4F9AB

Human cdc7 kinase in complex with dbf4 and nucleotide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
129
structure length
90
Chain Sequence
RLKKPFVKVEDMSQLYRPFYLQLTNMPFINYSIQKPCSPFDGYCECCLQKYEDLETHLLSEQHRNFAQSNQYQVVDDIVSKLVFDFVEYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of human CDC7 kinase in complex with its activator DBF4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Cell division cycle 7-related protein kinase
total genus 14
structure length 90
sequence length 129
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07535 zf-DBF DBF zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.680 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4f9aB02
4F9CB 4F9AB 4F9BB
chains in the Genus database with same CATH superfamily
4WX9A 4N4RB 5A6BD 1Z1BA 1F2IG 2YPNA 5IT9C 4LF6E 2WBTA 2R76A 3VHTB 2EM0A 4B3SE 2I13A 2KONA 5DNYA 4WYQB 2EPPA 2UU9E 4L8NA 3HQ1A 2EQ1A 2EMIA 2DSYA 1WRJA 2EM6A 2EMAA 2FV4B 3TQMA 1JK2A 4B3TE 1RC7A 2EMXA 2GLIA 2HHHE 2EM8A 4BHBA 3MHSC 4LF9E 3P1XA 2MDGA 2ZM6E 4DR2E 4DKKA 3KWRA 2YTEA 1A1LA 2BBGA 2EN3A 2LTSA 4WSGA 2LMZA 4K0KE 4WFTA 1IMUA 2M9AA 4DR4E 2JY9A 4NXME 1PJQA 2EMGA 2V85A 2LVHA 4JI0E 4DR5E 1NCSA 1RMDA 3DF6A 3M99B 2JOXA 3C4BA 3HTXA 2DGCA 4LU9A 4BC7A 2HC5A 4F6NA 2EM4A 3ADJA 4GEQB 4YY3E 4GKJE 1HNWE 2EJ4A 1ZR9A 1P47A 2DMYA 3ECRA 4ZYGA 2EM2A 2DLQA 4M9VC 1STUA 4MLQA 3ADGA 2EOEA 2YRKA 1LLMC 1EKZA 4NXNE 1UN6B 4BC9A 1B69A 4HTGA 1YZ9A 3HPZA 2WBUA 5TSEA 2EPXA 1J26A 1X6HA 4JI3E 5KL7A 1KJKA 1EH8A 4DV1E 1A1FA 5AC4A 3C6MA 2EN2A 2N3GA 2ADRA 3OMLA 1FJGE 4LF8E 2EMLA 2D9HA 5LMUE 1G2DC 3JTZA 1UHZA 2V87A 4BCAA 2LJHA 5AE3A 2V89A 2GPIA 2KOUA 2V8QB 2CSHA 2FTXB 1T38A 2RPCA 2EOIA 4BMJA 2LRSA 2PRTA 2JPAA 3KZYA 3LMLA 4DV4E 2IHR1 3VYYA 3RMPA 1DGCA 1A1KA 2EMKA 1WHQA 2FGGA 2MDRA 2L2MA 4IJDA 4KHPE 2E1MA 4I8OA 5FLXC 1TN9A 4R2QA 4M0VA 5BR8E 1ZBQA 2EN6A 2JOBA 5AASA 5A69A 2NUFA 1IQSA 1HNZE 1L4SA 4KWYA 4BBYA 2YTOA 5A6AA 4X66E 4R2AA 4JI8E 3HXLA 2UUCE 1YSAC 2JVAA 4X8WA 3EQ1A 2YTPA 2DRPA 2EPRA 