4F9AB

Human cdc7 kinase in complex with dbf4 and nucleotide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
129
structure length
90
Chain Sequence
RLKKPFVKVEDMSQLYRPFYLQLTNMPFINYSIQKPCSPFDGYCECCLQKYEDLETHLLSEQHRNFAQSNQYQVVDDIVSKLVFDFVEYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Cell division cycle 7-related protein kinase
publication title Crystal structure of human CDC7 kinase in complex with its activator DBF4.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 90
sequence length 129
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07535 zf-DBF DBF zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.680 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4f9aB02
4F9BB 4F9AB 4F9CB
chains in the Genus database with same CATH superfamily
2R76A 4DR1E 4LFBE 3THOB 2VRDA 1YUIA 2DGCA 2DMIA 2M9AA 2ODRD 3TQMA 1GQEA 1UILA 5ADZA 2EMXA 4DV6E 2M1SA 2EPUA 2EM5A 4WFTA 4M9VC 2DLQA 1BBOA 2HC5A 2YWQA 2NUEA 1RMDA 2YTNA 1G2FC 4ZYHA 5LLQA 2LCEA 2YRMA 2JYAA 3J7Yp 4JYAE 4B3RE 1J26A 4O5GA 1XMQE 3J81C 2YZTA 3HQ1A 4R03A 2EQ0A 5IT9C 4HEIA 2IHR1 2EPOA 1A1JA 3UK3C 4DUZE 2JWOA 1EH8A 5AC4A 2MDGA 4ZYGA 5AC5A 3EPKA 2K7IA 4X66E 2EOJA 2UUAE 4LF9E 5LL6R 3QG5C 4K0KE 3MHSC 5AE2A 1B69A 2EM0A 3ADGA 2DMYA 1IBME 2YTQA 4F54A 4R2AA 2RS6A 3MSWA 4WXCA 2DRPA 3H09A 4DR3E 1LLMC 4JI6E 4DV1E 4GZNC 4JI1E 4F2JC 3BGHA 2RTXA 2B7TA 4F6MA 4OX9E 1N36E 1A1FA 4N4RB 2EOSA 2EMHA 3HTXA 2N8XA 2EJ4A 3IWCA 4DR7E 2UU9E 2ZM6E 1AAYA 2UXBE 2KOUA 2LT7A 1X49A 3ECRA 4YY3E 2EM2A 5A6KA 3JU0A 2ODRC 1N3GA 3VYYA 2L8TA 1MGTA 2EN8A 2JP9A 1XMOE 2EM4A 2LV2A 1P47A 4R2EA 4NXME 3KZYA 4RH8A 4DV3E 1HR0E 2EPAA 3VK6A 4GEQB 2EPXA 2EPCA 1ZU1A 4LTYA 4R2QA 2EOQA 2L92A 3LLHA 2VF1A 1PKPA 4LF4E 3THNA 2ELYA 2YU5A 3FIGA 3EQ1A 3ZOQB 4LFCE 2GPIA 1SFEA 2JR1A 2LTSA 4J8ZA 2EMGA 3C4BA 2YTJA 2CPNA 2R1FA 1PDAA 2A25A 2CT1A 2WBSA 1YYWA 4M2ZA 1T4NA 2EMYA 2EOHA 2LRSA 3HPSA 4WXDA 4DV5E 1IQSA 2EM9A 4F9AB 4YHHE 4KZSA 2LVHA 1A1HA 3BBGA 2EMZA 2M4IA 4LF7E 5FLXC 4M0VA 4O24A 4DKKA 2EPZA 2BBGA 1GZ6A 5A6JA 4BC9A 1JK2A 1X6FA 2JVAA 2CSHA 1WHNA 2JXPA 2DIXA 2LMZA 2MC5A 4DR4E 1IMUA 