2EPUA

Solution structure of the secound c2h2 type zinc finger domain of zinc finger protein 32
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
45
structure length
45
Chain Sequence
b'GSSGSSGTGQKPFECTHCGKSFRAKGNLVTHQRIHTGEKSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Zinc finger protein 32
publication title Solution structure of the secound C2H2 type zinc finger domain of Zinc finger protein 32
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2epuA01
3MHHC 2DLQA 1X6EA 1X6FA 2LCEA 2DGCA 2D9HA 2EMAA 2YTNA 3VHTB 4R2PA 1X5WA 4F6NA 2EE8A 2EL5A 1TN9A 1X6HA 2EMBA 2EMYA 4WSGA 1G2FC 1YUIA 1BB8A 2EMIA 1JK1A 2M9AA 1A1FA 1YUJA 1MEYC 5KL5A 2MDGA 1ZR9A 3UK3C 1YSAC 1A1KA 1A1GA 2WCC3 1B69A 2ENHA 1G2DC 2ADRA 2ENCA 2EM3A 2EM2A 2YTFA 3EPKA 1LLMC 2EP3A 2DRPA 2EL4A 2ENAA 1A1IA 2EOHA 2EPUA 2EQ1A 2EMZA 2NABA 2HGHA 2LO3A 1A1LA 2EMKA 5KL3A 2JPAA 4IS1C 2EM8A 2J7JA 2LV2A 4FK5C 1RMDA 2EMWA 4IJDA 2MKNA 2EN8A 2EMGA 2YRMA 1P47A 5KL6A 2EN2A 2EM4A 2YRKA 2WBSA 2EN7A 2LT7A 2CSHA 2EPRA 1F2IG 2GHFA 2CTDA 2EOFA 2EN6A 4R2EA 2EORA 2EPPA 4R2QA 1BBOA 2EOYA 2A25A 5KL7A 2R1FA 4R2RA 2YU8A 2EMFA 2EMXA 3M99B 2EQ0A 2I13A 1Z1BA 2EPXA 2JP9A 2YTJA 2EOXA 2VRDA 2E72A 1X3CA 2EOEA 1AAYA 1A1HA 4M9VC 5KL4A 1UN6B 2MKDA 4GZNC 2EMHA 2RPCA 2EOSA 2YTGA 2EN1A 4F6MA 2YTOA 2EPCA 2EOJA 2WBUA 1KJKA 2ELZA 4R2CA 5KL2A 2EN4A 2PRTA 2YTIA 1WJPA 2EM0A 2CT1A 2DLKA 2EM9A 2EM5A 3EPJA 2BB8A 4F2JC 2EQ3A 1UBDC 2LVHA 4X9JA 2EN3A 2YSOA 1NCSA 2EMCA 2YU5A 2EJ4A 2EOMA 2EMLA 2RSIA 2EOZA 4R2AA 1DGCA 2GLIA 2EM6A 1TF3A 1JK2A 1ZAAC 2EOOA 2YTQA 3EPLA 2WBTA 2EOQA 2YTDA 2EL6A 4R2SA 3MHSC 1A1JA 2EPZA 2YTEA 2EOIA 2EPAA 2ELYA 2YTPA 4R2DA 2YSPA 1ZU1A 3EPHA 2DMIA 2YRHA 2EM7A 1TF6A
chains in the Genus database with same CATH superfamily
