein 32
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2epuA01
2WBUA 4WSGA 2RSIA 2EMXA 2EMFA 2ENHA 2EQ3A 1ZAAC 2CTDA 1KJKA 2EN2A 2WBSA 2EQ0A 2YTEA 2EN8A 2D9HA 1NCSA 2EOJA 2J7JA 2EOMA 1UBDC 2EM5A 4F6MA 2DRPA 2EPXA 3MHHC 2EPCA 4R2EA 1A1IA 2EN4A 2RPCA 1MEYC 2DLKA 2EP3A 4R2AA 2EOYA 5KL5A 2YTPA 2EOEA 1YUJA 3EPKA 2EOSA 3M99B 1TF6A 2LV2A 2YTGA 1DGCA 2EOFA 2EOIA 2EMKA 2EMLA 2EMGA 2DGCA 5KL4A 1X5WA 2YU5A 2DMIA 4M9VC 4F2JC 5KL7A 2GHFA 2WCC3 2EMCA 2GLIA 2LVHA 2EL4A 2EM7A 1RMDA 2WBTA 2VRDA 2LO3A 1B69A 2EM0A 5KL6A 3UK3C 2EM8A 2I13A 2YSOA 1G2FC 4R2PA 1ZR9A 4R2SA 5KL3A 1TN9A 2EPPA 2EOQA 2EPZA 3MHSC 1JK2A 3VHTB 2EMZA 2EJ4A 2JPAA 4IS1C 1TF3A 1BB8A 1LLMC 1JK1A 2EORA 2EMBA 2EN1A 2E72A 2NABA 2YRHA 2BB8A 1ZU1A 2LCEA 2YRMA 4FK5C 2EOOA 2MKNA 2JP9A 2EM3A 2HGHA 2EM4A 2YTFA 2EMWA 2EL6A 2YRKA 1A1HA 2EPAA 4GZNC 1Z1BA 2ELZA 4R2RA 1A1JA 2EM6A 2EOXA 2YTIA 1X6FA 2YTNA 2EMAA 2EN6A 1A1GA 1YUIA 4X9JA 1X6EA 4R2DA 2ELYA 2YTJA 1UN6B 4R2CA 2DLQA 2MKDA 2YTDA 2YU8A 2ENAA 2LT7A 1F2IG 2EMHA 2EM2A 2EMIA 1X6HA 2EL5A 2YTQA 1YSAC 3EPHA 2EN3A 1X3CA 2A25A 1P47A 2CT1A 3EPLA 2R1FA 1G2DC 2YSPA 4IJDA 2EPUA 2EPRA 2M9AA 1A1LA 2EE8A 2EM9A 1AAYA 2EOHA 2CSHA 3EPJA 2EMYA 1BBOA 1A1KA 2ADRA 2YTOA 2EOZA 4R2QA 1A1FA 4F6NA 2PRTA 5KL2A 2MDGA 2ENCA 2EN7A 1WJPA 2EQ1A
chains in the Genus database with same CATH superfamily
2WBUA 4MLQA 2EPOA 2L2MA 4DKKA 5IWAE 2ZM6E 4K0KE 2RSIA 2KONA 4DV2E 2EQ3A 3C6MA 1WXRA 1YZ9A 2EN2A 2WBSA 5DNYA 1L4SA 1GTKA 2V86A 2EOJA 3LLHA 1RQ0A 2EPXA 3OTOE 2JYAA 2LTSA 2EP3A 1X48A 5IT9C 2N8XA 1RC7A 2EOEA 2EPKX 1N36E 2EOSA 5A6KA 2LMZA 4N4RB 2HJJA 1X5WA 4X64E 4LFAE 2VF1A 2RS7A 2WCC3 2EMCA 2GLIA 2V89A 2EL4A 4O4KA 3T1HE 1RMDA 4ZYEA 3RMPA 3JAMC 2I13A 2G7HA 2I9IA 3DJWA 1FKAE 2EOQA 3MHSC 2FTXB 2KOUA 1N32E 2F4VE 3C4TA 1JK1A 3K6QA 2JVAA 1KYQA 2E72A 2EMBA 2YPNA 3C6KA 2EPMX 4RHBB 2BB8A 1ZU1A 4YY3E 2MKNA 4LF6E 4BHCA 3VYXA 4WPYA 2JP9A 2YTFA 2YRKA 2EL6A 2V85A 4HEIA 4NZVA 4X66E 4WSPA 