4F9AB

Human cdc7 kinase in complex with dbf4 and nucleotide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
129
structure length
90
Chain Sequence
RLKKPFVKVEDMSQLYRPFYLQLTNMPFINYSIQKPCSPFDGYCECCLQKYEDLETHLLSEQHRNFAQSNQYQVVDDIVSKLVFDFVEYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cell division cycle 7-related protein kinase
publication title Crystal structure of human CDC7 kinase in complex with its activator DBF4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 14
structure length 90
sequence length 129
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07535 zf-DBF DBF zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.680 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4f9aB02
4F9BB 4F9AB 4F9CB
chains in the Genus database with same CATH superfamily
3BGHA 2EPUA 2EN3A 2RSIA 1YPNA 2WBSA 2E5LE 3ZOQB 2JYAA 2ODRC 5LL6R 5BR8E 2EPNA 5DNYA 2GLIA 2R76A 4WFTA 1X48A 2LE2A 5IXMB 2CTDA 4IJDA 2EPRA 4O43A 4L5NC 4M2ZA 4NZVA 1EKZA 4BC9A 2FV4B 4BCAA 2F8BA 2WBUA 2G7HA 4ZYEA 3DF6A 4X66E 3H09A 4ZYHA 2DRPA 2Q8UA 2L3JA 5FLXC 1IMUA 2ENCA 4DV5E 2RQLA 4HEIA 2YRMA 2LTRA 2BBGA 2K7IA 1N3GA 4R8OA 4F9AB 2WBTA 2N3HA 1YYWA 1N34E 2MC6A 1X3CA 1FKAE 2H36X 3J80C 4WX9A 1DQ3A 4AQYE 2YTIA 1AH5A 1RC7A 5AC4A 4R2CA 2BB8A 3OMLA 2V89A 2YSOA 3BIDA 2D9HA 3C4TA 2EM0A 5A6JA 4DR4E 2EOIA 2EPXA 2K4VA 1G2DC 2JOBA 4LF6E 5CFFE 2LT7A 3AUZA 4JI0E 4OOGC 4LFCE 2DMYA 2KONA 5IWAE 2VRDA 2EORA 2JXPA 4DV7E 3HQ1A 5KL5A 4LF9E 1BB8A 4R2RA 4LF4E 2PRTA 2N3GA 2I13A 4MLVA 2L92A 4DV2E 3VHTB 1QNTA 2N8XA 3MHSC 2YTEA 2E1MA 1T4NA 2V85A 1A1HA 4TUIA 1O0WA 1SFEA 4B3SE 2FTXB 4O5GA 1IQOA 1DGCA 5KL6A 1L4SA 3F6HA 5KL4A 2UU9E 2CT1A 3LMLA 3HXLA 5T6JA 2YTQA 2EPCA 3M99B 2EL6A 2EL4A 2YTPA 2LMZA 3VK6A 3EPHA 2V87A 3EPKA 2EQ3A 5A6BA 2RPCA 1WHQA 4JI2E 3ADIA 1WHNA 2EN8A 1HNXE 2EN7A 4DR6E 5A69A 2VQFE 5AASA 3L00A 4LFAE 2I9IA 4X64E 2YRKA 1EH8A 2EMLA 2FGGA 2RS7A 2EPOA 1T4OA 2A25A 4F54A 2LBSB 2B7VA 3T1HE 1KYQA 3FIGA 2EE8A 2EM3A 2EOFA 2JPAA 2YTFA 2EOMA 3J7AG 2GHFA 2VQEE 4GZNC 1WRJA 2RTXA 4O24A 5IT9C 2EJ4A 3C4BA 2LV2A 1UBDC 1X5WA 4R2EA 2LRSA 2EMYA 2YTNA 