2GLIA 2YTPA 4NHRA 1QNTA 4GKKE 2VQFE 2EM7A 4JI2E 2LJUA 5KL2A 2LBSB 1NEIA 2YTOA 2HJJA 2DLKA 5TSEA 4R2PA 5A6BA 5DNYA 4LF6E 2EN7A 4ZYEA 2ENHA 5CFFE 4RHBB 1X5WA 2EPNA 2YTFA 3ADLA 1X6EA 2H36X 1TF6A 2L6MA 1HNXE 4BHCA 5IXMB 2YSOA 3HPZA 2EOFA 2L3JA 1WJPA 4GKJE 1QU6A 3C4TA 1X6HA 1YYOA 1N33E 2K4VA 4P7DA 4DMIA 4B3ME 2EWLA 2LUQA 4O4KA 4MLVA 2UUCE 4DR2E 4B3SE 4BS9A 5F3WA 2ENAA 1STUA 1N34E 1PJTA 1ZBQA 5AASA 4LF5E 2I13A 2D9HA 2JOXA 2EN6A 4L5NC 3JTZA 1XNRE 2EOMA 3P1XA 4DR6E 4KWYA 4AQYE 4X9JA 1L4SA 2ADRA 4BHBA 4FK5C 3RMPA 2WZOA 4Q28A 1YYKA 1F2IG 2EOZA 3BIDA 3IWBA 1A1LA 3C6MA 1DQ3A 3KZZA 2EORA 1BBGA 4TUIA 5BR8E 2MKDA 2B9DA 3IWDA 4MLQA 1RC7A 2MDRA 1T4LB 3VHTB 5IV8B 2KHXA 2UXCE 2E72A 1KYQA 2EOYA 2EN3A 1WXRA 3OMLA 4Q35B 2EPMX 1FKAE 3T1HE 1MEYC 4F6NA 2CTDA 4X62E 2YT4A 2RSIA 4LFAE 5A6BD 2L3CA 4I8OA 2L2KB 3AV0A 1GTKA 1BB8A 2MKNA 1ZR9A 2YPNA 1G2DC 1EH7A 2V86A 3C6KA 2I9IA 2EOEA 4BCAA 1IBLE 4BBYA 2F4VE 4DR5E 2NA2A 2V87A 2V85A 3EPLA 2EQ1A 2EOIA 4IS1C 2DB2A 3DF6A 3T1YE 2DSYA 5AE1A 5KL3A 3VYXA 2LO3A 4DV0E 4WSPA 1PJSA 4WSGA 2L33A 2EL4A 5LMUE 3HXLA 2EMKA 4P78A 4F9BB 4KHPE 2RQLA 5KL4A 1ZBTA 4JI0E 1N32E 4L8NA 2M7QA 2HGHA 2EMWA 2EP3A 2G7HA 2UUBE 3J80C 2YSPA 5KL5A 3MHHC 1A1KA 4JI4E 1HNZE 3ADIA 1UHZA 2L2MA 2NABA 2B3TB 2E1MA 2EMCA 2HHHE 1XNQE 2N3HA 2PRTA 3F6HA 2V89A 4M30A 1TF3A 2EOXA 2YRHA 4OOGC 2EZ6A 2EN2A 5KL6A 4DV7E 4JI8E 4B3TE 5AE3A 3EPHA 2YTEA 4HTGA 1HNWE 1UN6B 3M99B 2BB8A 2GHFA 5A6AA 3K6QA 3DJWA 2N3GA 2YTIA 2WCC3 4R2DA 4X65E 4JV5E 2Q8UA 3EPJA 2EPPA 4NZVA 2LUPB 1J5EE 4JI5E 1NCSA 2V88A 4R8OA 3L00A 1WHQA 2RSMA 1ZAAC 2E5LE 1UBDC 2RS7A 4IJDA 2ELZA 2LJHA 1A1IA 2L2NA 2RPCA 4WX9A 1JK1A 2EM8A 4JI7E 2WBUA 2EMBA 2WBTA 2VQEE 4R2CA 2YTGA 2EMLA 2J7JA 2V8QB 2LTRA 4R2SA 2EMAA 1YZ9A 2EN4A 3AUZA 1EH6A 4WPYA 2EL5A 1PJQA 4LF8E 2EL6A 4R2RA 2NUFA 1Z1BA 5LMNE 1X47A 1DGCA 1TN9A 1EKZA 4DV4E 2JOBA 4WYQB 3OTOE 2EOOA 1YFHA 1YUJA 3JAMC 5IWAE 2V83A 1WRJA 2MC6A 1RQ0A 4LU9A 2F8BA 4DUYE 5A2QC 4DV2E 5A69A 2YTDA 4JI3E 1O0WA 1T39A 1AH5A 2YU8A 3KWRA 1T38A 4NXNE 1IQOA 2ENCA 3ADJA 2JPAA 2VE7C 4BMJA 4O43A 4ZYDA 2EM3A 2FTXB 2FV4B 2EPKX 3LMLA 2EMIA 1YPNA 2JY9A 4F9CB 1I94E 2LE2A 1SR9A 4X64E 2NUGA 3J7AG 2FGGA 2KONA 4TUGA 1X3CA 2EE8A 3F6GA 2EPLX 4BC7A 1YSAC 1IBKE 2B7VA 2EM6A 1DI2A 2YRKA 2EQ3A 5KL7A 1A1GA 1KJKA 2EPRA 1X48A 1FJGE 1T4OA 5T6JA 2UXDE 2EN1A 2EMFA 3BF2A 4X8WA