1YPNA 2ELZA 4JI5E 1A1JA 2EM6A 1T4NA 2YTIA 3KWRA 5A6BD 4R2DA 1PKPA 4P7DA 1UN6B 2MC5A 2FV4B 4R2CA 4DR1E 1EKZA 2YU8A 2EM2A 2L33A 4ZYHA 4P78A 2YT4A 4KWYA 4JV5E 1X6HA 4NXNE 2YTQA 1YSAC 5LMUE 1STUA 1X3CA 2CT1A 2N3HA 4MLVA 1I94E 5A2QC 4IJDA 3IWBA 2E1MA 2EPUA 4KZSA 2EPRA 1YYOA 2LE2A 3ECRA 2EOHA 2B9DA 2CSHA 2B3TB 2EMYA 4JI0E 2ADRA 4X62E 1HNWE 1IBKE 5AE3A 4L5NC 3JTZA 3F6GA 3IWDA 4I8OA 5AASA 4LF5E 2EMFA 2CTDA 1T4OA 1WHNA 1KJKA 1GQEA 5A6BA 4AQYE 2EQ0A 1AH5A 3AV0A 2J7JA 1MGTA 2EOMA 3L00A 4X65E 3BIDA 2EN4A 2LJHA 4TUIA 4JI3E 4JI2E 3THNA 3ADIA 1TF6A 2EOIA 2DGCA 1O0WA 4DMIA 4DUZE 2FGGA 2L92A 5LL6R 1EH6A 2YU5A 3DF6A 3HTXA 5LMNE 2UUCE 2LVHA 3ADGA 4X8WA 2LUPB 5KL6A 3UK3C 2JY9A 1SR9A 4F9AB 1G2FC 4R2SA 2EPZA 2RS6A 2EMZA 2JPAA 4IS1C 1TF3A 3P1XA 2EORA 3ADJA 2EN1A 1IBLE 2B7TA 2LCEA 2YRMA 1SFEA 4FK5C 4Q28A 2JR1A 2HGHA 2EM4A 4GZNC 1PJTA 3VYYA 2UUBE 2UXCE 4F54A 3HPSA 4HTGA 2RSMA 2YTNA 2EMAA 2EN6A 3MSWA 5CFFE 1A1GA 1YUIA 4O24A 4WXCA 4WXDA 4DUYE 4JI6E 1QU6A 1WHQA 2EPNA 3J81C 2YTDA 1F2IG 3F6HA 2EMIA 3QG5C 2DSYA 1XNQE 2L3JA 1IQOA 3EPLA 4B3TE 2KHXA 2R1FA 4R03A 2M9AA 2EE8A 3HXLA 1A1KA 4JI8E 2EOZA 4R2QA 5AE1A 4F6NA 2E5LE 1X47A 3AUZA 2MDGA 4BC7A 2EQ1A 3HQ1A 2F8BA 4B3RE 1T4LB 5A6JA 3T1YE 1XNRE 3OMLA 3BF2A 1N3GA 1ZBTA 2ENHA 4BS9A 3JU0A 2GPIA 2EN8A 2D9HA 1NCSA 5A69A 1GZ6A 2LRSA 3MHHC 4GKKE 2IHR1 1A1IA 1J26A 3KZYA 1DI2A 2DLKA 2DMYA 2EOYA 4B3SE 2M1SA 1YUJA 4DV3E 3M99B 1FJGE 1HNZE 2EMKA 4JI7E 2EMLA 4B3ME 5KL4A 4DR2E 4Q35B 4M9VC 2JWOA 3FIGA 4F2JC 5KL7A 2CPNA 2EM7A 1EH7A 2WBTA 2LO3A 2EM0A 4BCAA 1NEIA 2LTRA 2YSOA 1ZR9A 2JOXA 2NA2A 1JK2A 3VHTB 4ZYGA 2EJ4A 5IXMB 1PDAA 1PJQA 5FLXC 2NUEA 1LLMC 2M7QA 3EQ1A 2UUAE 2V8QB 4M2ZA 2VQEE 4F9CB 5IV8B 2JOBA 2LBSB 1A1HA 3VK6A 1N33E 4LF9E 4R2RA 1PJSA 1YYKA 5AE2A 3BGHA 4DV5E 1UHZA 3J7Yp 2EOXA 1WRJA 2MC6A 3J7AG 4BBYA 2ELYA 2LUQA 4DV1E 2MKDA 2K4VA 3J80C 2ENAA 2EMHA 3IWCA 2JXPA 2K7IA 2EL5A 4M0VA 5AC5A 1T39A 2V88A 4O43A 1YFHA 2V83A 2A25A 1P47A 