2EPUA

Solution structure of the secound c2h2 type zinc finger domain of zinc finger protein 32
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
45
structure length
45
Chain Sequence
GSSGSSGTGQKPFECTHCGKSFRAKGNLVTHQRIHTGEKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the secound C2H2 type zinc finger domain of Zinc finger protein 32
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 32
total genus 6
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2epuA01
3UK3C 2EJ4A 2EN8A 2EM9A 2EQ1A 2EOFA 2EMXA 2EMKA 1BB8A 5KL5A 1NCSA 5KL2A 2A25A 2EP3A 5KL3A 2ENHA 2R1FA 1A1GA 2EOQA 2RPCA 4R2SA 1A1LA 3EPLA 1KJKA 2EM0A 2YSPA 1LLMC 2EOIA 4R2QA 4R2RA 2DRPA 1X5WA 2ELZA 2EN4A 1B69A 4F2JC 2EQ0A 2MKNA 1YSAC 2EMIA 2DGCA 2EM4A 1X6HA 2EE8A 2D9HA 3MHSC 2EL6A 2RSIA 2CTDA 2EOYA 2EOMA 2EL4A 2YTFA 4M9VC 1YUIA 1A1FA 4R2DA 1DGCA 1TF3A 2LCEA 2BB8A 2GLIA 3MHHC 2YTOA 4GZNC 1A1HA 2EPCA 2EM6A 2YRMA 2EMGA 2YTQA 2WBSA 2EN1A 1UN6B 1BBOA 2WCC3 1YUJA 4IS1C 2EMCA 2YRHA 5KL7A 2EM5A 3EPJA 2EMZA 2EORA 1X6EA 1P47A 2VRDA 2DLQA 2M9AA 2EOSA 2DLKA 2EMLA 3M99B 2J7JA 1ZR9A 2YU5A 2JP9A 2I13A 2YTDA 2EN2A 2EOZA 4R2EA 2EN3A 2EQ3A 1TF6A 2EOHA 2MKDA 2EN6A 1G2DC 5KL4A 2MDGA 2EMHA 2EM8A 2YTPA 2EM7A 3EPKA 2LO3A 4X9JA 2YTJA 1JK1A 2YSOA 2EPAA 2EPUA 2ELYA 2YTEA 1A1KA 2EMAA 1UBDC 4F6NA 3EPHA 4R2AA 2WBTA 2LV2A 1A1IA 2EM2A 2EM3A 2YU8A 4WSGA 1TN9A 2PRTA 1WJPA 2EPZA 1JK2A 2ENCA 2WBUA 2YTGA 2CSHA 2EMBA 1F2IG 2ADRA 2EOXA 2EOJA 2E72A 2DMIA 3VHTB 2YTIA 2HGHA 2EMWA 2EN7A 1AAYA 2EL5A 2YRKA 5KL6A 1MEYC 2EOEA 2GHFA 1X6FA 2EPPA 4R2PA 2EPRA 1X3CA 2CT1A 4F6MA 4R2CA 1RMDA 2EMFA 2NABA 2EPXA 2JPAA 2EMYA 4FK5C 1Z1BA 2ENAA 2YTNA 2LVHA 2EOOA 2LT7A 1ZU1A 1ZAAC 4IJDA 1A1JA 1G2FC
chains in the Genus database with same CATH superfamily