2EQ0A 1BBOA 2EOYA 2JVAA 1PJQA 3K6QA 3VYYA 2WCC3 3HTXA 2KHXA 1UILA 4WPYA 4JI3E 4DV4E 3EQ1A 1XMOE 4P7DA 3TQMA 4F2JC 1BBGA 2CPNA 2EPZA 5KL3A 2L2KB 4WSGA 1TF6A 2NUFA 2EN2A 2ELYA 2EOJA 5AE3A 2L2MA 2UXCE 4R2SA 2WZOA 1RMDA 2YTOA 3BBGA 4BBYA 2YRHA 4F9BB 4WXDA 3C6KA 2E72A 1A1IA 2RSMA 2M7QA 4DUZE 2F4VE 4JI4E 4F9CB 2RS6A 3EPJA 5TSEA 3BF2A 1PJTA 2YTJA 2DB2A 4DR2E 1N36E 5A6AA 4DKKA 3F6GA 1X6FA 2EPMX 1IBLE 4L8NA 2MKDA 4RHBB 4JI8E 1JK2A 1KJKA 4BHBA 4DV3E 1ZBQA 1I94E 2DGCA 2ELZA 1DI2A 2EPLX 2NABA 3IWDA 3HPZA 2L2NA 2YTDA 2JY9A 1A1LA 1WJPA 2MC5A 2LUQA 1XMQE 4MLQA 4LF5E 2UUCE 1MEYC 2IHR1 1F2IG 2EZ6A 1P47A 2EOEA 1IQSA 1PKPA 2HHHE 2JOXA 5LLQA 1UHZA 4BMJA 5ADZA 1YUIA 1N32E 5KL7A 4NHRA 2UUAE 4B3ME 1ZU1A 1GTKA 2EOSA 2EPPA 2YWQA 3J81C 3ECRA 3OTOE 1JK1A 3LLHA 4LU9A 4WXCA 3THOB 4OX9E 4LF8E 4X8WA 5F3WA 4JI1E 4X62E 2KOUA 3JAMC 2DIXA 1RQ0A 4R03A 4ZYDA 2LVHA 4O4KA 2B3TB 3IWCA 3UK3C 3C6MA 1XNQE 1J26A 2LUPB 1ZAAC 2V86A 3EPLA 1NEIA 3KZYA 1MGTA 1STUA 2EN1A 4BS9A 4DMIA 3THNA 5AC5A 1HNWE 2YT4A 1GQEA 1IBKE 1AAYA 4LF7E 4GKKE 1HR0E 3JU0A 3ADLA 1T39A 2R1FA 4J8ZA 4BC7A 4DR1E 2EM9A 4P78A 2LJHA 2VE7C 4M30A 2LO3A 2UXDE 4F6NA 4DV0E 2L8TA 2LJUA 1YYKA 4NXNE 1GZ6A 1UN6B 5IV8B 4GKJE 1QU6A 4YY3E 2LCEA 1X47A 2ENHA 2L33A 4WYQB 2EM8A 3KWRA 1J5EE 2EM2A 2JR1A 3ADGA 4N4RB 2EMZA 5KL2A 3IWBA 3JTZA 2EM6A 1A1JA 4JI5E 1EH7A 4WSPA 1T4LB 1G2FC 3QG5C 4F6MA 2ODRD 2EN6A 2EM5A 3MHHC 4NXME 4DR5E 4GEQB 5AE2A 2V83A 2HJJA 4JYAE 4B3RE 2J7JA 2L3CA 4DR7E 2DMIA 3KZZA 1B69A 2EOHA 1TN9A 2EMIA 4R2DA 4I8OA 3AV0A 4YHHE 2EMAA 2EOZA 2CSHA 1WXRA 2HC5A 2YZTA 2B7TA 4LTYA 2EMXA 2HGHA 1N33E 2EP3A 2EMHA 2EM7A 1EH6A 4M9VC 4TUGA 4M0VA 2DLKA 5LMNE 2M9AA 4DV6E 4IS1C 1T38A 2EOQA 4X65E 2EMCA 2MDRA 2EPKX 2EPAA 2YSPA 5A2QC 4X9JA 1YFHA 2NA2A 4Q28A 4JI6E 4FK5C 3MSWA 2ADRA 2EN4A 2EMBA 1A1KA 4KWYA 1X6HA 2MKNA 4JI7E 4LFBE 2M4IA 3P1XA 5A6BD 5LMUE 2EWLA 1X6EA 4ZYGA 2UUBE 4Q35B 2JP9A 4R2PA 4DV1E 2EQ1A 1YSAC 2V88A 3VYXA 2YTGA 1NCSA 2ZM6E 1YUJA 4R2QA 5AE1A 2NUEA 2B9DA 2YU8A 1Z1BA 4BHCA 2YPNA 1FJGE 2NUGA 1SR9A 4KZSA 4DR3E 1ZBTA 2EMGA 1YZ9A 1A1GA 2EOXA 1XNRE 4RH8A 3ADJA 1YYOA 5A6KA 1A1FA 1HNZE 1LLMC 3DJWA 2JWOA 2EOOA 2EMWA 2M1SA 4B3TE 2YU5A 1PJSA 3HPSA 2GPIA 3J7Yp 4R2AA 4K0KE 2DLQA 2L6MA 2ENAA 4DUYE 2EM4A 2EMKA 3RMPA 2MDGA 1IBME 4HTGA 1ZR9A 2V8QB 2VF1A 4JV5E 1TF3A 1PDAA 2EL5A 2UXBE 2EMFA 1X49A 2LTSA 2DSYA 4KHPE 3T1YE