2EOMA 4F9AB 2EN4A 3BBGA 3IWCA 1NEIA 4IS1C 3J7Yp 4F9CB 2DIXA 5IXMB 2LV2A 2CTDA 2L92A 1PJSA 2YTGA 2EMFA 1YFHA 1X48A 2CPNA 4P78A 2EOZA 1N34E 1YUJA 2EPAA 2L3JA 2RTXA 3QG5C 1ZAAC 1X3CA 1T4NA 1J5EE 1XNRE 4OX9E 4BS9A 3ADLA 2EZ6A 5A6BA 2E5LE 3T1YE 2YTDA 4LFCE 2EQ3A 3F6GA 5LMNE 5AE1A 4DV3E 4J8ZA 1WHNA 2N3HA 2VQEE 4R8OA 1BBGA 3JU0A 1T39A 5A6JA 4FK5C 1PJTA 4JI6E 2UXDE 3JAMC 1FKAE 4YHHE 3UK3C 1T4OA 5T6JA 1HR0E 4AQYE 2YU5A 2WBSA 4KZSA 4DV0E 5AC5A 2EM7A 1UBDC 3DJWA 1SR9A 2EMZA 3MHHC 5IV8B 2NUGA 2LUPB 2M7QA 4LFAE 2F4VE 1N36E 2L33A 2LT7A 1MEYC 2KHXA 2YZTA 4ZYEA 4R2SA 4LF7E 2JXPA 2EMHA 3HPSA 3C4TA 3EPKA 4MLVA 4O5GA 2EN1A 2EOSA 4WXDA 2ENAA 2ODRC 4O24A 1DQ3A 1QU6A 2VE7C 1QNTA 4BHCA 2UXBE 4GZNC 2EOFA 2I9IA 4Q35B 4P7DA 2L6MA 1UILA 1X6EA 2YTFA 1X49A 4JI1E 4R03A 2V83A 2EPLX 2RS7A 2EMWA 4F6MA 1WJPA 3AV0A 3BGHA 2M1SA 4DV5E 2ELYA 5A6KA 3OTOE 2WZOA 1X6FA 4JI2E 1O0WA 4JYAE 4RHBB 2HJJA 4Q28A 4DR7E 3H09A 2LTRA 5KL5A 4DMIA 2BB8A 5KL2A 2DMIA 3VYXA 1N3GA 3FIGA 3EPJA 2EPMX 1YYKA 4DV6E 2EWLA 2L2KB 1EH6A 2EM9A 1G2FC 4LTYA 2V86A 2EE8A 2EM5A 1IQOA 1GQEA 3EPHA 4HEIA 3BIDA 5KL4A 2LCEA 3J81C 2H36X 5KL6A 1A1JA 2NUEA 4F54A 2EN7A 4JI4E 2RQLA 1IBME 3AUZA 2F8BA 2VQFE 1ZU1A 2A25A 4JV5E 3F6HA 4GKKE 2EN8A 1A1GA 1SFEA 1I94E 4DUYE 2EPZA 1AH5A 4DV2E 2EPKX 5IWAE 1GTKA 1N32E 1EH7A 1X47A 2K7IA 3ADIA 2EL6A 1PKPA 4O43A 2MKDA 1XNQE 2EP3A 1MGTA 2RS6A 2B7TA 1YUIA 1A1HA 2EL4A 2K4VA 2YSPA 2YRHA 4X65E 4DUZE 4DR3E 2YWQA 4X9JA 2ENHA 2E72A 2YU8A 4NZVA 2LUQA 5AE2A 1KYQA 1XMQE 4M30A 3VK6A 2EPNA 4LFBE 4B3ME 2EPCA 1YYOA 1XMOE 1X5WA 1RQ0A 2ODRD 1IBKE 1GZ6A 1TF6A 4TUGA 2EOJA 4RH8A 4F9BB 2WCC3 1T4LB 2L2NA 2VF1A 2UXCE 2YSOA 1ZBTA 2V88A 3IWBA 2DB2A 2EMBA 2LO3A 4DR6E 2J7JA 2JP9A 2UUAE 2MKNA 2EOXA 4LF4E 2CT1A 4JI7E 2YTJA 4DR1E 4ZYDA 2B9DA 5ADZA 2YTQA 2EM3A 4X64E 3T1HE 2G7HA 4WPYA 4TUIA 1IBLE 1A1IA 4R2RA 5KL3A 4R2DA 3IWDA 2LE2A 3J7AG 4WSPA 2JWOA 4L5NC 4LF5E 3EPLA 4DV7E 2YT4A 2EMYA 3ZOQB 3THNA 2EOHA 2JYAA 2EL5A 4R2PA 2EOQA 3KZZA 4JI5E 2EOOA 1AAYA 1DI2A 1YPNA 2EORA 2MC5A 2Q8UA 4O4KA 4WXCA 