1EKZA 4BMJA 3UK3C 2EJ4A 2EN8A 2EQ1A 1T39A 5A6BD 1UILA 1ZBTA 2EMKA 1RQ0A 1BB8A 3JTZA 4LFAE 1NCSA 5KL3A 2EP3A 4GKKE 5A6JA 4R2SA 4JI0E 2EM0A 1LLMC 2LUQA 4R2RA 3HXLA 4JYAE 1YYKA 1PKPA 2DSYA 2EN4A 3OTOE 2EQ0A 1QNTA 2Q8UA 2MKNA 1YSAC 2DGCA 3VYYA 3AUZA 2EZ6A 3MHSC 2RSIA 1SFEA 4BHCA 1FJGE 2EOYA 1YPNA 2E5LE 2EL4A 2MDRA 1N33E 1A1FA 4YY3E 4R2DA 2KHXA 1TF3A 4K0KE 2FGGA 4GZNC 2JXPA 1YYWA 4LU9A 5IV8B 2L8TA 4WSPA 2WBSA 2B7TA 1UN6B 2EMCA 4OX9E 2N3GA 2HHHE 1XNRE 3QG5C 3EPJA 4RH8A 2EORA 2VRDA 2M9AA 5ADZA 2DLKA 3M99B 2G7HA 2NA2A 5LLQA 4GKJE 4DR1E 3C4BA 2EMHA 2LTRA 4KHPE 2LUPB 2VF1A 1STUA 2YTPA 2KOUA 3HQ1A 4X9JA 2YSOA 2EPAA 5A6BA 4JI3E 2EPKX 2EPUA 2RTXA 2ELYA 2YTEA 4NZVA 4OOGC 2EMAA 2HC5A 4JI4E 2K7IA 2M7QA 3EPHA 5FLXC 2UXCE 5IWAE 1TN9A 2EM3A 2IHR1 4WSGA 4GEQB 4TUIA 3EQ1A 2UUCE 5AASA 1IQOA 4WYQB 2EPZA 1JK2A 3LMLA 2B7VA 4WPYA 1F2IG 2V85A 2EOXA 2E72A 2LE2A 2EN7A 2GHFA 1T4NA 4BCAA 2EPPA 4R2PA 2E1MA 2R76A 2VQFE 4DV2E 2H36X 2DMYA 2JY9A 2EPXA 4JI5E 4Q28A 1Z1BA 2ENAA 1N32E 4BBYA 4DV0E 2M4IA 5A69A 3KZZA 4DV3E 2BBGA 4Q35B 4DUYE 4IJDA 3HPSA 1KYQA 2EM9A 2EOFA 4KZSA 2A25A 2YWQA 2R1FA 1IBKE 1A1GA 2I9IA 2EOQA 3K6QA 1A1LA 1PJQA 4F9AB 4ZYHA 2RSMA 2EPMX 1B69A 4F2JC 2LJUA 2D9HA 4LF9E 3JAMC 2F4VE 3IWCA 4AQYE 2B9DA 3RMPA 2EOMA 1N3GA 4DR3E 1YUIA 1DGCA 2V83A 4P7DA 1IBLE 1EH7A 3VYXA 3MHHC 2N3HA 4DMIA 2YRMA 2EMGA 2YTQA 2DIXA 3MSWA 4ZYGA 3ADGA 1BBOA 2WCC3 1YUJA 2EM5A 2UXBE 1X6EA 3BGHA 2LJHA 4DV5E 2ODRC 3ADLA 2J7JA 1ZR9A 4LF8E 1N36E 3TQMA 2CPNA 3C4TA 4R2EA 1O0WA 2EQ3A 2B3TB 2LTSA 1G2DC 3BF2A 4JV5E 2YPNA 2EM7A 2LO3A 2RS6A 1JK1A 4ZYEA 1IBME 5BR8E 3VK6A 3OMLA 3T1HE 2LV2A 1A1IA 2EM2A 2V87A 2YU8A 1J26A 2V86A 1YYOA 3THNA 4DR7E 1NEIA 4WXDA 1PJTA 5CFFE 4JI2E 2ENCA 3DJWA 3KZYA 3ADIA 2ADRA 2WZOA 2EOJA 3VHTB 2NUFA 4NXNE 2JVAA 2EL5A 2YRKA 5KL6A 1X6FA 1X3CA 4R2CA 5AE1A 2UUBE 4DUZE 4FK5C 4F9BB 4MLQA 1HNWE 1WXRA 4DR6E 1ZU1A 4X64E 1EH6A 4F9CB 1T4OA 3C6KA 2FTXB 2UU9E 5TSEA 4P78A 5KL5A 2NUGA 3P1XA 5KL2A 3J81C 5A6AA 2ODRD 2RPCA 5A6KA 4X65E 4B3SE 3EPLA 1KJKA 4BS9A 2YSPA 2EOIA 2MC5A 1BBGA 1GTKA 4LF4E 2DRPA 1X5WA 1WHNA 3HTXA 4BC7A 1DI2A 3KWRA 1YFHA 3THOB 2UUAE 2RQLA 2EMIA 2EM4A 2V8QB 4MLVA 2EL6A 4WXCA 4L8NA 4R8OA 1T38A 1HNXE 2YTFA 4M9VC 4O24A 2GPIA 2YTOA 1A1HA 