chains in the Genus database with same CATH topology
4DR1E 3K6QA 2L92A 3RMPA 4LFBE 2WZOA 3LLHA 3DJWA 2VF1A 4Q28A 1YYKA 1PKPA 2N3GA 4LF4E 3ZOQB 3IWBA 3FIGA 4LFCE 4X65E 4JV5E 2JR1A 4J8ZA 2LTSA 1DQ3A 2ODRD 2LUPB 1J5EE 4JI5E 2V88A 4R8OA 1UILA 1GQEA 5ADZA 3C4BA 4TUIA 5BR8E 1WHQA 2M1SA 2B9DA 2CPNA 3IWDA 4DV6E 1RC7A 2MDRA 2RSMA 4WFTA 2E5LE 1T4LB 2KHXA 2UXCE 2RS7A 2NUEA 1YYWA 1WXRA 4M2ZA 1T4NA 2LJHA 3OMLA 1FKAE 3T1HE 3J7Yp 4JYAE 2LRSA 3HPSA 2L2NA 4X62E 4DV5E 2YT4A 4F9AB 4YHHE 4B3RE 1J26A 4KZSA 4LFAE 1XMQE 4JI7E 3J81C 2YZTA 3HQ1A 4R03A 4LF7E 2M4IA 2L3CA 5IT9C 2IHR1 5FLXC 4I8OA 4M0VA 2L2KB 3AV0A 4DKKA 2VQEE 1GZ6A 4DUZE 2V8QB 4BC9A 2JWOA 2LTRA 1YZ9A 2JVAA 3AUZA 1WHNA 2V86A 2DIXA 2LMZA 4WPYA 2MC5A 4BCAA 1IBLE 4LF8E 4DR4E 2NUFA 4BBYA 5LMNE 1X47A 2VQFE 2F4VE 4GKKE 1EKZA 4DR5E 4X66E 2NA2A 4DV4E 4JI2E 2JOBA 2V87A 2V85A 4WYQB 3OTOE 2LBSB 2UUAE 4LF9E 2UXBE 2DB2A 3DF6A 3T1YE 2DSYA 5AE1A 3VYXA 3JAMC 5IWAE 4DV0E 2V83A 4WSPA 5LL6R 2MC6A 1RQ0A 4LU9A 2F8BA 5DNYA 5A2QC 4DUYE 4DV2E 4K0KE 4JI3E 5AE2A 1O0WA 4LF6E 2L33A 5CFFE 3ADGA 5LMUE 3KWRA 2DMYA 3HXLA 1IBME 4NXNE 3ADJA 4F54A 2RS6A 3MSWA 3ADLA 2H36X 3H09A 4DR3E 4JI6E 2VE7C 4P78A 2L6MA 4F9BB 1HNXE 4BMJA 4DV1E 4KHPE 2FTXB 3HPZA 1ZBTA 4JI1E 2FV4B 2L3JA 4JI0E 1N32E 2RTXA 1QU6A 2B7TA 3C4TA 3LMLA 4L8NA 1YYOA 4OX9E 2M7QA 1N36E 1N33E 2G7HA 2JY9A 4F9CB 3HTXA 2UUBE 2K4VA 4P7DA 4DMIA 3J80C 4B3ME 2EWLA 1I94E 2LUQA 2LE2A 3IWCA 4JI4E 4DR7E 1HNZE 2UU9E 1SR9A 4X64E 2ZM6E 2NUGA 1UHZA 2L2MA 4DR2E 2KOUA 2UUCE 4B3SE 3ADIA 1X49A 4BS9A 2B3TB 2E1MA 5F3WA 3J7AG 2FGGA 2KONA 4YY3E 2HHHE 1XNQE 4TUGA 2N3HA 3JU0A 1STUA 2ODRC 1N34E 3F6HA 3VYYA 2V89A 2L8TA 4M30A 4GKJE 1ZBQA 5AASA 3F6GA 1XMOE 4LF5E 4BC7A 4NXME 1IBKE 4OOGC 2B7VA 2JOXA 1DI2A 2EZ6A 4L5NC 3JTZA 4DV3E 4DV7E 1X48A 1XNRE 4JI8E 1HR0E 3P1XA 1FJGE 3VK6A 4B3TE 4GEQB 5AE3A 4DR6E 1T4OA 4AQYE 5T6JA 4LTYA 1HNWE 2UXDE 4X8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F9B B;  4F9A B;  4F9C B; 