4R2CA 1HNXE 2L8TA 3C6KA 1PDAA 2B3TB 2YTIA 1JK1A 1YYWA 2ELZA 2RSMA 2ENCA 2R1FA 1BB8A 2YTNA 5F3WA 1TF3A 3MSWA 3L00A 2YRMA 4F2JC 2EPUA 2VRDA 4B3RE 2EQ0A 3LLHA 2LBSB 1BBOA 4OOGC 2MC6A 2HGHA 2GHFA 2EMCA 1N33E 3K6QA 2EPOA 2LJUA 4R2EA 2N8XA 4ZYHA 2JR1A 2RSIA 5A2QC 3J80C 2DLKA 2B7VA 5LL6R 2NA2A 2L3CA 2NABA 4X62E 4M2ZA 5CFFE 3THOB 2EOYA 2M4IA 5LLQA 4NHRA 1WXRA 2UUBE 3BF2A
chains in the Genus database with same CATH topology
2MDRA 2L2MA 4LF7E 3HPSA 2E1MA 4I8OA 5FLXC 3C4TA 5IT9C 4KHPE 4LF6E 2LUQA 4M0VA 5AE2A 1XMQE 4M30A 3VK6A 5BR8E 1ZBQA 2JOBA 4B3SE 1N32E 4LFBE 2KONA 5DNYA 5AASA 1YYOA 1XMOE 4WYQB 2ODRC 2NUFA 1DQ3A 1QU6A 1RQ0A 2ODRD 3HQ1A 1GZ6A 4L8NA 1IBKE 4TUGA 1HNZE 2DSYA 2VE7C 4F9BB 2FV4B 2L2NA 2VF1A 4BBYA 1T4LB 1ZBTA 4B3TE 2UXCE 2V88A 2UXBE 1RC7A 4X66E 3IWBA 4JI8E 3HXLA 2HHHE 4P7DA 2L6MA 1UILA 2UUCE 4LF9E 1X49A 2DB2A 4R03A 4JI1E 2JVAA 3P1XA 2V83A 4X8WA 2ZM6E 4DR2E 4DR6E 2RS7A 4DKKA 3KWRA 3AV0A 2UUAE 2M1SA 4B3ME 4DV5E 2LTSA 3OTOE 4LF4E 4F9AB 2LMZA 2WZOA 4K0KE 4WFTA 4JI2E 1O0WA 4JI7E 3IWCA 4JYAE 4DR4E 4DR1E 3J7Yp 2JY9A 4F9CB 2B9DA 2DIXA 4NXME 5ADZA 2V85A 4Q28A 4DR7E 4JI0E 3H09A 2LTRA 4X64E 4DR5E 3T1HE 2G7HA 4DMIA 3DF6A 4M2ZA 2JOXA 2L92A 3C4BA 4WPYA 3HTXA 4TUIA 1IBLE 4LU9A 1X48A 4BC7A 3VYXA 3FIGA 2CPNA 3ADJA 3IWDA 4GEQB 2LE2A 4P78A 4YY3E 4WSPA 1YYKA 3J7AG 4GKJE 2JWOA 4L5NC 4DV6E 1N34E 4LF5E 1HNWE 2EWLA 4DV7E 2YT4A 2DMYA 2L2KB 3ZOQB 4LTYA 2L3JA 2V86A 2RTXA 1GQEA 1STUA 4JI5E 3ADGA 1T4NA 1J5EE 1XNRE 4OX9E 1DI2A 4BS9A 1EKZA 3J81C 4NXNE 2MC5A 3ADLA 4BC9A 2EZ6A 2H36X 2E5LE 1YZ9A 2NUEA 3HPZA 4F54A 1HNXE 2L8TA 3T1YE 4LFCE 4JI4E 1J26A 2B3TB 1IBME 1YYWA 3AUZA 4JI3E 2RSMA 4DV1E 3F6GA 5F3WA 2F8BA 2VQFE 3MSWA 5LMNE 5AE1A 4DV3E 4J8ZA 4JV5E 1WHNA 2N3GA 4LFAE 2N3HA 3F6HA 2VQEE 3OMLA 1FJGE 4R8OA 4GKKE 4LF8E 4B3RE 1N33E 3JU0A 5LMUE 1I94E 3LLHA 4DUYE 4JI6E 3JTZA 2UXDE 2LBSB 4OOGC 4DV2E 1UHZA 2MC6A 2V87A 3JAMC 5IWAE 1FKAE 4YHHE 4BCAA 2LJHA 3K6QA 1T4OA 5T6JA 5AE3A 1HR0E 1X47A 4AQYE 2V89A 3ADIA 1PKPA 2KOUA 4KZSA 2V8QB 4DV0E 1XNQE 2FTXB 