2EM6A 4JI6E 4LF6E 1UHZA 2JOXA 2YRHA 4JI1E 1QU6A 2EPNA 2EMZA 4TUGA 2LBSB 2V89A 1P47A 2DLQA 5F3WA 3DF6A 2EOSA 4NHRA 2MC6A 1GQEA 4M2ZA 4DV7E 4M30A 4JI8E 2EOZA 3LLHA 4ZYDA 5KL4A 3BBGA 1N34E 2L2NA 3AV0A 4J8ZA 1IQSA 2EM8A 2HJJA 2L92A 2YTJA 5T6JA 2YT4A 5IXMB 1XNQE 1UBDC 2NUEA 4F6NA 1T4LB 2WBTA 2KONA 2L2MA 3HPZA 4JI7E 3ZOQB 4N4RB 2PRTA 4DR5E 3ADJA 4M0VA 2WBUA 2CSHA 4LTYA 2DMIA 2YTIA 2EMWA 2FV4B 1MEYC 2EOEA 4YHHE 2EPRA 2L33A 1X47A 1RMDA 2JPAA 2LVHA 2EOOA 2JWOA 4DKKA 1ZAAC 4DV6E 3L00A 1J5EE 4X62E 1DQ3A 4R03A 4BHBA 2JYAA 1EH8A 1RC7A 2EMXA 2N8XA 2ENHA 4DR4E 2UXDE 1ZBQA 1AH5A 3F6GA 1GZ6A 4LF7E 4DV4E 3F6HA 5LMUE 4R2QA 2L3JA 2L3CA 4O4KA 5AE2A 1HR0E 1WRJA 1X48A 2ELZA 2LRSA 4HTGA 1WHQA 1X6HA 2EE8A 1L4SA 2CTDA 3T1YE 2V88A 5A2QC 4RHBB 2EPOA 1X49A 1PJSA 3JU0A 4DR2E 2LCEA 4LFBE 2BB8A 3IWBA 2GLIA 1XMQE 2L2KB 4B3ME 2EPCA 4LF5E 2EN1A 5LMNE 1SR9A 4IS1C 5KL7A 4DV1E 3H09A 3IWDA 2K4VA 5AC4A 4X66E 4O43A 3BIDA 1YZ9A 2LMZA 2EMLA 4NXME 4O5GA 1MGTA 2YU5A 5IT9C 2JP9A 2I13A 2YTDA 2EN2A 5LL6R 2EN3A 1TF6A 2EOHA 2MKDA 2EN6A 1FKAE 3FIGA 2MDGA 1HNZE 5AC5A 2JR1A 3ECRA 2F8BA 3EPKA 4WX9A 1IMUA 3J7AG 2RS7A 4F54A 1A1KA 3C6MA 3J80C 4I8OA 4R2AA 5AE3A 3J7Yp 2ZM6E 2M1SA 4KWYA 5DNYA 2DB2A 1WJPA 4WFTA 2YTGA 2EPLX 2EMBA 2L6MA 2HGHA 2JOBA 1AAYA 2EWLA 1PDAA 2VE7C 2CT1A 4F6MA 4BC9A 2EMFA 2NABA 4L5NC 4LFCE 1I94E 2EMYA 4HEIA 4X8WA 2YTNA 2VQEE 2LT7A 1A1JA 2YZTA 4B3TE 4B3RE 1XMOE 1G2FC
chains in the Genus database with same CATH topology
3UK3C 2EJ4A 2EN8A 2EM9A 2EQ1A 2EOFA 2EMXA 2EMKA 1BB8A 5KL5A 1NCSA 5KL2A 2A25A 2EP3A 5KL3A 2ENHA 2R1FA 1A1GA 2EOQA 2RPCA 4R2SA 1A1LA 3EPLA 1KJKA 2EM0A 2YSPA 1LLMC 2EOIA 4R2QA 4R2RA 2DRPA 1X5WA 2ELZA 2EN4A 1B69A 4F2JC 2EQ0A 2MKNA 1YSAC 2EMIA 2DGCA 2EM4A 1X6HA 2EE8A 2D9HA 3MHSC 2EL6A 2RSIA 2CTDA 2EOYA 2EOMA 2EL4A 2YTFA 4M9VC 1YUIA 1A1FA 4R2DA 1DGCA 1TF3A 2LCEA 2BB8A 2GLIA 3MHHC 2YTOA 4GZNC 1A1HA 2EPCA 2EM6A 2YRMA 2EMGA 2YTQA 2WBSA 2EN1A 1UN6B 1BBOA 2WCC3 1YUJA 4IS1C 2EMCA 2YRHA 5KL7A 2EM5A 3EPJA 2EMZA 2EORA 