4YY3E 4KHPE 2EMAA 3VHTB 1PKPA 4R2PA 3C4BA 1N33E 4LTYA 1YFHA 2N3HA 2EMYA 1BB8A 4BMJA 4GKKE 4L8NA 4B3RE 2M9AA 4BCAA 2V83A 4DKKA 2UUBE 4OX9E 5FLXC 1ZR9A 2F8BA 4LF7E 1UILA 4WXCA 2WCC3 1FKAE 2JY9A 4LF8E 2MC6A 4F9AB 2JOBA 3VYXA 2CPNA 1HNZE 3IWBA 2M7QA 2EM2A 2YTFA 3EPKA 4LFBE 3TQMA 4J8ZA 2DRPA 1STUA 2ENAA 3H09A 2NABA 4M30A 1A1LA 5KL3A 3J7AG 4IS1C 2V8QB 2L3JA 4BC7A 1RMDA 2EMWA 2FGGA 2EN8A 2L2MA 4DR5E 1PDAA 2EPRA 1F2IG 1FJGE 1EH8A 5LMNE 2CTDA 1X48A 2LJHA 2EN6A 1GQEA 4X64E 3EQ1A 1BBOA 2LTRA 5IT9C 4DV6E 2JOXA 3LMLA 1J5EE 3M99B 4ZYEA 4P78A 2HJJA 2RTXA 5AE1A 1Z1BA 3IWCA 1T4NA 2VRDA 1L4SA 1AAYA 1A1HA 2RPCA 4BC9A 4F6MA 3C4TA 2VE7C 3F6HA 2WBUA 3LLHA 5LL6R 3P1XA 2CT1A 3OMLA 1XMOE 5A6AA 2EM9A 2LJUA 4DR7E 4WYQB 3L00A 4F2JC 2VQFE 2LBSB 2LVHA 1QU6A 3ADJA 2EN3A 2V87A 5AC4A 1IBKE 1HNWE 2B9DA 2EMCA 4TUGA 1J26A 2EJ4A 2EOMA 2ODRD 2GLIA 4O5GA 4DV1E 1TF3A 1JK2A 2LTSA 1EH6A 1PJQA 2EL6A 3BBGA 1YZ9A 2GPIA 4M0VA 2EOIA 2ELYA 2YTPA 4B3SE 5T6JA 2JYAA 2EM7A 3KWRA 5IV8B 2FV4B 4JV5E 1X6FA 5TSEA 2DGCA 3OTOE 2H36X 2K4VA 4HEIA 1YPNA 4GEQB 3HQ1A 4X8WA 1N32E 2EE8A 3KZZA 1X6HA 4DV2E 1GZ6A 1JK1A 2DIXA 4MLQA 1A1FA 3JU0A 2N8XA 1IQSA 2MDGA 4DR4E 1YSAC 1A1GA 4JI1E 2YWQA 2ADRA 4NHRA 1HR0E 2V86A 1N34E 4R8OA 4JI6E 2RS6A 3JTZA 2EQ1A 4DR2E 2EPMX 2JPAA 2EM8A 2J7JA 2LV2A 4X66E 4YHHE 2L6MA 4IJDA 1DQ3A 2JWOA 2YRMA 5F3WA 5KL6A 2EN2A 2EM4A 2WBSA 2EN7A 2LT7A 2KHXA 5LMUE 1PJSA 2JXPA 3DJWA 2GHFA 4TUIA 3AV0A 1N36E 4NZVA 2YZTA 3ECRA 1WRJA 2EPPA 3HPSA 1T38A 5KL7A 2R1FA 4JI8E 4NXNE 2YU8A 2EMXA 4NXME 1SR9A 2B7TA 2EPXA 2JP9A 2M4IA 2E1MA 2WZOA 2EOXA 2YPNA 2B3TB 1UN6B 2ZM6E 3J81C 2MKDA 2EMHA 2EOSA 4GKJE 1KJKA 4JI7E 4DR1E 2NUEA 1MGTA 2YTIA 4BBYA 2F4VE 2DLKA 4B3ME 5LLQA 2B7VA 4F9BB 3ZOQB 4JI4E 2EQ3A 1UBDC 4X62E 4I8OA 2N3GA 4DR6E 2EMLA 2EOZA 1AH5A 3ADLA 2EOQA 2YTDA 4R2SA 3MHSC 1A1JA 2EPZA 2LRSA 1N3GA 2UU9E 2LMZA 1ZU1A 1XMQE 2HC5A 2HHHE 2YRHA 1GTKA 4DV0E 3HPZA 2DB2A 2D9HA 2YTNA 4WPYA 5ADZA 4BS9A 1X5WA 2L92A 4F6NA 1TN9A 5A69A 1WHNA 2EMBA 4WSGA 2KOUA 1YUIA 2L3CA 2DMYA 1WXRA 4LF6E 1ZBTA 4JI5E 1QNTA 1EKZA 2M1SA 5KL5A 2UXBE 4DV3E 2V85A 2UXDE 1A1KA 1B69A 3KZYA 4OOGC 2ENCA 1ZBQA 4WFTA 1LLMC 4B3TE 2KONA 2EP3A 4L5NC 2EOHA 5A6JA 2EPUA 3VK6A 2RQLA 1RQ0A 3J80C 3QG5C 4Q35B 4ZYHA 