3DJWA 1SR9A 2JR1A 5A2QC 3J80C 2RS6A 2NUGA 4BMJA 2B7VA 2B7TA 2LRSA 2NA2A 3LMLA 5LL6R 2M7QA 2IHR1 4X62E 5CFFE 2L3CA 3VYYA 4DV4E 2LUPB 3RMPA 2K4VA 2F4VE 1N36E 2L33A 2M4IA 4X65E 1WHQA 2KHXA 4DUZE 4DR3E 2FGGA 2UU9E 2YZTA 1WXRA 2UUBE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F9C B;  4F9A B;  4F9B B; 
#chains in the Genus database with same CATH topology
 4WX9 A;  4N4R B;  5A6B D;  1Z1B A;  1F2I G;  2YPN A;  5IT9 C;  4LF6 E;  2WBT A;  2R76 A;  3VHT B;  2EM0 A;  4B3S E;  2I13 A;  2KON A;  5DNY A;  4WYQ B;  2EPP A;  2UU9 E;  4L8N A;  3HQ1 A;  2EQ1 A;  2EMI A;  2DSY A;  1WRJ A;  2EM6 A;  2EMA A;  2FV4 B;  3TQM A;  1JK2 A;  4B3T E;  1RC7 A;  2EMX A;  2GLI A;  2HHH E;  2EM8 A;  4BHB A;  3MHS C;  4LF9 E;  3P1X A;  2MDG A;  2ZM6 E;  4DR2 E;  4DKK A;  3KWR A;  2YTE A;  1A1L A;  2BBG A;  2EN3 A;  2LTS A;  4WSG A;  2LMZ A;  4K0K E;  4WFT A;  1IMU A;  2M9A A;  4DR4 E;  2JY9 A;  4NXM E;  1PJQ A;  2EMG A;  2V85 A;  2LVH A;  4JI0 E;  4DR5 E;  1NCS A;  1RMD A;  3DF6 A;  3M99 B;  2JOX A;  3C4B A;  3HTX A;  2DGC A;  4LU9 A;  4BC7 A;  2HC5 A;  4F6N A;  2EM4 A;  3ADJ A;  4GEQ B;  4YY3 E;  4GKJ E;  1HNW E;  2EJ4 A;  1ZR9 A;  1P47 A;  2DMY A;  3ECR A;  4ZYG A;  2EM2 A;  2DLQ A;  4M9V C;  1STU A;  4MLQ A;  3ADG A;  2EOE A;  2YRK A;  1LLM C;  1EKZ A;  4NXN E;  1UN6 B;  4BC9 A;  1B69 A;  4HTG A;  1YZ9 A;  3HPZ A;  2WBU A;  5TSE A;  2EPX A;  1J26 A;  1X6H A;  4JI3 E;  5KL7 A;  1KJK A;  1EH8 A;  4DV1 E;  1A1F A;  5AC4 A;  3C6M A;  2EN2 A;  2N3G A;  2ADR A;  3OML A;  1FJG E;  4LF8 E;  2EML A;  2D9H A;  5LMU E;  1G2D C;  3JTZ A;  1UHZ A;  2V87 A;  4BCA A;  2LJH A;  5AE3 A;  2V89 A;  2GPI A;  2KOU A;  2V8Q B;  2CSH A;  2FTX B;  1T38 A;  2RPC A;  2EOI A;  4BMJ A;  2LRS A;  2PRT A;  2JPA A;  3KZY A;  3LML A;  4DV4 E;  2IHR 1;  3VYY A;  3RMP A;  1DGC A;  1A1K A;  2EMK A;  1WHQ A;  2FGG A;  2MDR A;  2L2M A;  4IJD A;  4KHP E;  2E1M A;  4I8O A;  5FLX C;  1TN9 A;  4R2Q A;  4M0V A;  5BR8 E;  1ZBQ A;  2EN6 A;  2JOB A;  5AAS A;  5A69 A;  2NUF