chains in the Genus database with same CATH topology
2L3CA 1XMQE 4LF5E 4DR7E 2UUCE 2IHR1 2EZ6A 2E5LE 3VK6A 2LMZA 2V87A 3ZOQB 4I8OA 2ODRC 3AV0A 4YHHE 5LL6R 5BR8E 5DNYA 1PKPA 4WFTA 1X48A 1WHQA 2LE2A 1WXRA 2HHHE 4JI2E 2JOXA 3ADIA 2YZTA 1WHNA 1UHZA 2B7TA 4L5NC 4LTYA 4BMJA 5ADZA 1HNXE 4M2ZA 1N33E 1EKZA 1N32E 4DR6E 4BC9A 2FV4B 4BCAA 2F8BA 5AASA 2VQFE 2UUAE 4B3ME 4LFAE 4TUGA 4M0VA 4X64E 2G7HA 5LMNE 3J81C 4DV6E 3DF6A 4X66E 3OTOE 2FGGA 3LLHA 4LU9A 4X65E 3H09A 2MDRA 2RS7A 1T4OA 4F54A 2L3JA 4OX9E 5FLXC 4LF8E 4X8WA 2LBSB 2B7VA 5F3WA 3T1HE 4JI1E 4DV5E 4X62E 3FIGA 2KOUA 2LTRA 3JAMC 5A2QC 4JI3E 2DIXA 2NA2A 4Q28A 1RQ0A 3MSWA 4R8OA 4R03A 4F9AB 4JI5E 4JI6E 2N3HA 1YYWA 2B3TB 3IWCA 1N34E 2MC6A 5T6JA 1XNQE 3J7AG 1FKAE 1J26A 2H36X 3J80C 2LUPB 2VQEE 2RTXA 5IT9C 4JI7E 4LFBE 1DQ3A 4AQYE 2V86A 2M4IA 3C4BA 3P1XA 5LMUE 1RC7A 2EWLA 3OMLA 2LRSA 2UUBE 2V89A 3C4TA 1STUA 4DR4E 2JVAA 4BS9A 3K6QA 4DMIA 3VYYA 4DV1E 1HNWE 2YT4A 1GQEA 2V88A 1IBKE 4LF7E 3VYXA 2K4VA 2KHXA 2JOBA 4LF6E 3HTXA 4GKKE 1UILA 3JU0A 4WPYA 5CFFE 3AUZA 2ZM6E 4DV4E 4P7DA 1XMOE 1HR0E 4JI0E 3ADLA 4J8ZA 4OOGC 5AE1A 4LFCE 2DMYA 2KONA 4BC7A 4DR1E 2NUEA 2B9DA 2CPNA 4P78A 2LJHA 2VE7C 4M30A 2L2KB 2NUFA 5IWAE 4DV7E 2UXDE 5AE3A 2L2MA 2L8TA 4DV0E 3HQ1A 1GZ6A 1SR9A 4NXNE 1FJGE 4KZSA 1YYKA 2NUGA 2UXCE 4DR3E 2WZOA 4LF9E 1QU6A 1ZBTA 4GKJE 4YY3E 1YZ9A 4BBYA 4F9BB 1X47A 1XNRE 3ADJA 2RSMA 1YYOA 4LF4E 1HNZE 2N3GA 2L33A 2M7QA 4WYQB 3DJWA 2JWOA 4DUZE 3KWRA 2L92A 2M1SA 1J5EE 2JR1A 4F9CB 2RS6A 3ADGA 4DV2E 4B3TE 4JI4E 2F4VE 3HPSA 3J7Yp 4K0KE 2DB2A 4DR2E 3IWBA 2E1MA 2L6MA 1T4NA 3JTZA 4DUYE 1N36E 2V85A 3F6GA 4WSPA 4DKKA 3RMPA 1T4LB 1IBLE 2ODRD 1O0WA 4L8NA 4TUIA 1IBME 4JI8E 4B3SE 2FTXB 4DV3E 4NXME 1ZBQA 2V8QB 2VF1A 4DR5E 1I94E 4GEQB 4JV5E 1DI2A 3IWDA 3HPZA 2UXBE 2L2NA 3F6HA 2JY9A 5AE2A 1X49A 2LTSA 2UU9E 2V83A 2DSYA 3LMLA 4JYAE 4B3RE 2MC5A 4KHPE 3T1YE 2LUQA 3HXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F9B B;  4F9A B;  4F9C B; 