2R76A 4BHBA 4ZYDA 2HHHE 4LTYA 1G2DC 2YSPA 1YYWA 4LF8E 4DV7E 1T38A 1AAYA 5BR8E 4JI1E 4GEQB 1XMOE 1BBOA 2EZ6A 2YTOA 4M30A 4NXME 3H09A 2PRTA 4NHRA 2ENCA 2EN7A 2RQLA 4WSGA 4DR4E 4WYQB 2EMXA 1ZAAC 2UXDE 1HR0E 1X49A 2RTXA 4DV0E 2ODRD 2YTEA 2V87A 1DQ3A 2VE7C 4O5GA 3KZZA 1UBDC 2EM5A 3LMLA 4F6MA 2DRPA 4DR6E 2EWLA 2EPCA 4R2EA 2RPCA 1MEYC 1IMUA 4YHHE 1UILA 4R2AA 1IQSA 4JI4E 5KL5A 2YTPA 2LJUA 2L2KB 3EPKA 3C4BA 4KHPE 2LV2A 2YTGA 1DGCA 2EOFA 4OOGC 4WFTA 4RH8A 4J8ZA 4OX9E 2EMGA 5AC4A 5ADZA 2M4IA 3HPZA 2YWQA 3ADLA 1J5EE 1BBGA 2DMIA 2NUFA 5T6JA 4DV4E 2GHFA 4DR3E 2L2NA 1EH8A 2N3GA 1QNTA 4DR7E 4GKJE 4F9BB 2VRDA 1B69A 2EM8A 2DIXA 4R2PA 4DV6E 5KL3A 1TN9A 2EPPA 3TQMA 2Q8UA 2H36X 1HNXE 5F3WA 1BB8A 4LU9A 2NABA 2YRHA 1ZBQA 2VQFE 3BBGA 3THOB 2EOOA 2EM3A 2EMWA 4LF4E 5LLQA 2EPAA 4BC9A 1Z1BA 4LFBE 4JYAE 2DB2A 1X6FA 4WX9A 4X9JA 1X6EA 5TSEA 2UU9E 4R8OA 2YTJA 2B7VA 2DLQA 2L3CA 2YZTA 2BBGA 2WZOA 2LT7A 2NUGA 4DR5E 2L6MA 2L8TA 1XMQE 3ZOQB 3EPHA 4LFCE 2EPLX 4LF7E 2EN3A 1N34E 4TUGA 2HC5A 5A6AA 1A1LA 2UXBE 2EM9A 4L8NA 2MDRA 3EPJA 1IBME 4BMJA 1A1FA 5KL2A 1WJPA 2ODRC
chains in the Genus database with same CATH topology
2WBUA 4WSGA 2RSIA 2EMXA 2EMFA 2ENHA 2EQ3A 1ZAAC 2CTDA 1KJKA 2EN2A 2WBSA 2EQ0A 2YTEA 2EN8A 2D9HA 1NCSA 2EOJA 2J7JA 2EOMA 1UBDC 2EM5A 4F6MA 2DRPA 2EPXA 3MHHC 2EPCA 4R2EA 1A1IA 2EN4A 2RPCA 1MEYC 2DLKA 2EP3A 4R2AA 2EOYA 5KL5A 2YTPA 2EOEA 1YUJA 3EPKA 2EOSA 3M99B 1TF6A 2LV2A 2YTGA 1DGCA 2EOFA 2EOIA 2EMKA 2EMLA 2EMGA 2DGCA 5KL4A 1X5WA 2YU5A 2DMIA 4M9VC 4F2JC 5KL7A 2GHFA 2WCC3 2EMCA 2GLIA 2LVHA 2EL4A 2EM7A 1RMDA 2WBTA 2VRDA 2LO3A 1B69A 2EM0A 5KL6A 3UK3C 2EM8A 2I13A 2YSOA 1G2FC 4R2PA 1ZR9A 4R2SA 5KL3A 1TN9A 2EPPA 2EOQA 2EPZA 3MHSC 1JK2A 3VHTB 2EMZA 2EJ4A 2JPAA 4IS1C 1TF3A 1BB8A 1LLMC 1JK1A 2EORA 2EMBA 2EN1A 2E72A 2NABA 2YRHA 2BB8A 1ZU1A 2LCEA 2YRMA 4FK5C 2EOOA 2MKNA 2JP9A 2EM3A 2HGHA 2EM4A 2YTFA 2EMWA 2EL6A 2YRKA 1A1HA 2EPAA 4GZNC 1Z1BA 2ELZA 4R2RA 1A1JA 2EM6A 