A;  1IQS A;  1HNZ E;  1L4S A;  4KWY A;  4BBY A;  2YTO A;  5A6A A;  4X66 E;  4R2A A;  4JI8 E;  3HXL A;  2UUC E;  1YSA C;  2JVA A;  4X8W A;  3EQ1 A;  2YTP A;  2DRP A;  2EPR A;  2EOM A;  4F9A B;  2EN4 A;  3BBG A;  3IWC A;  1NEI A;  4IS1 C;  3J7Y p;  4F9C B;  2DIX A;  5IXM B;  2LV2 A;  2CTD A;  2L92 A;  1PJS A;  2YTG A;  2EMF A;  1YFH A;  1X48 A;  2CPN A;  4P78 A;  2EOZ A;  1N34 E;  1YUJ A;  2EPA A;  2L3J A;  2RTX A;  3QG5 C;  1ZAA C;  1X3C A;  1T4N A;  1J5E E;  1XNR E;  4OX9 E;  4BS9 A;  3ADL A;  2EZ6 A;  5A6B A;  2E5L E;  3T1Y E;  2YTD A;  4LFC E;  2EQ3 A;  3F6G A;  5LMN E;  5AE1 A;  4DV3 E;  4J8Z A;  1WHN A;  2N3H A;  2VQE E;  4R8O A;  1BBG A;  3JU0 A;  1T39 A;  5A6J A;  4FK5 C;  1PJT A;  4JI6 E;  2UXD E;  3JAM C;  1FKA E;  4YHH E;  3UK3 C;  1T4O A;  5T6J A;  1HR0 E;  4AQY E;  2YU5 A;  2WBS A;  4KZS A;  4DV0 E;  5AC5 A;  2EM7 A;  1UBD C;  3DJW A;  1SR9 A;  2EMZ A;  3MHH C;  5IV8 B;  2NUG A;  2LUP B;  2M7Q A;  4LFA E;  2F4V E;  1N36 E;  2L33 A;  2LT7 A;  1MEY C;  2KHX A;  2YZT A;  4ZYE A;  4R2S A;  4LF7 E;  2JXP A;  2EMH A;  3HPS A;  3C4T A;  3EPK A;  4MLV A;  4O5G A;  2EN1 A;  2EOS A;  4WXD A;  2ENA A;  2ODR C;  4O24 A;  1DQ3 A;  1QU6 A;  2VE7 C;  1QNT A;  4BHC A;  2UXB E;  4GZN C;  2EOF A;  2I9I A;  4Q35 B;  4P7D A;  2L6M A;  1UIL A;  1X6E A;  2YTF A;  1X49 A;  4JI1 E;  4R03 A;  2V83 A;  2EPL X;  2RS7 A;  2EMW A;  4F6M A;  1WJP A;  3AV0 A;  3BGH A;  2M1S A;  4DV5 E;  2ELY A;  5A6K A;  3OTO E;  2WZO A;  1X6F A;  4JI2 E;  1O0W A;  4JYA E;  4RHB B;  2HJJ A;  4Q28 A;  4DR7 E;  3H09 A;  2LTR A;  5KL5 A;  4DMI A;  2BB8 A;  5KL2 A;  2DMI A;  3VYX A;  1N3G A;  3FIG A;  3EPJ A;  2EPM X;  1YYK A;  4DV6 E;  2EWL A;  2L2K B;  1EH6 A;  2EM9 A;  1G2F C;  4LTY A;  2V86 A;  2EE8 A;  2EM5 A;  1IQO A;  1GQE A;  3EPH A;  4HEI A;  3BID A;  5KL4 A;  2LCE A;  3J81 C;  2H36 X;  5KL6 A;  1A1J A;  2NUE A;  4F54 A;  2EN7 A;  4JI4 E;  2RQL A;  1IBM E;  3AUZ A;  2F8B A;  2VQF E;  1ZU1 A;  2A25 A;  4JV5 E;  3F6H A;  4GKK E;  2EN8 A;  