#chains in the Genus database with same CATH topology
 3BGH A;  2EPU A;  2EN3 A;  2RSI A;  1YPN A;  2WBS A;  2E5L E;  3ZOQ B;  2JYA A;  2ODR C;  5LL6 R;  5BR8 E;  2EPN A;  5DNY A;  2GLI A;  2R76 A;  4WFT A;  1X48 A;  2LE2 A;  5IXM B;  2CTD A;  4IJD A;  2EPR A;  4O43 A;  4L5N C;  4M2Z A;  4NZV A;  1EKZ A;  4BC9 A;  2FV4 B;  4BCA A;  2F8B A;  2WBU A;  2G7H A;  4ZYE A;  3DF6 A;  4X66 E;  3H09 A;  4ZYH A;  2DRP A;  2Q8U A;  2L3J A;  5FLX C;  1IMU A;  2ENC A;  4DV5 E;  2RQL A;  4HEI A;  2YRM A;  2LTR A;  2BBG A;  2K7I A;  1N3G A;  4R8O A;  4F9A B;  2WBT A;  2N3H A;  1YYW A;  1N34 E;  2MC6 A;  1X3C A;  1FKA E;  2H36 X;  3J80 C;  4WX9 A;  1DQ3 A;  4AQY E;  2YTI A;  1AH5 A;  1RC7 A;  5AC4 A;  4R2C A;  2BB8 A;  3OML A;  2V89 A;  2YSO A;  3BID A;  2D9H A;  3C4T A;  2EM0 A;  5A6J A;  4DR4 E;  2EOI A;  2EPX A;  2K4V A;  1G2D C;  2JOB A;  4LF6 E;  5CFF E;  2LT7 A;  3AUZ A;  4JI0 E;  4OOG C;  4LFC E;  2DMY A;  2KON A;  5IWA E;  2VRD A;  2EOR A;  2JXP A;  4DV7 E;  3HQ1 A;  5KL5 A;  4LF9 E;  1BB8 A;  4R2R A;  4LF4 E;  2PRT A;  2N3G A;  2I13 A;  4MLV A;  2L92 A;  4DV2 E;  3VHT B;  1QNT A;  2N8X A;  3MHS C;  2YTE A;  2E1M A;  1T4N A;  2V85 A;  1A1H A;  4TUI A;  1O0W A;  1SFE A;  4B3S E;  2FTX B;  4O5G A;  1IQO A;  1DGC A;  5KL6 A;  1L4S A;  3F6H A;  5KL4 A;  2UU9 E;  2CT1 A;  3LML A;  3HXL A;  5T6J A;  2YTQ A;  2EPC A;  3M99 B;  2EL6 A;  2EL4 A;  2YTP A;  2LMZ A;  3VK6 A;  3EPH A;  2V87 A;  3EPK A;  2EQ3 A;  5A6B A;  2RPC A;  1WHQ A;  4JI2 E;  3ADI A;  1WHN A;  2EN8 A;  1HNX E;  2EN7 A;  4DR6 E;  5A69 A;  2VQF E;  5AAS A;  3L00 A;  4LFA E;  2I9I A;  4X64 E;  2YRK A;  1EH8 A;  2EML A;  2FGG A;  2RS7 A;  2EPO A;  1T4O A;  2A25 A;  4F54 A;  2LBS B;  2B7V A;  3T1H E;  1KYQ A;  3FIG A;  2EE8 A;  2EM3 A;  2EOF A;  2JPA A;  2YTF A;  2EOM A;  3J7A G;  2GHF A;  2VQE E;  4GZN C;  1WRJ A;  2RTX A;  4O24 A;  5IT9 C;  2EJ4 A;  3C4B A;  2LV2 A;  1UBD C;  1X5W A;  4R2E A;  2LRS A;  2EMY A;  2YTN A;  2EQ0 A;  1BBO A;  2EOY A;  2JVA A;  