#chains in the Genus database with same CATH topology
 2R76 A;  4DR1 E;  4LFB E;  3THO B;  2VRD A;  1YUI A;  2DGC A;  2DMI A;  2M9A A;  2ODR D;  3TQM A;  1GQE A;  1UIL A;  5ADZ A;  2EMX A;  4DV6 E;  2M1S A;  2EPU A;  2EM5 A;  4WFT A;  4M9V C;  2DLQ A;  1BBO A;  2HC5 A;  2YWQ A;  2NUE A;  1RMD A;  2YTN A;  1G2F C;  4ZYH A;  5LLQ A;  2LCE A;  2YRM A;  2JYA A;  3J7Y p;  4JYA E;  4B3R E;  1J26 A;  4O5G A;  1XMQ E;  3J81 C;  2YZT A;  3HQ1 A;  4R03 A;  2EQ0 A;  5IT9 C;  4HEI A;  2IHR 1;  2EPO A;  1A1J A;  3UK3 C;  4DUZ E;  2JWO A;  1EH8 A;  5AC4 A;  2MDG A;  4ZYG A;  5AC5 A;  3EPK A;  2K7I A;  4X66 E;  2EOJ A;  2UUA E;  4LF9 E;  5LL6 R;  3QG5 C;  4K0K E;  3MHS C;  5AE2 A;  1B69 A;  2EM0 A;  3ADG A;  2DMY A;  1IBM E;  2YTQ A;  4F54 A;  4R2A A;  2RS6 A;  3MSW A;  4WXC A;  2DRP A;  3H09 A;  4DR3 E;  1LLM C;  4JI6 E;  4DV1 E;  4GZN C;  4JI1 E;  4F2J C;  3BGH A;  2RTX A;  2B7T A;  4F6M A;  4OX9 E;  1N36 E;  1A1F A;  4N4R B;  2EOS A;  2EMH A;  3HTX A;  2N8X A;  2EJ4 A;  3IWC A;  4DR7 E;  2UU9 E;  2ZM6 E;  1AAY A;  2UXB E;  2KOU A;  2LT7 A;  1X49 A;  3ECR A;  4YY3 E;  2EM2 A;  5A6K A;  3JU0 A;  2ODR C;  1N3G A;  3VYY A;  2L8T A;  1MGT A;  2EN8 A;  2JP9 A;  1XMO E;  2EM4 A;  2LV2 A;  1P47 A;  4R2E A;  4NXM E;  3KZY A;  4RH8 A;  4DV3 E;  1HR0 E;  2EPA A;  3VK6 A;  4GEQ B;  2EPX A;  2EPC A;  1ZU1 A;  4LTY A;  4R2Q A;  2EOQ A;  2L92 A;  3LLH A;  2VF1 A;  1PKP A;  4LF4 E;  3THN A;  2ELY A;  2YU5 A;  3FIG A;  3EQ1 A;  3ZOQ B;  4LFC E;  2GPI A;  1SFE A;  2JR1 A;  2LTS A;  4J8Z A;  2EMG A;  3C4B A;  2YTJ A;  2CPN A;  2R1F A;  1PDA A;  2A25 A;  2CT1 A;  2WBS A;  1YYW A;  4M2Z A;  1T4N A;  2EMY A;  2EOH A;  2LRS A;  3HPS A;  4WXD A;  4DV5 E;  1IQS A;  2EM9 A;  4F9A B;  4YHH E;  4KZS A;  2LVH A;  1A1H A;  3BBG A;  2EMZ A;  2M4I A;  4LF7 E;  5FLX C;  4M0V A;  4O24 A;  4DKK A;  2EPZ A;  2BBG A;  1GZ6 A;  5A6J A;  4BC9 A;  1JK2 A;  1X6F A;  2JVA A;  2CSH A;  1WHN A;  2JXP A;  2DIX A;  2LMZ A;  2MC5 A;  4DR4 E;  1IMU A;  2GLI A;  2YTP A;  