4LF4E 1IMUA 3K6QA 2JR1A 3C6MA 2YRKA 2CSHA 2UUCE 3FIGA 5CFFE 2K7IA 3J7Yp 2EPLX 4X65E 2EPNA 2R76A 4RH8A 4DUZE 2RS7A 2A25A 4DV4E 4R2RA 2EMFA 5BR8E 2VQEE 3THOB 2BBGA 2EOEA 3T1YE 5KL4A 2VF1A 4GZNC 2EN1A 3BGHA 2YT4A 5AE3A 4KZSA 4O24A 4R2CA 2EN4A 1UHZA 1WJPA 2EM0A 3C6KA 4WX9A 4DV5E 2EM5A 2L8TA 2G7HA 1O0WA 2UXCE 3ADIA 4JI0E 1DI2A 1T4LB 2YU5A 4ZYGA 3MSWA 4R2AA 2L33A 2IHR1 2YTQA 3DF6A 2NUFA 3AUZA 2NUGA 3THNA 2EPAA 2L2KB 4N4RB 4R2DA 5A6KA 4DUYE 3MHHC 2MC5A 2DLQA 5A6BA 5IWAE 1X6EA 2LCEA 5AASA 4RHBB 2EL5A 1T39A 4O4KA 1G2FC 2JVAA 3RMPA 2EMIA 4F54A 1YUJA 4ZYDA 1MEYC 1IBLE 2Q8UA 3UK3C 2E5LE 5IXMB 2ENHA 1X49A 2MDRA 1G2DC 2EM3A 1RC7A 2EPOA 3BIDA 4P7DA 4DV7E 2EL4A 1I94E 1A1IA 2EMZA 2HGHA 2LO3A 2EMKA 1XNQE 4HTGA 4O43A 4FK5C 2EWLA 2MKNA 2EMGA 1P47A 1HNXE 1YYKA 4JI3E 1NEIA 2NA2A 1IBME 4LF9E 1PJTA 4AQYE 4LFAE 4M2ZA 2L2NA 4Q28A 4JI2E 2EPKX 1SFEA 2EOFA 2FTXB 3IWDA 4R2EA 4BHCA 2EORA 4R2QA 3JAMC 2LE2A 2EOYA 2V88A 3HTXA 1WHQA 2V89A 2EQ0A 2RSMA 2I13A 5A2QC 4LF5E 4MLVA 2YTJA 4LU9A 2E72A 1X3CA 5A6BD 2LUPB 4M9VC 1YYOA 5AC5A 3BF2A 2YTGA 3ADGA 1BBGA 2YTOA 1YYWA 2EPCA 2EOJA 2EZ6A 1IQOA 3HXLA 2LUQA 2ELZA 1X47A 3F6GA 5KL2A 2PRTA 3T1HE 4BHBA 4DR3E 4LFCE 2UUAE 3EPJA 1T4OA 2BB8A 4X9JA 5DNYA 4R03A 2YSOA 1NCSA 2ODRC 5AE2A 2DSYA 3VYYA 2RSIA 1DGCA 2EM6A 2I9IA 1ZAAC 2EOOA 3EPLA 2WBTA 2YTEA 1EH7A 4KWYA 1XNRE 4WSPA 1KYQA 2YSPA 3EPHA 2DMIA 4WXDA 4DMIA 4F9CB 4K0KE 4JYAE 1TF6A
chains in the Genus database with same CATH topology
3MHHC 2DLQA 1X6EA 1X6FA 2LCEA 2DGCA 2D9HA 2EMAA 2YTNA 3VHTB 4R2PA 1X5WA 4F6NA 2EE8A 2EL5A 1TN9A 1X6HA 2EMBA 2EMYA 4WSGA 1G2FC 1YUIA 1BB8A 2EMIA 1JK1A 2M9AA 1A1FA 1YUJA 1MEYC 5KL5A 2MDGA 1ZR9A 3UK3C 1YSAC 1A1KA 1A1GA 2WCC3 1B69A 2ENHA 1G2DC 2ADRA 2ENCA 2EM3A 2EM2A 2YTFA 3EPKA 1LLMC 2EP3A 2DRPA 2EL4A 2ENAA 1A1IA 2EOHA 2EPUA 2EQ1A 2EMZA 2NABA 2HGHA 2LO3A 1A1LA 2EMKA 5KL3A 2JPAA 4IS1C 2EM8A 2J7JA 2LV2A 4FK5C 1RMDA 2EMWA 4IJDA 2MKNA 2EN8A 2EMGA 2YRMA 1P47A 5KL6A 2EN2A 2EM4A 2YRKA 2WBSA 2EN7A 2LT7A 2CSHA 2EPRA 