1PJQ A;  3K6Q A;  3VYY A;  2WCC 3;  3HTX A;  2KHX A;  1UIL A;  4WPY A;  4JI3 E;  4DV4 E;  3EQ1 A;  1XMO E;  4P7D A;  3TQM A;  4F2J C;  1BBG A;  2CPN A;  2EPZ A;  5KL3 A;  2L2K B;  4WSG A;  1TF6 A;  2NUF A;  2EN2 A;  2ELY A;  2EOJ A;  5AE3 A;  2L2M A;  2UXC E;  4R2S A;  2WZO A;  1RMD A;  2YTO A;  3BBG A;  4BBY A;  2YRH A;  4F9B B;  4WXD A;  3C6K A;  2E72 A;  1A1I A;  2RSM A;  2M7Q A;  4DUZ E;  2F4V E;  4JI4 E;  4F9C B;  2RS6 A;  3EPJ A;  5TSE A;  3BF2 A;  1PJT A;  2YTJ A;  2DB2 A;  4DR2 E;  1N36 E;  5A6A A;  4DKK A;  3F6G A;  1X6F A;  2EPM X;  1IBL E;  4L8N A;  2MKD A;  4RHB B;  4JI8 E;  1JK2 A;  1KJK A;  4BHB A;  4DV3 E;  1ZBQ A;  1I94 E;  2DGC A;  2ELZ A;  1DI2 A;  2EPL X;  2NAB A;  3IWD A;  3HPZ A;  2L2N A;  2YTD A;  2JY9 A;  1A1L A;  1WJP A;  2MC5 A;  2LUQ A;  1XMQ E;  4MLQ A;  4LF5 E;  2UUC E;  1MEY C;  2IHR 1;  1F2I G;  2EZ6 A;  1P47 A;  2EOE A;  1IQS A;  1PKP A;  2HHH E;  2JOX A;  5LLQ A;  1UHZ A;  4BMJ A;  5ADZ A;  1YUI A;  1N32 E;  5KL7 A;  4NHR A;  2UUA E;  4B3M E;  1ZU1 A;  1GTK A;  2EOS A;  2EPP A;  2YWQ A;  3J81 C;  3ECR A;  3OTO E;  1JK1 A;  3LLH A;  4LU9 A;  4WXC A;  3THO B;  4OX9 E;  4LF8 E;  4X8W A;  5F3W A;  4JI1 E;  4X62 E;  2KOU A;  3JAM C;  2DIX A;  1RQ0 A;  4R03 A;  4ZYD A;  2LVH A;  4O4K A;  2B3T B;  3IWC A;  3UK3 C;  3C6M A;  1XNQ E;  1J26 A;  2LUP B;  1ZAA C;  2V86 A;  3EPL A;  1NEI A;  3KZY A;  1MGT A;  1STU A;  2EN1 A;  4BS9 A;  4DMI A;  3THN A;  5AC5 A;  1HNW E;  2YT4 A;  1GQE A;  1IBK E;  1AAY A;  4LF7 E;  4GKK E;  1HR0 E;  3JU0 A;  3ADL A;  1T39 A;  2R1F A;  4J8Z A;  4BC7 A;  4DR1 E;  2EM9 A;  4P78 A;  2LJH A;  2VE7 C;  4M30 A;  2LO3 A;  2UXD E;  4F6N A;  4DV0 E;  2L8T A;  2LJU A;  1YYK A;  4NXN E;  1GZ6 A;  1UN6 B;  5IV8 B;  4GKJ E;  1QU6 A;  4YY3 E;  2LCE A;  1X47 A;  2ENH A;  2L33 A;  4WYQ B;  2EM8 A;  3KWR A;  1J5E E;  2EM2 A;  2JR1 A;  3ADG A;  4N4R B;  2EMZ A;  5KL2 A;  3IWB A;  3JTZ A;  2EM6 A;  1A1J A;  4JI5 E;  1EH7 A;  4WSP A;  1T4L B;  1G2F C;  3QG5 C;  4F6M A;  2ODR D;  2EN6 A;  2EM5 A;  3MHH C;  4NXM E;  4DR5 E;  4GEQ B;  5AE2 A;  2V83 A;  2HJJ A;  4JYA E;  4B3R E;  2J7J A;  2L3C A;  4DR7 E;  2DMI A;  3KZZ A;  1B69 A;  2EOH A;  1TN9 A;  2EMI A;  4R2D A;  4I8O A;  3AV0 A;  4YHH E;  2EMA A;  2EOZ A;  2CSH A;  1WXR A;  2HC5 A;  2YZT A;  2B7T A;  4LTY A;  2EMX A;  2HGH A;  1N33 E;  2EP3 A;  2EMH A;  2EM7 A;  1EH6 A;  4M9V C;  4TUG A;  4M0V A;  2DLK A;  5LMN E;  2M9A A;  4DV6 E;  4IS1 C;  1T38 A;  2EOQ A;  4X65 E;  2EMC A;  2MDR A;  2EPK X;  2EPA A;  2YSP A;  5A2Q C;  4X9J A;  1YFH A;  2NA2 A;  4Q28 A;  4JI6 E;  4FK5 C;  3MSW A;  2ADR A;  2EN4 A;  2EMB A;  1A1K A;  4KWY A;  1X6H A;  2MKN A;  4JI7 E;  4LFB E;  2M4I A;  3P1X A;  5A6B D;  5LMU E;  2EWL A;  1X6E A;  4ZYG A;  2UUB E;  4Q35 B;  2JP9 A;  4R2P A;  4DV1 E;  2EQ1 A;  1YSA C;  2V88 A;  3VYX A;  2YTG A;  1NCS A;  2ZM6 E;  1YUJ A;  4R2Q A;  5AE1 A;  2NUE A;  2B9D A;  2YU8 A;  1Z1B A;  4BHC A;  2YPN A;  1FJG E;  2NUG A;  1SR9 A;  4KZS A;  4DR3 E;  1ZBT A;  2EMG A;  1YZ9 A;  1A1G A;  2EOX A;  1XNR E;  4RH8 A;  3ADJ A;  1YYO A;  5A6K A;  1A1F A;  1HNZ E;  1LLM C;  3DJW A;  2JWO A;  2EOO A;  2EMW A;  2M1S A;  4B3T E;  2YU5 A;  1PJS A;  3HPS A;  2GPI A;  3J7Y p;  4R2A A;  4K0K E;  2DLQ A;  2L6M A;  2ENA A;  4DUY E;  2EM4 A;  2EMK A;  3RMP A;  2MDG A;  1IBM E;  4HTG A;  1ZR9 A;  2V8Q B;  2VF1 A;  4JV5 E;  1TF3 A;  1PDA A;  2EL5 A;  2UXB E;  2EMF A;  1X49 A;  2LTS A;  2DSY A;  4KHP E;  3T1Y E; 
#chains in the Genus database with same CATH homology
 2L3C A;  1XMQ E;  4LF5 E;  4DR7 E;  2UUC E;  2IHR 1;  2EZ6 A;  2E5L E;  3VK6 A;  2LMZ A;  2V87 A;  3ZOQ B;  4I8O A;  2ODR C;  3AV0 A;  4YHH E;  5LL6 R;  5BR8 E;  5DNY A;  1PKP A;  4WFT A;  1X48 A;  1WHQ A;  2LE2 A;  1WXR A;  2HHH E;  4JI2 E;  2JOX A;  3ADI A;  2YZT A;  1WHN A;  1UHZ A;  2B7T A;  4L5N C;  4LTY A;  4BMJ A;  5ADZ A;  1HNX E;  4M2Z A;  1N33 E;  1EKZ A;  1N32 E;  4DR6 E;  4BC9 A;  2FV4 B;  4BCA A;  2F8B A;  5AAS A;  2VQF E;  2UUA E;  4B3M E;  4LFA E;  4TUG A;  4M0V A;  4X64 E;  2G7H A;  5LMN E;  3J81 C;  4DV6 E;  3DF6 A;  4X66 E;  3OTO E;  2FGG A;  3LLH A;  4LU9 A;  4X65 E;  3H09 A;  2MDR A;  2RS7 A;  1T4O A;  4F54 A;  2L3J A;  