1X6EA 1P47A 2VRDA 2DLQA 2M9AA 2EOSA 2DLKA 2EMLA 3M99B 2J7JA 1ZR9A 2YU5A 2JP9A 2I13A 2YTDA 2EN2A 2EOZA 4R2EA 2EN3A 2EQ3A 1TF6A 2EOHA 2MKDA 2EN6A 1G2DC 5KL4A 2MDGA 2EMHA 2EM8A 2YTPA 2EM7A 3EPKA 2LO3A 4X9JA 2YTJA 1JK1A 2YSOA 2EPAA 2EPUA 2ELYA 2YTEA 1A1KA 2EMAA 1UBDC 4F6NA 3EPHA 4R2AA 2WBTA 2LV2A 1A1IA 2EM2A 2EM3A 2YU8A 4WSGA 1TN9A 2PRTA 1WJPA 2EPZA 1JK2A 2ENCA 2WBUA 2YTGA 2CSHA 2EMBA 1F2IG 2ADRA 2EOXA 2EOJA 2E72A 2DMIA 3VHTB 2YTIA 2HGHA 2EMWA 2EN7A 1AAYA 2EL5A 2YRKA 5KL6A 1MEYC 2EOEA 2GHFA 1X6FA 2EPPA 4R2PA 2EPRA 1X3CA 2CT1A 4F6MA 4R2CA 1RMDA 2EMFA 2NABA 2EPXA 2JPAA 2EMYA 4FK5C 1Z1BA 2ENAA 2YTNA 2LVHA 2EOOA 2LT7A 1ZU1A 1ZAAC 4IJDA 1A1JA 1G2FC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UK3 C;  2EJ4 A;  2EN8 A;  2EM9 A;  2EQ1 A;  2EOF A;  2EMX A;  2EMK A;  1BB8 A;  5KL5 A;  1NCS A;  5KL2 A;  2A25 A;  2EP3 A;  5KL3 A;  2ENH A;  2R1F A;  1A1G A;  2EOQ A;  2RPC A;  4R2S A;  1A1L A;  3EPL A;  1KJK A;  2EM0 A;  2YSP A;  1LLM C;  2EOI A;  4R2Q A;  4R2R A;  2DRP A;  1X5W A;  2ELZ A;  2EN4 A;  1B69 A;  4F2J C;  2EQ0 A;  2MKN A;  1YSA C;  2EMI A;  2DGC A;  2EM4 A;  1X6H A;  2EE8 A;  2D9H A;  3MHS C;  2EL6 A;  2RSI A;  2CTD A;  2EOY A;  2EOM A;  2EL4 A;  2YTF A;  4M9V C;  1YUI A;  1A1F A;  4R2D A;  1DGC A;  1TF3 A;  2LCE A;  2BB8 A;  2GLI A;  3MHH C;  2YTO A;  4GZN C;  1A1H A;  2EPC A;  2EM6 A;  2YRM A;  2EMG A;  2YTQ A;  2WBS A;  2EN1 A;  1UN6 B;  1BBO A;  2WCC 3;  1YUJ A;  4IS1 C;  2EMC A;  2YRH A;  5KL7 A;  2EM5 A;  3EPJ A;  2EMZ A;  2EOR A;  1X6E A;  1P47 A;  2VRD A;  2DLQ A;  2M9A A;  2EOS A;  2DLK A;  2EML A;  3M99 B;  2J7J A;  1ZR9 A;  2YU5 A;  2JP9 A;  2I13 A;  2YTD A;  2EN2 A;  2EOZ A;  4R2E A;  2EN3 A;  2EQ3 A;  1TF6 A;  2EOH A;  2MKD A;  2EN6 A;  1G2D C;  5KL4 A;  2MDG A;  2EMH A;  2EM8 A;  2YTP A;  2EM7 A;  3EPK A;  2LO3 A;  4X9J A;  2YTJ A;  1JK1 A;  2YSO A;  2EPA A;  2EPU A;  2ELY A;  2YTE A;  1A1K A;  2EMA A;  1UBD C;  4F6N A;  3EPH A;  4R2A A;  2WBT A;  2LV2 A;  1A1I