2EOXA 2YTIA 1X6FA 2YTNA 2EMAA 2EN6A 1A1GA 1YUIA 4X9JA 1X6EA 4R2DA 2ELYA 2YTJA 1UN6B 4R2CA 2DLQA 2MKDA 2YTDA 2YU8A 2ENAA 2LT7A 1F2IG 2EMHA 2EM2A 2EMIA 1X6HA 2EL5A 2YTQA 1YSAC 3EPHA 2EN3A 1X3CA 2A25A 1P47A 2CT1A 3EPLA 2R1FA 1G2DC 2YSPA 4IJDA 2EPUA 2EPRA 2M9AA 1A1LA 2EE8A 2EM9A 1AAYA 2EOHA 2CSHA 3EPJA 2EMYA 1BBOA 1A1KA 2ADRA 2YTOA 2EOZA 4R2QA 1A1FA 4F6NA 2PRTA 5KL2A 2MDGA 2ENCA 2EN7A 1WJPA 2EQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WBU A;  4WSG A;  2RSI A;  2EMX A;  2EMF A;  2ENH A;  2EQ3 A;  1ZAA C;  2CTD A;  1KJK A;  2EN2 A;  2WBS A;  2EQ0 A;  2YTE A;  2EN8 A;  2D9H A;  1NCS A;  2EOJ A;  2J7J A;  2EOM A;  1UBD C;  2EM5 A;  4F6M A;  2DRP A;  2EPX A;  3MHH C;  2EPC A;  4R2E A;  1A1I A;  2EN4 A;  2RPC A;  1MEY C;  2DLK A;  2EP3 A;  4R2A A;  2EOY A;  5KL5 A;  2YTP A;  2EOE A;  1YUJ A;  3EPK A;  2EOS A;  3M99 B;  1TF6 A;  2LV2 A;  2YTG A;  1DGC A;  2EOF A;  2EOI A;  2EMK A;  2EML A;  2EMG A;  2DGC A;  5KL4 A;  1X5W A;  2YU5 A;  2DMI A;  4M9V C;  4F2J C;  5KL7 A;  2GHF A;  2WCC 3;  2EMC A;  2GLI A;  2LVH A;  2EL4 A;  2EM7 A;  1RMD A;  2WBT A;  2VRD A;  2LO3 A;  1B69 A;  2EM0 A;  5KL6 A;  3UK3 C;  2EM8 A;  2I13 A;  2YSO A;  1G2F C;  4R2P A;  1ZR9 A;  4R2S A;  5KL3 A;  1TN9 A;  2EPP A;  2EOQ A;  2EPZ A;  3MHS C;  1JK2 A;  3VHT B;  2EMZ A;  2EJ4 A;  2JPA A;  4IS1 C;  1TF3 A;  1BB8 A;  1LLM C;  1JK1 A;  2EOR A;  2EMB A;  2EN1 A;  2E72 A;  2NAB A;  2YRH A;  2BB8 A;  1ZU1 A;  2LCE A;  2YRM A;  4FK5 C;  2EOO A;  2MKN A;  2JP9 A;  2EM3 A;  2HGH A;  2EM4 A;  2YTF A;  2EMW A;  2EL6 A;  2YRK A;  1A1H A;  2EPA A;  4GZN C;  1Z1B A;  2ELZ A;  4R2R A;  1A1J A;  2EM6 A;  2EOX A;  2YTI A;  1X6F A;  2YTN A;  2EMA A;  2EN6 A;  1A1G A;  1YUI A;  4X9J A;  1X6E A;  4R2D A;  2ELY A;  2YTJ A;  1UN6 B;  4R2C A;  2DLQ A;  2MKD A;  2YTD A;  2YU8 A;  2ENA A;  2LT7 A;  1F2I G;  2EMH A;  2EM2 A;  2EMI A;  1X6H A;  2EL5 A;  2YTQ A;  1YSA C;  3EPH A;  2EN3 