4NHR A;  1QNT A;  4GKK E;  2VQF E;  2EM7 A;  4JI2 E;  2LJU A;  5KL2 A;  2LBS B;  1NEI A;  2YTO A;  2HJJ A;  2DLK A;  5TSE A;  4R2P A;  5A6B A;  5DNY A;  4LF6 E;  2EN7 A;  4ZYE A;  2ENH A;  5CFF E;  4RHB B;  1X5W A;  2EPN A;  2YTF A;  3ADL A;  1X6E A;  2H36 X;  1TF6 A;  2L6M A;  1HNX E;  4BHC A;  5IXM B;  2YSO A;  3HPZ A;  2EOF A;  2L3J A;  1WJP A;  4GKJ E;  1QU6 A;  3C4T A;  1X6H A;  1YYO A;  1N33 E;  2K4V A;  4P7D A;  4DMI A;  4B3M E;  2EWL A;  2LUQ A;  4O4K A;  4MLV A;  2UUC E;  4DR2 E;  4B3S E;  4BS9 A;  5F3W A;  2ENA A;  1STU A;  1N34 E;  1PJT A;  1ZBQ A;  5AAS A;  4LF5 E;  2I13 A;  2D9H A;  2JOX A;  2EN6 A;  4L5N C;  3JTZ A;  1XNR E;  2EOM A;  3P1X A;  4DR6 E;  4KWY A;  4AQY E;  4X9J A;  1L4S A;  2ADR A;  4BHB A;  4FK5 C;  3RMP A;  2WZO A;  4Q28 A;  1YYK A;  1F2I G;  2EOZ A;  3BID A;  3IWB A;  1A1L A;  3C6M A;  1DQ3 A;  3KZZ A;  2EOR A;  1BBG A;  4TUI A;  5BR8 E;  2MKD A;  2B9D A;  3IWD A;  4MLQ A;  1RC7 A;  2MDR A;  1T4L B;  3VHT B;  5IV8 B;  2KHX A;  2UXC E;  2E72 A;  1KYQ A;  2EOY A;  2EN3 A;  1WXR A;  3OML A;  4Q35 B;  2EPM X;  1FKA E;  3T1H E;  1MEY C;  4F6N A;  2CTD A;  4X62 E;  2YT4 A;  2RSI A;  4LFA E;  5A6B D;  2L3C A;  4I8O A;  2L2K B;  3AV0 A;  1GTK A;  1BB8 A;  2MKN A;  1ZR9 A;  2YPN A;  1G2D C;  1EH7 A;  2V86 A;  3C6K A;  2I9I A;  2EOE A;  4BCA A;  1IBL E;  4BBY A;  2F4V E;  4DR5 E;  2NA2 A;  2V87 A;  2V85 A;  3EPL A;  2EQ1 A;  2EOI A;  4IS1 C;  2DB2 A;  3DF6 A;  3T1Y E;  2DSY A;  5AE1 A;  5KL3 A;  3VYX A;  2LO3 A;  4DV0 E;  4WSP A;  1PJS A;  4WSG A;  2L33 A;  2EL4 A;  5LMU E;  3HXL A;  2EMK A;  4P78 A;  4F9B B;  4KHP E;  2RQL A;  5KL4 A;  1ZBT A;  4JI0 E;  1N32 E;  4L8N A;  2M7Q A;  2HGH A;  2EMW A;  2EP3 A;  2G7H A;  2UUB E;  3J80 C;  2YSP A;  5KL5 A;  3MHH C;  1A1K A;  4JI4 E;  1HNZ E;  3ADI A;  1UHZ A;  2L2M A;  2NAB A;  2B3T B;  2E1M A;  2EMC A;  2HHH E;  1XNQ E;  2N3H A;  2PRT A;  3F6H A;  2V89 A;  4M30 A;  1TF3 A;  2EOX A;  2YRH A;  4OOG C;  2EZ6 A;  2EN2 A;  5KL6 A;  4DV7 E;  4JI8 E;  4B3T E;  5AE3 A;  3EPH A;  2YTE A;  4HTG A;  1HNW E;  1UN6 B;  3M99 B;  