A;  2EM2 A;  2EM3 A;  2YU8 A;  4WSG A;  1TN9 A;  2PRT A;  1WJP A;  2EPZ A;  1JK2 A;  2ENC A;  2WBU A;  2YTG A;  2CSH A;  2EMB A;  1F2I G;  2ADR A;  2EOX A;  2EOJ A;  2E72 A;  2DMI A;  3VHT B;  2YTI A;  2HGH A;  2EMW A;  2EN7 A;  1AAY A;  2EL5 A;  2YRK A;  5KL6 A;  1MEY C;  2EOE A;  2GHF A;  1X6F A;  2EPP A;  4R2P A;  2EPR A;  1X3C A;  2CT1 A;  4F6M A;  4R2C A;  1RMD A;  2EMF A;  2NAB A;  2EPX A;  2JPA A;  2EMY A;  4FK5 C;  1Z1B A;  2ENA A;  2YTN A;  2LVH A;  2EOO A;  2LT7 A;  1ZU1 A;  1ZAA C;  4IJD A;  1A1J A;  1G2F C; 
#chains in the Genus database with same CATH topology
 1EKZ A;  4BMJ A;  3UK3 C;  2EJ4 A;  2EN8 A;  2EQ1 A;  1T39 A;  5A6B D;  1UIL A;  1ZBT A;  2EMK A;  1RQ0 A;  1BB8 A;  3JTZ A;  4LFA E;  1NCS A;  5KL3 A;  2EP3 A;  4GKK E;  5A6J A;  4R2S A;  4JI0 E;  2EM0 A;  1LLM C;  2LUQ A;  4R2R A;  3HXL A;  4JYA E;  1YYK A;  1PKP A;  2DSY A;  2EN4 A;  3OTO E;  2EQ0 A;  1QNT A;  2Q8U A;  2MKN A;  1YSA C;  2DGC A;  3VYY A;  3AUZ A;  2EZ6 A;  3MHS C;  2RSI A;  1SFE A;  4BHC A;  1FJG E;  2EOY A;  1YPN A;  2E5L E;  2EL4 A;  2MDR A;  1N33 E;  1A1F A;  4YY3 E;  4R2D A;  2KHX A;  1TF3 A;  4K0K E;  2FGG A;  4GZN C;  2JXP A;  1YYW A;  4LU9 A;  5IV8 B;  2L8T A;  4WSP A;  2WBS A;  2B7T A;  1UN6 B;  2EMC A;  4OX9 E;  2N3G A;  2HHH E;  1XNR E;  3QG5 C;  3EPJ A;  4RH8 A;  2EOR A;  2VRD A;  2M9A A;  5ADZ A;  2DLK A;  3M99 B;  2G7H A;  2NA2 A;  5LLQ A;  4GKJ E;  4DR1 E;  3C4B A;  2EMH A;  2LTR A;  4KHP E;  2LUP B;  2VF1 A;  1STU A;  2YTP A;  2KOU A;  3HQ1 A;  4X9J A;  2YSO A;  2EPA A;  5A6B A;  4JI3 E;  2EPK X;  2EPU A;  2RTX A;  2ELY A;  2YTE A;  4NZV A;  4OOG C;  2EMA A;  2HC5 A;  4JI4 E;  2K7I A;  2M7Q A;  3EPH A;  5FLX C;  2UXC E;  5IWA E;  1TN9 A;  2EM3 A;  2IHR 1;  4WSG A;  4GEQ B;  4TUI A;  3EQ1 A;  2UUC E;  5AAS A;  1IQO A;  4WYQ B;  2EPZ A;  1JK2 A;  3LML A;  2B7V A;  4WPY A;  1F2I G;  2V85 A;  2EOX A;  2E72 A;  2LE2 A;  2EN7 A;  2GHF A;  1T4N A;  4BCA A;  2EPP A;  4R2P A;  2E1M A;  