1F2IG 2GHFA 2CTDA 2EOFA 2EN6A 4R2EA 2EORA 2EPPA 4R2QA 1BBOA 2EOYA 2A25A 5KL7A 2R1FA 4R2RA 2YU8A 2EMFA 2EMXA 3M99B 2EQ0A 2I13A 1Z1BA 2EPXA 2JP9A 2YTJA 2EOXA 2VRDA 2E72A 1X3CA 2EOEA 1AAYA 1A1HA 4M9VC 5KL4A 1UN6B 2MKDA 4GZNC 2EMHA 2RPCA 2EOSA 2YTGA 2EN1A 4F6MA 2YTOA 2EPCA 2EOJA 2WBUA 1KJKA 2ELZA 4R2CA 5KL2A 2EN4A 2PRTA 2YTIA 1WJPA 2EM0A 2CT1A 2DLKA 2EM9A 2EM5A 3EPJA 2BB8A 4F2JC 2EQ3A 1UBDC 2LVHA 4X9JA 2EN3A 2YSOA 1NCSA 2EMCA 2YU5A 2EJ4A 2EOMA 2EMLA 2RSIA 2EOZA 4R2AA 1DGCA 2GLIA 2EM6A 1TF3A 1JK2A 1ZAAC 2EOOA 2YTQA 3EPLA 2WBTA 2EOQA 2YTDA 2EL6A 4R2SA 3MHSC 1A1JA 2EPZA 2YTEA 2EOIA 2EPAA 2ELYA 2YTPA 4R2DA 2YSPA 1ZU1A 3EPHA 2DMIA 2YRHA 2EM7A 1TF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MHH C;  2DLQ A;  1X6E A;  1X6F A;  2LCE A;  2DGC A;  2D9H A;  2EMA A;  2YTN A;  3VHT B;  4R2P A;  1X5W A;  4F6N A;  2EE8 A;  2EL5 A;  1TN9 A;  1X6H A;  2EMB A;  2EMY A;  4WSG A;  1G2F C;  1YUI A;  1BB8 A;  2EMI A;  1JK1 A;  2M9A A;  1A1F A;  1YUJ A;  1MEY C;  5KL5 A;  2MDG A;  1ZR9 A;  3UK3 C;  1YSA C;  1A1K A;  1A1G A;  2WCC 3;  1B69 A;  2ENH A;  1G2D C;  2ADR A;  2ENC A;  2EM3 A;  2EM2 A;  2YTF A;  3EPK A;  1LLM C;  2EP3 A;  2DRP A;  2EL4 A;  2ENA A;  1A1I A;  2EOH A;  2EPU A;  2EQ1 A;  2EMZ A;  2NAB A;  2HGH A;  2LO3 A;  1A1L A;  2EMK A;  5KL3 A;  2JPA A;  4IS1 C;  2EM8 A;  2J7J A;  2LV2 A;  4FK5 C;  1RMD A;  2EMW A;  4IJD A;  2MKN A;  2EN8 A;  2EMG A;  2YRM A;  1P47 A;  5KL6 A;  2EN2 A;  2EM4 A;  2YRK A;  2WBS A;  2EN7 A;  2LT7 A;  2CSH A;  2EPR A;  1F2I G;  2GHF A;  2CTD A;  2EOF A;  2EN6 A;  4R2E A;  2EOR A;  2EPP A;  4R2Q A;  1BBO A;  2EOY A;  2A25 A;  5KL7 A;  2R1F A;  4R2R A;  2YU8 A;  2EMF A;  2EMX A;  3M99 B;  2EQ0 A;  2I13 A;  1Z1B A;  2EPX A;  2JP9 A;  2YTJ A;  2EOX A;  2VRD A;  2E72 A;  1X3C A;  2EOE A;  1AAY A;  1A1H A;  4M9V C;  5KL4 A;  1UN6 B;  2MKD A;  4GZN C;  2EMH A;  2RPC A;  2EOS A;  2YTG A;  2EN1 A;  4F6M A;  2YTO A;  2EPC A;  2EOJ A;  2WBU A;  1KJK A;  2ELZ A;  4R2C