2BB8 A;  2GHF A;  5A6A A;  3K6Q A;  3DJW A;  2N3G A;  2YTI A;  2WCC 3;  4R2D A;  4X65 E;  4JV5 E;  2Q8U A;  3EPJ A;  2EPP A;  4NZV A;  2LUP B;  1J5E E;  4JI5 E;  1NCS A;  2V88 A;  4R8O A;  3L00 A;  1WHQ A;  2RSM A;  1ZAA C;  2E5L E;  1UBD C;  2RS7 A;  4IJD A;  2ELZ A;  2LJH A;  1A1I A;  2L2N A;  2RPC A;  4WX9 A;  1JK1 A;  2EM8 A;  4JI7 E;  2WBU A;  2EMB A;  2WBT A;  2VQE E;  4R2C A;  2YTG A;  2EML A;  2J7J A;  2V8Q B;  2LTR A;  4R2S A;  2EMA A;  1YZ9 A;  2EN4 A;  3AUZ A;  1EH6 A;  4WPY A;  2EL5 A;  1PJQ A;  4LF8 E;  2EL6 A;  4R2R A;  2NUF A;  1Z1B A;  5LMN E;  1X47 A;  1DGC A;  1TN9 A;  1EKZ A;  4DV4 E;  2JOB A;  4WYQ B;  3OTO E;  2EOO A;  1YFH A;  1YUJ A;  3JAM C;  5IWA E;  2V83 A;  1WRJ A;  2MC6 A;  1RQ0 A;  4LU9 A;  2F8B A;  4DUY E;  5A2Q C;  4DV2 E;  5A69 A;  2YTD A;  4JI3 E;  1O0W A;  1T39 A;  1AH5 A;  2YU8 A;  3KWR A;  1T38 A;  4NXN E;  1IQO A;  2ENC A;  3ADJ A;  2JPA A;  2VE7 C;  4BMJ A;  4O43 A;  4ZYD A;  2EM3 A;  2FTX B;  2FV4 B;  2EPK X;  3LML A;  2EMI A;  1YPN A;  2JY9 A;  4F9C B;  1I94 E;  2LE2 A;  1SR9 A;  4X64 E;  2NUG A;  3J7A G;  2FGG A;  2KON A;  4TUG A;  1X3C A;  2EE8 A;  3F6G A;  2EPL X;  4BC7 A;  1YSA C;  1IBK E;  2B7V A;  2EM6 A;  1DI2 A;  2YRK A;  2EQ3 A;  5KL7 A;  1A1G A;  1KJK A;  2EPR A;  1X48 A;  1FJG E;  1T4O A;  5T6J A;  2UXD E;  2EN1 A;  2EMF A;  3BF2 A;  4X8W A; 
#chains in the Genus database with same CATH homology
 4DR1 E;  3K6Q A;  2L92 A;  3RMP A;  4LFB E;  2WZO A;  3LLH A;  3DJW A;  2VF1 A;  4Q28 A;  1YYK A;  1PKP A;  2N3G A;  4LF4 E;  3ZOQ B;  3IWB A;  3FIG A;  4LFC E;  4X65 E;  4JV5 E;  2JR1 A;  4J8Z A;  2LTS A;  1DQ3 A;  2ODR D;  2LUP B;  1J5E E;  4JI5 E;  2V88 A;  4R8O A;  1UIL A;  1GQE A;  5ADZ A;  3C4B A;  4TUI A;  5BR8 E;  1WHQ A;  2M1S A;  2B9D A;  2CPN A;  3IWD A;  4DV6 E;  1RC7 A;  2MDR A;  2RSM A;  4WFT A;  2E5L E;  1T4L B;  2KHX A;  2UXC E;  2RS7 A;  2NUE A;  1YYW A;  1WXR A;  4M2Z A;  1T4N A;  2LJH A;  3OML A;  1FKA E;  3T1H E;  3J7Y p;  4JYA E;  2LRS A;  3HPS A;  2L2N A;  4X62 E;  4DV5 E;  2YT4 A;  4F9A B;  4YHH E;  4B3R E;  1J26 A;  4KZS