2R76 A;  2VQF E;  4DV2 E;  2H36 X;  2DMY A;  2JY9 A;  2EPX A;  4JI5 E;  4Q28 A;  1Z1B A;  2ENA A;  1N32 E;  4BBY A;  4DV0 E;  2M4I A;  5A69 A;  3KZZ A;  4DV3 E;  2BBG A;  4Q35 B;  4DUY E;  4IJD A;  3HPS A;  1KYQ A;  2EM9 A;  2EOF A;  4KZS A;  2A25 A;  2YWQ A;  2R1F A;  1IBK E;  1A1G A;  2I9I A;  2EOQ A;  3K6Q A;  1A1L A;  1PJQ A;  4F9A B;  4ZYH A;  2RSM A;  2EPM X;  1B69 A;  4F2J C;  2LJU A;  2D9H A;  4LF9 E;  3JAM C;  2F4V E;  3IWC A;  4AQY E;  2B9D A;  3RMP A;  2EOM A;  1N3G A;  4DR3 E;  1YUI A;  1DGC A;  2V83 A;  4P7D A;  1IBL E;  1EH7 A;  3VYX A;  3MHH C;  2N3H A;  4DMI A;  2YRM A;  2EMG A;  2YTQ A;  2DIX A;  3MSW A;  4ZYG A;  3ADG A;  1BBO A;  2WCC 3;  1YUJ A;  2EM5 A;  2UXB E;  1X6E A;  3BGH A;  2LJH A;  4DV5 E;  2ODR C;  3ADL A;  2J7J A;  1ZR9 A;  4LF8 E;  1N36 E;  3TQM A;  2CPN A;  3C4T A;  4R2E A;  1O0W A;  2EQ3 A;  2B3T B;  2LTS A;  1G2D C;  3BF2 A;  4JV5 E;  2YPN A;  2EM7 A;  2LO3 A;  2RS6 A;  1JK1 A;  4ZYE A;  1IBM E;  5BR8 E;  3VK6 A;  3OML A;  3T1H E;  2LV2 A;  1A1I A;  2EM2 A;  2V87 A;  2YU8 A;  1J26 A;  2V86 A;  1YYO A;  3THN A;  4DR7 E;  1NEI A;  4WXD A;  1PJT A;  5CFF E;  4JI2 E;  2ENC A;  3DJW A;  3KZY A;  3ADI A;  2ADR A;  2WZO A;  2EOJ A;  3VHT B;  2NUF A;  4NXN E;  2JVA A;  2EL5 A;  2YRK A;  5KL6 A;  1X6F A;  1X3C A;  4R2C A;  5AE1 A;  2UUB E;  4DUZ E;  4FK5 C;  4F9B B;  4MLQ A;  1HNW E;  1WXR A;  4DR6 E;  1ZU1 A;  4X64 E;  1EH6 A;  4F9C B;  1T4O A;  3C6K A;  2FTX B;  2UU9 E;  5TSE A;  4P78 A;  5KL5 A;  2NUG A;  3P1X A;  5KL2 A;  3J81 C;  5A6A A;  2ODR D;  2RPC A;  5A6K A;  4X65 E;  4B3S E;  3EPL A;  1KJK A;  4BS9 A;  2YSP A;  2EOI A;  2MC5 A;  1BBG A;  1GTK A;  4LF4 E;  2DRP A;  1X5W A;  1WHN A;  3HTX A;  4BC7 A;  1DI2 A;  3KWR A;  1YFH A;  3THO B;  2UUA E;  2RQL A;  2EMI A;  2EM4 A;  2V8Q B;  4MLV A;  2EL6 A;  4WXC A;  4L8N A;  4R8O A;  1T38 A;  1HNX E;  2YTF A;  4M9V C;  4O24 A;  2GPI A;  2YTO A;  1A1H A;  2EM6 A;  4JI6 E;  4LF6 E;  1UHZ A;  2JOX A;  