A;  5KL2 A;  2EN4 A;  2PRT A;  2YTI A;  1WJP A;  2EM0 A;  2CT1 A;  2DLK A;  2EM9 A;  2EM5 A;  3EPJ A;  2BB8 A;  4F2J C;  2EQ3 A;  1UBD C;  2LVH A;  4X9J A;  2EN3 A;  2YSO A;  1NCS A;  2EMC A;  2YU5 A;  2EJ4 A;  2EOM A;  2EML A;  2RSI A;  2EOZ A;  4R2A A;  1DGC A;  2GLI A;  2EM6 A;  1TF3 A;  1JK2 A;  1ZAA C;  2EOO A;  2YTQ A;  3EPL A;  2WBT A;  2EOQ A;  2YTD A;  2EL6 A;  4R2S A;  3MHS C;  1A1J A;  2EPZ A;  2YTE A;  2EOI A;  2EPA A;  2ELY A;  2YTP A;  4R2D A;  2YSP A;  1ZU1 A;  3EPH A;  2DMI A;  2YRH A;  2EM7 A;  1TF6 A; 
#chains in the Genus database with same CATH topology
 4YY3 E;  4KHP E;  2EMA A;  3VHT B;  1PKP A;  4R2P A;  3C4B A;  1N33 E;  4LTY A;  1YFH A;  2N3H A;  2EMY A;  1BB8 A;  4BMJ A;  4GKK E;  4L8N A;  4B3R E;  2M9A A;  4BCA A;  2V83 A;  4DKK A;  2UUB E;  4OX9 E;  5FLX C;  1ZR9 A;  2F8B A;  4LF7 E;  1UIL A;  4WXC A;  2WCC 3;  1FKA E;  2JY9 A;  4LF8 E;  2MC6 A;  4F9A B;  2JOB A;  3VYX A;  2CPN A;  1HNZ E;  3IWB A;  2M7Q A;  2EM2 A;  2YTF A;  3EPK A;  4LFB E;  3TQM A;  4J8Z A;  2DRP A;  1STU A;  2ENA A;  3H09 A;  2NAB A;  4M30 A;  1A1L A;  5KL3 A;  3J7A G;  4IS1 C;  2V8Q B;  2L3J A;  4BC7 A;  1RMD A;  2EMW A;  2FGG A;  2EN8 A;  2L2M A;  4DR5 E;  1PDA A;  2EPR A;  1F2I G;  1FJG E;  1EH8 A;  5LMN E;  2CTD A;  1X48 A;  2LJH A;  2EN6 A;  1GQE A;  4X64 E;  3EQ1 A;  1BBO A;  2LTR A;  5IT9 C;  4DV6 E;  2JOX A;  3LML A;  1J5E E;  3M99 B;  4ZYE A;  4P78 A;  2HJJ A;  2RTX A;  5AE1 A;  1Z1B A;  3IWC A;  1T4N A;  2VRD A;  1L4S A;  1AAY A;  1A1H A;  2RPC A;  4BC9 A;  4F6M A;  3C4T A;  2VE7 C;  3F6H A;  2WBU A;  3LLH A;  5LL6 R;  3P1X A;  2CT1 A;  3OML A;  1XMO E;  5A6A A;  2EM9 A;  2LJU A;  4DR7 E;  4WYQ B;  3L00 A;  4F2J C;  2VQF E;  2LBS B;  2LVH A;  1QU6 A;  3ADJ A;  2EN3 A;  2V87 A;  5AC4 A;  1IBK E;  1HNW E;  2B9D A;  2EMC A;  4TUG A;  1J26 A;  2EJ4 A;  2EOM A;  2ODR D;  2GLI A;  4O5G A;  4DV1 E;  1TF3 A;  1JK2 A;  2LTS A;  1EH6 A;  1PJQ A;  2EL6 A;  3BBG A;  1YZ9 A;  2GPI A;  