A;  1X3C A;  2A25 A;  1P47 A;  2CT1 A;  3EPL A;  2R1F A;  1G2D C;  2YSP A;  4IJD A;  2EPU A;  2EPR A;  2M9A A;  1A1L A;  2EE8 A;  2EM9 A;  1AAY A;  2EOH A;  2CSH A;  3EPJ A;  2EMY A;  1BBO A;  1A1K A;  2ADR A;  2YTO A;  2EOZ A;  4R2Q A;  1A1F A;  4F6N A;  2PRT A;  5KL2 A;  2MDG A;  2ENC A;  2EN7 A;  1WJP A;  2EQ1 A; 
#chains in the Genus database with same CATH topology
 2WBU A;  4MLQ A;  2EPO A;  2L2M A;  4DKK A;  5IWA E;  2ZM6 E;  4K0K E;  2RSI A;  2KON A;  4DV2 E;  2EQ3 A;  3C6M A;  1WXR A;  1YZ9 A;  2EN2 A;  2WBS A;  5DNY A;  1L4S A;  1GTK A;  2V86 A;  2EOJ A;  3LLH A;  1RQ0 A;  2EPX A;  3OTO E;  2JYA A;  2LTS A;  2EP3 A;  1X48 A;  5IT9 C;  2N8X A;  1RC7 A;  2EOE A;  2EPK X;  1N36 E;  2EOS A;  5A6K A;  2LMZ A;  4N4R B;  2HJJ A;  1X5W A;  4X64 E;  4LFA E;  2VF1 A;  2RS7 A;  2WCC 3;  2EMC A;  2GLI A;  2V89 A;  2EL4 A;  4O4K A;  3T1H E;  1RMD A;  4ZYE A;  3RMP A;  3JAM C;  2I13 A;  2G7H A;  2I9I A;  3DJW A;  1FKA E;  2EOQ A;  3MHS C;  2FTX B;  2KOU A;  1N32 E;  2F4V E;  3C4T A;  1JK1 A;  3K6Q A;  2JVA A;  1KYQ A;  2E72 A;  2EMB A;  2YPN A;  3C6K A;  2EPM X;  4RHB B;  2BB8 A;  1ZU1 A;  4YY3 E;  2MKN A;  4LF6 E;  4BHC A;  3VYX A;  4WPY A;  2JP9 A;  2YTF A;  2YRK A;  2EL6 A;  2V85 A;  4HEI A;  4NZV A;  4X66 E;  4WSP A;  1YPN A;  2ELZ A;  4JI5 E;  1A1J A;  2EM6 A;  1T4N A;  2YTI A;  3KWR A;  5A6B D;  4R2D A;  1PKP A;  4P7D A;  1UN6 B;  2MC5 A;  2FV4 B;  4R2C A;  4DR1 E;  1EKZ A;  2YU8 A;  2EM2 A;  2L33 A;  4ZYH A;  4P78 A;  2YT4 A;  4KWY A;  4JV5 E;  1X6H A;  4NXN E;  2YTQ A;  1YSA C;  5LMU E;  1STU A;  1X3C A;  2CT1 A;  2N3H A;  4MLV A;  1I94 E;  5A2Q C;  4IJD A;  3IWB A;  2E1M A;  2EPU A;  4KZS A;  2EPR A;  1YYO A;  2LE2 A;  3ECR A;  2EOH A;  2B9D A;  2CSH A;  2B3T B;  2EMY A;  4JI0 E;  2ADR A;  4X62 E;  1HNW E;  1IBK E;  5AE3 A;  4L5N C;  3JTZ A;  3F6G A;  3IWD A;  4I8O A;  5AAS A;  4LF5 E;  2EMF A;  2CTD A;  1T4O A;  1WHN A;  