2YRH A;  4JI1 E;  1QU6 A;  2EPN A;  2EMZ A;  4TUG A;  2LBS B;  2V89 A;  1P47 A;  2DLQ A;  5F3W A;  3DF6 A;  2EOS A;  4NHR A;  2MC6 A;  1GQE A;  4M2Z A;  4DV7 E;  4M30 A;  4JI8 E;  2EOZ A;  3LLH A;  4ZYD A;  5KL4 A;  3BBG A;  1N34 E;  2L2N A;  3AV0 A;  4J8Z A;  1IQS A;  2EM8 A;  2HJJ A;  2L92 A;  2YTJ A;  5T6J A;  2YT4 A;  5IXM B;  1XNQ E;  1UBD C;  2NUE A;  4F6N A;  1T4L B;  2WBT A;  2KON A;  2L2M A;  3HPZ A;  4JI7 E;  3ZOQ B;  4N4R B;  2PRT A;  4DR5 E;  3ADJ A;  4M0V A;  2WBU A;  2CSH A;  4LTY A;  2DMI A;  2YTI A;  2EMW A;  2FV4 B;  1MEY C;  2EOE A;  4YHH E;  2EPR A;  2L33 A;  1X47 A;  1RMD A;  2JPA A;  2LVH A;  2EOO A;  2JWO A;  4DKK A;  1ZAA C;  4DV6 E;  3L00 A;  1J5E E;  4X62 E;  1DQ3 A;  4R03 A;  4BHB A;  2JYA A;  1EH8 A;  1RC7 A;  2EMX A;  2N8X A;  2ENH A;  4DR4 E;  2UXD E;  1ZBQ A;  1AH5 A;  3F6G A;  1GZ6 A;  4LF7 E;  4DV4 E;  3F6H A;  5LMU E;  4R2Q A;  2L3J A;  2L3C A;  4O4K A;  5AE2 A;  1HR0 E;  1WRJ A;  1X48 A;  2ELZ A;  2LRS A;  4HTG A;  1WHQ A;  1X6H A;  2EE8 A;  1L4S A;  2CTD A;  3T1Y E;  2V88 A;  5A2Q C;  4RHB B;  2EPO A;  1X49 A;  1PJS A;  3JU0 A;  4DR2 E;  2LCE A;  4LFB E;  2BB8 A;  3IWB A;  2GLI A;  1XMQ E;  2L2K B;  4B3M E;  2EPC A;  4LF5 E;  2EN1 A;  5LMN E;  1SR9 A;  4IS1 C;  5KL7 A;  4DV1 E;  3H09 A;  3IWD A;  2K4V A;  5AC4 A;  4X66 E;  4O43 A;  3BID A;  1YZ9 A;  2LMZ A;  2EML A;  4NXM E;  4O5G A;  1MGT A;  2YU5 A;  5IT9 C;  2JP9 A;  2I13 A;  2YTD A;  2EN2 A;  5LL6 R;  2EN3 A;  1TF6 A;  2EOH A;  2MKD A;  2EN6 A;  1FKA E;  3FIG A;  2MDG A;  1HNZ E;  5AC5 A;  2JR1 A;  3ECR A;  2F8B A;  3EPK A;  4WX9 A;  1IMU A;  3J7A G;  2RS7 A;  4F54 A;  1A1K A;  3C6M A;  3J80 C;  4I8O A;  4R2A A;  5AE3 A;  3J7Y p;  2ZM6 E;  2M1S A;  4KWY A;  5DNY A;  2DB2 A;  1WJP A;  4WFT A;  2YTG A;  2EPL X;  2EMB A;  2L6M A;  2HGH A;  2JOB A;  1AAY A;  2EWL A;  1PDA A;  2VE7 C;  2CT1 A;  4F6M A;  4BC9 A;  2EMF A;  2NAB A;  4L5N C;  4LFC E;  1I94 E;  2EMY A;  4HEI A;  4X8W A;  2YTN A;  2VQE E;  2LT7 A;  1A1J A;  2YZT A;  4B3T E;  4B3R E;  1XMO E;  1G2F C; 