4M0V A;  2EOI A;  2ELY A;  2YTP A;  4B3S E;  5T6J A;  2JYA A;  2EM7 A;  3KWR A;  5IV8 B;  2FV4 B;  4JV5 E;  1X6F A;  5TSE A;  2DGC A;  3OTO E;  2H36 X;  2K4V A;  4HEI A;  1YPN A;  4GEQ B;  3HQ1 A;  4X8W A;  1N32 E;  2EE8 A;  3KZZ A;  1X6H A;  4DV2 E;  1GZ6 A;  1JK1 A;  2DIX A;  4MLQ A;  1A1F A;  3JU0 A;  2N8X A;  1IQS A;  2MDG A;  4DR4 E;  1YSA C;  1A1G A;  4JI1 E;  2YWQ A;  2ADR A;  4NHR A;  1HR0 E;  2V86 A;  1N34 E;  4R8O A;  4JI6 E;  2RS6 A;  3JTZ A;  2EQ1 A;  4DR2 E;  2EPM X;  2JPA A;  2EM8 A;  2J7J A;  2LV2 A;  4X66 E;  4YHH E;  2L6M A;  4IJD A;  1DQ3 A;  2JWO A;  2YRM A;  5F3W A;  5KL6 A;  2EN2 A;  2EM4 A;  2WBS A;  2EN7 A;  2LT7 A;  2KHX A;  5LMU E;  1PJS A;  2JXP A;  3DJW A;  2GHF A;  4TUI A;  3AV0 A;  1N36 E;  4NZV A;  2YZT A;  3ECR A;  1WRJ A;  2EPP A;  3HPS A;  1T38 A;  5KL7 A;  2R1F A;  4JI8 E;  4NXN E;  2YU8 A;  2EMX A;  4NXM E;  1SR9 A;  2B7T A;  2EPX A;  2JP9 A;  2M4I A;  2E1M A;  2WZO A;  2EOX A;  2YPN A;  2B3T B;  1UN6 B;  2ZM6 E;  3J81 C;  2MKD A;  2EMH A;  2EOS A;  4GKJ E;  1KJK A;  4JI7 E;  4DR1 E;  2NUE A;  1MGT A;  2YTI A;  4BBY A;  2F4V E;  2DLK A;  4B3M E;  5LLQ A;  2B7V A;  4F9B B;  3ZOQ B;  4JI4 E;  2EQ3 A;  1UBD C;  4X62 E;  4I8O A;  2N3G A;  4DR6 E;  2EML A;  2EOZ A;  1AH5 A;  3ADL A;  2EOQ A;  2YTD A;  4R2S A;  3MHS C;  1A1J A;  2EPZ A;  2LRS A;  1N3G A;  2UU9 E;  2LMZ A;  1ZU1 A;  1XMQ E;  2HC5 A;  2HHH E;  2YRH A;  1GTK A;  4DV0 E;  3HPZ A;  2DB2 A;  2D9H A;  2YTN A;  4WPY A;  5ADZ A;  4BS9 A;  1X5W A;  2L92 A;  4F6N A;  1TN9 A;  5A69 A;  1WHN A;  2EMB A;  4WSG A;  2KOU A;  1YUI A;  2L3C A;  2DMY A;  1WXR A;  4LF6 E;  1ZBT A;  4JI5 E;  1QNT A;  1EKZ A;  2M1S A;  5KL5 A;  2UXB E;  4DV3 E;  2V85 A;  2UXD E;  1A1K A;  1B69 A;  3KZY A;  4OOG C;  2ENC A;  1ZBQ A;  4WFT A;  1LLM C;  4B3T E;  2KON A;  2EP3 A;  4L5N C;  2EOH A;  5A6J A;  2EPU A;  3VK6 A;  2RQL A;  1RQ0 A;  3J80 C;  3QG5 C;  4Q35 B;  4ZYH A;  4LF4 E;  1IMU A;  3K6Q A;  2JR1 A;  3C6M A;  2YRK A;  2CSH A;  2UUC E;  3FIG A;  5CFF E;  2K7I A;  3J7Y p;  2EPL X;  4X65 E;  2EPN A;  2R76 A;  4RH8 A;  4DUZ E;  2RS7 A;  2A25 A;  4DV4 E;  4R2R A;  2EMF A;  5BR8 E;  2VQE E;  3THO B;  2BBG A;  2EOE A;  3T1Y E;  5KL4 A;  2VF1 A;  4GZN C;  2EN1 A;  3BGH A;  2YT4 A;  5AE3 A;  4KZS A;  4O24 A;  4R2C A;  2EN4 A;  1UHZ A;  1WJP A;  2EM0 A;  3C6K A;  4WX9 A;  4DV5 E;  2EM5 A;  2L8T A;  2G7H A;  1O0W A;  2UXC E;  3ADI A;  4JI0 E;  1DI2 A;  1T4L B;  2YU5 A;  4ZYG A;  3MSW A;  4R2A A;  2L33 A;  2IHR 1;  2YTQ A;  3DF6 A;  2NUF A;  3AUZ A;  2NUG A;  3THN A;  2EPA A;  2L2K B;  4N4R B;  4R2D A;  5A6K A;  4DUY E;  3MHH C;  2MC5 A;  2DLQ A;  5A6B A;  5IWA E;  1X6E A;  2LCE A;  5AAS A;  4RHB B;  2EL5 A;  1T39 A;  4O4K A;  1G2F C;  2JVA A;  3RMP A;  2EMI A;  4F54 A;  1YUJ A;  4ZYD A;  1MEY C;  1IBL E;  2Q8U A;  3UK3 C;  2E5L E;  5IXM B;  2ENH A;  1X49 A;  2MDR A;  1G2D C;  2EM3 A;  1RC7 A;  2EPO A;  3BID A;  4P7D A;  4DV7 E;  2EL4 A;  1I94 E;  1A1I A;  2EMZ A;  2HGH A;  2LO3 A;  2EMK A;  1XNQ E;  4HTG A;  4O43 A;  4FK5 C;  2EWL A;  2MKN A;  2EMG A;  1P47 A;  1HNX E;  1YYK A;  4JI3 E;  1NEI A;  2NA2 A;  1IBM E;  4LF9 E;  1PJT A;  4AQY E;  4LFA E;  4M2Z A;  2L2N A;  4Q28 A;  4JI2 E;  2EPK X;  1SFE A;  2EOF A;  2FTX B;  3IWD A;  4R2E A;  4BHC A;  2EOR A;  4R2Q A;  3JAM C;  2LE2 A;  2EOY A;  2V88 A;  3HTX A;  1WHQ A;  2V89 A;  2EQ0 A;  2RSM A;  2I13 A;  5A2Q C;  4LF5 E;  4MLV A;  2YTJ A;  4LU9 A;  2E72 A;  1X3C A;  5A6B D;  2LUP B;  4M9V C;  1YYO A;  5AC5 A;  3BF2 A;  2YTG A;  3ADG A;  1BBG A;  2YTO A;  1YYW A;  2EPC A;  2EOJ A;  2EZ6 A;  1IQO A;  3HXL A;  2LUQ A;  2ELZ A;  1X47 A;  3F6G A;  5KL2 A;  2PRT A;  3T1H E;  4BHB A;  4DR3 E;  4LFC E;  2UUA E;  3EPJ A;  1T4O A;  2BB8 A;  4X9J A;  5DNY A;  4R03 A;  2YSO A;  1NCS A;  2ODR C;  5AE2 A;  2DSY A;  3VYY A;  2RSI A;  1DGC A;  2EM6 A;  2I9I A;  1ZAA C;  2EOO A;  3EPL A;  2WBT A;  2YTE A;  1EH7 A;  4KWY A;  1XNR E;  4WSP A;  1KYQ A;  2YSP A;  3EPH A;  2DMI A;  4WXD A;  4DMI A;  4F9C B;  4K0K E;  4JYA E;  1TF6 A; 