4OX9 E;  5FLX C;  4LF8 E;  4X8W A;  2LBS B;  2B7V A;  5F3W A;  3T1H E;  4JI1 E;  4DV5 E;  4X62 E;  3FIG A;  2KOU A;  2LTR A;  3JAM C;  5A2Q C;  4JI3 E;  2DIX A;  2NA2 A;  4Q28 A;  1RQ0 A;  3MSW A;  4R8O A;  4R03 A;  4F9A B;  4JI5 E;  4JI6 E;  2N3H A;  1YYW A;  2B3T B;  3IWC A;  1N34 E;  2MC6 A;  5T6J A;  1XNQ E;  3J7A G;  1FKA E;  1J26 A;  2H36 X;  3J80 C;  2LUP B;  2VQE E;  2RTX A;  5IT9 C;  4JI7 E;  4LFB E;  1DQ3 A;  4AQY E;  2V86 A;  2M4I A;  3C4B A;  3P1X A;  5LMU E;  1RC7 A;  2EWL A;  3OML A;  2LRS A;  2UUB E;  2V89 A;  3C4T A;  1STU A;  4DR4 E;  2JVA A;  4BS9 A;  3K6Q A;  4DMI A;  3VYY A;  4DV1 E;  1HNW E;  2YT4 A;  1GQE A;  2V88 A;  1IBK E;  4LF7 E;  3VYX A;  2K4V A;  2KHX A;  2JOB A;  4LF6 E;  3HTX A;  4GKK E;  1UIL A;  3JU0 A;  4WPY A;  5CFF E;  3AUZ A;  2ZM6 E;  4DV4 E;  4P7D A;  1XMO E;  1HR0 E;  4JI0 E;  3ADL A;  4J8Z A;  4OOG C;  5AE1 A;  4LFC E;  2DMY A;  2KON A;  4BC7 A;  4DR1 E;  2NUE A;  2B9D A;  2CPN A;  4P78 A;  2LJH A;  2VE7 C;  4M30 A;  2L2K B;  2NUF A;  5IWA E;  4DV7 E;  2UXD E;  5AE3 A;  2L2M A;  2L8T A;  4DV0 E;  3HQ1 A;  1GZ6 A;  1SR9 A;  4NXN E;  1FJG E;  4KZS A;  1YYK A;  2NUG A;  2UXC E;  4DR3 E;  2WZO A;  4LF9 E;  1QU6 A;  1ZBT A;  4GKJ E;  4YY3 E;  1YZ9 A;  4BBY A;  4F9B B;  1X47 A;  1XNR E;  3ADJ A;  2RSM A;  1YYO A;  4LF4 E;  1HNZ E;  2N3G A;  2L33 A;  2M7Q A;  4WYQ B;  3DJW A;  2JWO A;  4DUZ E;  3KWR A;  2L92 A;  2M1S A;  1J5E E;  2JR1 A;  4F9C B;  2RS6 A;  3ADG A;  4DV2 E;  4B3T E;  4JI4 E;  2F4V E;  3HPS A;  3J7Y p;  4K0K E;  2DB2 A;  4DR2 E;  3IWB A;  2E1M A;  2L6M A;  1T4N A;  3JTZ A;  4DUY E;  1N36 E;  2V85 A;  3F6G A;  4WSP A;  4DKK A;  3RMP A;  1T4L B;  1IBL E;  2ODR D;  1O0W A;  4L8N A;  4TUI A;  1IBM E;  4JI8 E;  4B3S E;  2FTX B;  4DV3 E;  4NXM E;  1ZBQ A;  2V8Q B;  2VF1 A;  4DR5 E;  1I94 E;  4GEQ B;  4JV5 E;  1DI2 A;  3IWD A;  3HPZ A;  2UXB E;  2L2N A;  3F6H A;  2JY9 A;  5AE2 A;  1X49 A;  2LTS A;  2UU9 E;  2V83 A;  2DSY A;  3LML A;  4JYA E;  4B3R E;  2MC5 A;  4KHP E;  3T1Y E;  2LUQ A;  3HXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...