#chains in the Genus database with same CATH homology
 3UK3 C;  2EJ4 A;  2EN8 A;  2EM9 A;  2EQ1 A;  2EOF A;  2EMX A;  2EMK A;  1BB8 A;  5KL5 A;  1NCS A;  5KL2 A;  2A25 A;  2EP3 A;  5KL3 A;  2ENH A;  2R1F A;  1A1G A;  2EOQ A;  2RPC A;  4R2S A;  1A1L A;  3EPL A;  1KJK A;  2EM0 A;  2YSP A;  1LLM C;  2EOI A;  4R2Q A;  4R2R A;  2DRP A;  1X5W A;  2ELZ A;  2EN4 A;  1B69 A;  4F2J C;  2EQ0 A;  2MKN A;  1YSA C;  2EMI A;  2DGC A;  2EM4 A;  1X6H A;  2EE8 A;  2D9H A;  3MHS C;  2EL6 A;  2RSI A;  2CTD A;  2EOY A;  2EOM A;  2EL4 A;  2YTF A;  4M9V C;  1YUI A;  1A1F A;  4R2D A;  1DGC A;  1TF3 A;  2LCE A;  2BB8 A;  2GLI A;  3MHH C;  2YTO A;  4GZN C;  1A1H A;  2EPC A;  2EM6 A;  2YRM A;  2EMG A;  2YTQ A;  2WBS A;  2EN1 A;  1UN6 B;  1BBO A;  2WCC 3;  1YUJ A;  4IS1 C;  2EMC A;  2YRH A;  5KL7 A;  2EM5 A;  3EPJ A;  2EMZ A;  2EOR A;  1X6E A;  1P47 A;  2VRD A;  2DLQ A;  2M9A A;  2EOS A;  2DLK A;  2EML A;  3M99 B;  2J7J A;  1ZR9 A;  2YU5 A;  2JP9 A;  2I13 A;  2YTD A;  2EN2 A;  2EOZ A;  4R2E A;  2EN3 A;  2EQ3 A;  1TF6 A;  2EOH A;  2MKD A;  2EN6 A;  1G2D C;  5KL4 A;  2MDG A;  2EMH A;  2EM8 A;  2YTP A;  2EM7 A;  3EPK A;  2LO3 A;  4X9J A;  2YTJ A;  1JK1 A;  2YSO A;  2EPA A;  2EPU A;  2ELY A;  2YTE A;  1A1K A;  2EMA A;  1UBD C;  4F6N A;  3EPH A;  4R2A A;  2WBT A;  2LV2 A;  1A1I A;  2EM2 A;  2EM3 A;  2YU8 A;  4WSG A;  1TN9 A;  2PRT A;  1WJP A;  2EPZ A;  1JK2 A;  2ENC A;  2WBU A;  2YTG A;  2CSH A;  2EMB A;  1F2I G;  2ADR A;  2EOX A;  2EOJ A;  2E72 A;  2DMI A;  3VHT B;  2YTI A;  2HGH A;  2EMW A;  2EN7 A;  1AAY A;  2EL5 A;  2YRK A;  5KL6 A;  1MEY C;  2EOE A;  2GHF A;  1X6F A;  2EPP A;  4R2P A;  2EPR A;  1X3C A;  2CT1 A;  4F6M A;  4R2C A;  1RMD A;  2EMF A;  2NAB A;  2EPX A;  2JPA A;  2EMY A;  4FK5 C;  1Z1B A;  2ENA A;  2YTN A;  2LVH A;  2EOO A;  2LT7 A;  1ZU1 A;  1ZAA C;  4IJD A;  1A1J A;  1G2F C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...