#chains in the Genus database with same CATH homology
 3MHH C;  2DLQ A;  1X6E A;  1X6F A;  2LCE A;  2DGC A;  2D9H A;  2EMA A;  2YTN A;  3VHT B;  4R2P A;  1X5W A;  4F6N A;  2EE8 A;  2EL5 A;  1TN9 A;  1X6H A;  2EMB A;  2EMY A;  4WSG A;  1G2F C;  1YUI A;  1BB8 A;  2EMI A;  1JK1 A;  2M9A A;  1A1F A;  1YUJ A;  1MEY C;  5KL5 A;  2MDG A;  1ZR9 A;  3UK3 C;  1YSA C;  1A1K A;  1A1G A;  2WCC 3;  1B69 A;  2ENH A;  1G2D C;  2ADR A;  2ENC A;  2EM3 A;  2EM2 A;  2YTF A;  3EPK A;  1LLM C;  2EP3 A;  2DRP A;  2EL4 A;  2ENA A;  1A1I A;  2EOH A;  2EPU A;  2EQ1 A;  2EMZ A;  2NAB A;  2HGH A;  2LO3 A;  1A1L A;  2EMK A;  5KL3 A;  2JPA A;  4IS1 C;  2EM8 A;  2J7J A;  2LV2 A;  4FK5 C;  1RMD A;  2EMW A;  4IJD A;  2MKN A;  2EN8 A;  2EMG A;  2YRM A;  1P47 A;  5KL6 A;  2EN2 A;  2EM4 A;  2YRK A;  2WBS A;  2EN7 A;  2LT7 A;  2CSH A;  2EPR A;  1F2I G;  2GHF A;  2CTD A;  2EOF A;  2EN6 A;  4R2E A;  2EOR A;  2EPP A;  4R2Q A;  1BBO A;  2EOY A;  2A25 A;  5KL7 A;  2R1F A;  4R2R A;  2YU8 A;  2EMF A;  2EMX A;  3M99 B;  2EQ0 A;  2I13 A;  1Z1B A;  2EPX A;  2JP9 A;  2YTJ A;  2EOX A;  2VRD A;  2E72 A;  1X3C A;  2EOE A;  1AAY A;  1A1H A;  4M9V C;  5KL4 A;  1UN6 B;  2MKD A;  4GZN C;  2EMH A;  2RPC A;  2EOS A;  2YTG A;  2EN1 A;  4F6M A;  2YTO A;  2EPC A;  2EOJ A;  2WBU A;  1KJK A;  2ELZ A;  4R2C A;  5KL2 A;  2EN4 A;  2PRT A;  2YTI A;  1WJP A;  2EM0 A;  2CT1 A;  2DLK A;  2EM9 A;  2EM5 A;  3EPJ A;  2BB8 A;  4F2J C;  2EQ3 A;  1UBD C;  2LVH A;  4X9J A;  2EN3 A;  2YSO A;  1NCS A;  2EMC A;  2YU5 A;  2EJ4 A;  2EOM A;  2EML A;  2RSI A;  2EOZ A;  4R2A A;  1DGC A;  2GLI A;  2EM6 A;  1TF3 A;  1JK2 A;  1ZAA C;  2EOO A;  2YTQ A;  3EPL A;  2WBT A;  2EOQ A;  2YTD A;  2EL6 A;  4R2S A;  3MHS C;  1A1J A;  2EPZ A;  2YTE A;  2EOI A;  2EPA A;  2ELY A;  2YTP A;  4R2D A;  2YSP A;  1ZU1 A;  3EPH A;  2DMI A;  2YRH A;  2EM7 A;  1TF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...