1KJK A;  1GQE A;  5A6B A;  4AQY E;  2EQ0 A;  1AH5 A;  3AV0 A;  2J7J A;  1MGT A;  2EOM A;  3L00 A;  4X65 E;  3BID A;  2EN4 A;  2LJH A;  4TUI A;  4JI3 E;  4JI2 E;  3THN A;  3ADI A;  1TF6 A;  2EOI A;  2DGC A;  1O0W A;  4DMI A;  4DUZ E;  2FGG A;  2L92 A;  5LL6 R;  1EH6 A;  2YU5 A;  3DF6 A;  3HTX A;  5LMN E;  2UUC E;  2LVH A;  3ADG A;  4X8W A;  2LUP B;  5KL6 A;  3UK3 C;  2JY9 A;  1SR9 A;  4F9A B;  1G2F C;  4R2S A;  2EPZ A;  2RS6 A;  2EMZ A;  2JPA A;  4IS1 C;  1TF3 A;  3P1X A;  2EOR A;  3ADJ A;  2EN1 A;  1IBL E;  2B7T A;  2LCE A;  2YRM A;  1SFE A;  4FK5 C;  4Q28 A;  2JR1 A;  2HGH A;  2EM4 A;  4GZN C;  1PJT A;  3VYY A;  2UUB E;  2UXC E;  4F54 A;  3HPS A;  4HTG A;  2RSM A;  2YTN A;  2EMA A;  2EN6 A;  3MSW A;  5CFF E;  1A1G A;  1YUI A;  4O24 A;  4WXC A;  4WXD A;  4DUY E;  4JI6 E;  1QU6 A;  1WHQ A;  2EPN A;  3J81 C;  2YTD A;  1F2I G;  3F6H A;  2EMI A;  3QG5 C;  2DSY A;  1XNQ E;  2L3J A;  1IQO A;  3EPL A;  4B3T E;  2KHX A;  2R1F A;  4R03 A;  2M9A A;  2EE8 A;  3HXL A;  1A1K A;  4JI8 E;  2EOZ A;  4R2Q A;  5AE1 A;  4F6N A;  2E5L E;  1X47 A;  3AUZ A;  2MDG A;  4BC7 A;  2EQ1 A;  3HQ1 A;  2F8B A;  4B3R E;  1T4L B;  5A6J A;  3T1Y E;  1XNR E;  3OML A;  3BF2 A;  1N3G A;  1ZBT A;  2ENH A;  4BS9 A;  3JU0 A;  2GPI A;  2EN8 A;  2D9H A;  1NCS A;  5A69 A;  1GZ6 A;  2LRS A;  3MHH C;  4GKK E;  2IHR 1;  1A1I A;  1J26 A;  3KZY A;  1DI2 A;  2DLK A;  2DMY A;  2EOY A;  4B3S E;  2M1S A;  1YUJ A;  4DV3 E;  3M99 B;  1FJG E;  1HNZ E;  2EMK A;  4JI7 E;  2EML A;  4B3M E;  5KL4 A;  4DR2 E;  4Q35 B;  4M9V C;  2JWO A;  3FIG A;  4F2J C;  5KL7 A;  2CPN A;  2EM7 A;  1EH7 A;  2WBT A;  2LO3 A;  2EM0 A;  4BCA A;  1NEI A;  2LTR A;  2YSO A;  1ZR9 A;  2JOX A;  2NA2 A;  1JK2 A;  3VHT B;  4ZYG A;  2EJ4 A;  5IXM B;  1PDA A;  1PJQ A;  5FLX C;  2NUE A;  1LLM C;  2M7Q A;  3EQ1 A;  2UUA E;  2V8Q B;  4M2Z A;  2VQE E;  4F9C B;  5IV8 B;  2JOB A;  2LBS B;  1A1H A;  3VK6 A;  1N33 E;  4LF9 