A;  4LFA E;  1XMQ E;  4JI7 E;  3J81 C;  2YZT A;  3HQ1 A;  4R03 A;  4LF7 E;  2M4I A;  2L3C A;  5IT9 C;  2IHR 1;  5FLX C;  4I8O A;  4M0V A;  2L2K B;  3AV0 A;  4DKK A;  2VQE E;  1GZ6 A;  4DUZ E;  2V8Q B;  4BC9 A;  2JWO A;  2LTR A;  1YZ9 A;  2JVA A;  3AUZ A;  1WHN A;  2V86 A;  2DIX A;  2LMZ A;  4WPY A;  2MC5 A;  4BCA A;  1IBL E;  4LF8 E;  4DR4 E;  2NUF A;  4BBY A;  5LMN E;  1X47 A;  2VQF E;  2F4V E;  4GKK E;  1EKZ A;  4DR5 E;  4X66 E;  2NA2 A;  4DV4 E;  4JI2 E;  2JOB A;  2V87 A;  2V85 A;  4WYQ B;  3OTO E;  2LBS B;  2UUA E;  4LF9 E;  2UXB E;  2DB2 A;  3DF6 A;  3T1Y E;  2DSY A;  5AE1 A;  3VYX A;  3JAM C;  5IWA E;  4DV0 E;  2V83 A;  4WSP A;  5LL6 R;  2MC6 A;  1RQ0 A;  4LU9 A;  2F8B A;  5DNY A;  5A2Q C;  4DUY E;  4DV2 E;  4K0K E;  4JI3 E;  5AE2 A;  1O0W A;  4LF6 E;  2L33 A;  5CFF E;  3ADG A;  5LMU E;  3KWR A;  2DMY A;  3HXL A;  1IBM E;  4NXN E;  3ADJ A;  4F54 A;  2RS6 A;  3MSW A;  3ADL A;  2H36 X;  3H09 A;  4DR3 E;  4JI6 E;  2VE7 C;  4P78 A;  2L6M A;  4F9B B;  1HNX E;  4BMJ A;  4DV1 E;  4KHP E;  2FTX B;  3HPZ A;  1ZBT A;  4JI1 E;  2FV4 B;  2L3J A;  4JI0 E;  1N32 E;  2RTX A;  1QU6 A;  2B7T A;  3C4T A;  3LML A;  4L8N A;  1YYO A;  4OX9 E;  2M7Q A;  1N36 E;  1N33 E;  2G7H A;  2JY9 A;  4F9C B;  3HTX A;  2UUB E;  2K4V A;  4P7D A;  4DMI A;  3J80 C;  4B3M E;  2EWL A;  1I94 E;  2LUQ A;  2LE2 A;  3IWC A;  4JI4 E;  4DR7 E;  1HNZ E;  2UU9 E;  1SR9 A;  4X64 E;  2ZM6 E;  2NUG A;  1UHZ A;  2L2M A;  4DR2 E;  2KOU A;  2UUC E;  4B3S E;  3ADI A;  1X49 A;  4BS9 A;  2B3T B;  2E1M A;  5F3W A;  3J7A G;  2FGG A;  2KON A;  4YY3 E;  2HHH E;  1XNQ E;  4TUG A;  2N3H A;  3JU0 A;  1STU A;  2ODR C;  1N34 E;  3F6H A;  3VYY A;  2V89 A;  2L8T A;  4M30 A;  4GKJ E;  1ZBQ A;  5AAS A;  3F6G A;  1XMO E;  4LF5 E;  4BC7 A;  4NXM E;  1IBK E;  4OOG C;  2B7V A;  2JOX A;  1DI2 A;  2EZ6 A;  4L5N C;  3JTZ A;  4DV3 E;  4DV7 E;  1X48 A;  1XNR E;  4JI8 E;  1HR0 E;  3P1X A;  1FJG E;  3VK6 A;  4B3T E;  4GEQ B;  5AE3 A;  4DR6 E;  1T4O A;  4AQY E;  5T6J A;  4LTY A;  1HNW E;  2UXD E;  4X8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...