E;  4R2R A;  1PJS A;  1YYK A;  5AE2 A;  3BGH A;  4DV5 E;  1UHZ A;  3J7Y p;  2EOX A;  1WRJ A;  2MC6 A;  3J7A G;  4BBY A;  2ELY A;  2LUQ A;  4DV1 E;  2MKD A;  2K4V A;  3J80 C;  2ENA A;  2EMH A;  3IWC A;  2JXP A;  2K7I A;  2EL5 A;  4M0V A;  5AC5 A;  1T39 A;  2V88 A;  4O43 A;  1YFH A;  2V83 A;  2A25 A;  1P47 A;  2R76 A;  4BHB A;  4ZYD A;  2HHH E;  4LTY A;  1G2D C;  2YSP A;  1YYW A;  4LF8 E;  4DV7 E;  1T38 A;  1AAY A;  5BR8 E;  4JI1 E;  4GEQ B;  1XMO E;  1BBO A;  2EZ6 A;  2YTO A;  4M30 A;  4NXM E;  3H09 A;  2PRT A;  4NHR A;  2ENC A;  2EN7 A;  2RQL A;  4WSG A;  4DR4 E;  4WYQ B;  2EMX A;  1ZAA C;  2UXD E;  1HR0 E;  1X49 A;  2RTX A;  4DV0 E;  2ODR D;  2YTE A;  2V87 A;  1DQ3 A;  2VE7 C;  4O5G A;  3KZZ A;  1UBD C;  2EM5 A;  3LML A;  4F6M A;  2DRP A;  4DR6 E;  2EWL A;  2EPC A;  4R2E A;  2RPC A;  1MEY C;  1IMU A;  4YHH E;  1UIL A;  4R2A A;  1IQS A;  4JI4 E;  5KL5 A;  2YTP A;  2LJU A;  2L2K B;  3EPK A;  3C4B A;  4KHP E;  2LV2 A;  2YTG A;  1DGC A;  2EOF A;  4OOG C;  4WFT A;  4RH8 A;  4J8Z A;  4OX9 E;  2EMG A;  5AC4 A;  5ADZ A;  2M4I A;  3HPZ A;  2YWQ A;  3ADL A;  1J5E E;  1BBG A;  2DMI A;  2NUF A;  5T6J A;  4DV4 E;  2GHF A;  4DR3 E;  2L2N A;  1EH8 A;  2N3G A;  1QNT A;  4DR7 E;  4GKJ E;  4F9B B;  2VRD A;  1B69 A;  2EM8 A;  2DIX A;  4R2P A;  4DV6 E;  5KL3 A;  1TN9 A;  2EPP A;  3TQM A;  2Q8U A;  2H36 X;  1HNX E;  5F3W A;  1BB8 A;  4LU9 A;  2NAB A;  2YRH A;  1ZBQ A;  2VQF E;  3BBG A;  3THO B;  2EOO A;  2EM3 A;  2EMW A;  4LF4 E;  5LLQ A;  2EPA A;  4BC9 A;  1Z1B A;  4LFB E;  4JYA E;  2DB2 A;  1X6F A;  4WX9 A;  4X9J A;  1X6E A;  5TSE A;  2UU9 E;  4R8O A;  2YTJ A;  2B7V A;  2DLQ A;  2L3C A;  2YZT A;  2BBG A;  2WZO A;  2LT7 A;  2NUG A;  4DR5 E;  2L6M A;  2L8T A;  1XMQ E;  3ZOQ B;  3EPH A;  4LFC E;  2EPL X;  4LF7 E;  2EN3 A;  1N34 E;  4TUG A;  2HC5 A;  5A6A A;  1A1L A;  2UXB E;  2EM9 A;  4L8N A;  2MDR A;  3EPJ A;  1IBM E;  4BMJ A;  1A1F A;  5KL2 A;  1WJP A;  2ODR C; 
#chains in the Genus database with same CATH homology
 2WBU A;  4WSG A;  2RSI A;  2EMX A;  2EMF A;  2ENH A;  2EQ3 A;  1ZAA C;  2CTD A;  1KJK A;  2EN2 A;  2WBS A;  2EQ0 A;  2YTE A;  2EN8 A;  2D9H A;  1NCS A;  2EOJ A;  2J7J A;  2EOM A;  1UBD C;  2EM5 A;  4F6M A;  2DRP A;  2EPX A;  3MHH C;  2EPC A;  4R2E A;  1A1I A;  2EN4 A;  2RPC A;  1MEY C;  2DLK A;  2EP3 A;  4R2A A;  2EOY A;  5KL5 A;  2YTP A;  2EOE A;  1YUJ A;  3EPK A;  2EOS A;  3M99 B;  1TF6 A;  2LV2 A;  2YTG A;  1DGC A;  2EOF A;  2EOI A;  2EMK A;  2EML A;  2EMG A;  2DGC A;  5KL4 A;  1X5W A;  2YU5 A;  2DMI A;  4M9V C;  4F2J C;  5KL7 A;  2GHF A;  2WCC 3;  2EMC A;  2GLI A;  2LVH A;  2EL4 A;  2EM7 A;  1RMD A;  2WBT A;  2VRD A;  2LO3 A;  1B69 A;  2EM0 A;  5KL6 A;  3UK3 C;  2EM8 A;  2I13 A;  2YSO A;  1G2F C;  4R2P A;  1ZR9 A;  4R2S A;  5KL3 A;  1TN9 A;  2EPP A;  2EOQ A;  2EPZ A;  3MHS C;  1JK2 A;  3VHT B;  2EMZ A;  2EJ4 A;  2JPA A;  4IS1 C;  1TF3 A;  1BB8 A;  1LLM C;  1JK1 A;  2EOR A;  2EMB A;  2EN1 A;  2E72 A;  2NAB A;  2YRH A;  2BB8 A;  1ZU1 A;  2LCE A;  2YRM A;  4FK5 C;  2EOO A;  2MKN A;  2JP9 A;  2EM3 A;  2HGH A;  2EM4 A;  2YTF A;  2EMW A;  2EL6 A;  2YRK A;  1A1H A;  2EPA A;  4GZN C;  1Z1B A;  2ELZ A;  4R2R A;  1A1J A;  2EM6 A;  2EOX A;  2YTI A;  1X6F A;  2YTN A;  2EMA A;  2EN6 A;  1A1G A;  1YUI A;  4X9J A;  1X6E A;  4R2D A;  2ELY A;  2YTJ A;  1UN6 B;  4R2C A;  2DLQ A;  2MKD A;  2YTD A;  2YU8 A;  2ENA A;  2LT7 A;  1F2I G;  2EMH A;  2EM2 A;  2EMI A;  1X6H A;  2EL5 A;  2YTQ A;  1YSA C;  3EPH A;  2EN3 A;  1X3C A;  2A25 A;  1P47 A;  2CT1 A;  3EPL A;  2R1F A;  1G2D C;  2YSP A;  4IJD A;  2EPU A;  2EPR A;  2M9A A;  1A1L A;  2EE8 A;  2EM9 A;  1AAY A;  2EOH A;  2CSH A;  3EPJ A;  2EMY A;  1BBO A;  1A1K A;  2ADR A;  2YTO A;  2EOZ A;  4R2Q A;  1A1F A;  4F6N A;  2PRT A;  5KL2 A;  2MDG A;  2ENC A;  2EN7 A;  1WJP A;  2EQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...