1A1G A;  1SFE A;  1I94 E;  4DUY E;  2EPZ A;  1AH5 A;  4DV2 E;  2EPK X;  5IWA E;  1GTK A;  1N32 E;  1EH7 A;  1X47 A;  2K7I A;  3ADI A;  2EL6 A;  1PKP A;  4O43 A;  2MKD A;  1XNQ E;  2EP3 A;  1MGT A;  2RS6 A;  2B7T A;  1YUI A;  1A1H A;  2EL4 A;  2K4V A;  2YSP A;  2YRH A;  4X65 E;  4DUZ E;  4DR3 E;  2YWQ A;  4X9J A;  2ENH A;  2E72 A;  2YU8 A;  4NZV A;  2LUQ A;  5AE2 A;  1KYQ A;  1XMQ E;  4M30 A;  3VK6 A;  2EPN A;  4LFB E;  4B3M E;  2EPC A;  1YYO A;  1XMO E;  1X5W A;  1RQ0 A;  2ODR D;  1IBK E;  1GZ6 A;  1TF6 A;  4TUG A;  2EOJ A;  4RH8 A;  4F9B B;  2WCC 3;  1T4L B;  2L2N A;  2VF1 A;  2UXC E;  2YSO A;  1ZBT A;  2V88 A;  3IWB A;  2DB2 A;  2EMB A;  2LO3 A;  4DR6 E;  2J7J A;  2JP9 A;  2UUA E;  2MKN A;  2EOX A;  4LF4 E;  2CT1 A;  4JI7 E;  2YTJ A;  4DR1 E;  4ZYD A;  2B9D A;  5ADZ A;  2YTQ A;  2EM3 A;  4X64 E;  3T1H E;  2G7H A;  4WPY A;  4TUI A;  1IBL E;  1A1I A;  4R2R A;  5KL3 A;  4R2D A;  3IWD A;  2LE2 A;  3J7A G;  4WSP A;  2JWO A;  4L5N C;  4LF5 E;  3EPL A;  4DV7 E;  2YT4 A;  2EMY A;  3ZOQ B;  3THN A;  2EOH A;  2JYA A;  2EL5 A;  4R2P A;  2EOQ A;  3KZZ A;  4JI5 E;  2EOO A;  1AAY A;  1DI2 A;  1YPN A;  2EOR A;  2MC5 A;  2Q8U A;  4O4K A;  4WXC A;  4R2C A;  1HNX E;  2L8T A;  3C6K A;  1PDA A;  2B3T B;  2YTI A;  1JK1 A;  1YYW A;  2ELZ A;  2RSM A;  2ENC A;  2R1F A;  1BB8 A;  2YTN A;  5F3W A;  1TF3 A;  3MSW A;  3L00 A;  2YRM A;  4F2J C;  2EPU A;  2VRD A;  4B3R E;  2EQ0 A;  3LLH A;  2LBS B;  1BBO A;  4OOG C;  2MC6 A;  2HGH A;  2GHF A;  2EMC A;  1N33 E;  3K6Q A;  2EPO A;  2LJU A;  4R2E A;  2N8X A;  4ZYH A;  2JR1 A;  2RSI A;  5A2Q C;  3J80 C;  2DLK A;  2B7V A;  5LL6 R;  2NA2 A;  2L3C A;  2NAB A;  4X62 E;  4M2Z A;  5CFF E;  3THO B;  2EOY A;  2M4I A;  5LLQ A;  4NHR A;  1WXR A;  2UUB E;  3BF2 A; 
#chains in the Genus database with same CATH homology
 2MDR A;  2L2M A;  4LF7 E;  3HPS A;  2E1M A;  4I8O A;  5FLX C;  3C4T A;  5IT9 C;  4KHP E;  4LF6 E;  2LUQ A;  4M0V A;  5AE2 A;  1XMQ E;  4M30 A;  3VK6 A;  5BR8 E;  1ZBQ A;  2JOB A;  4B3S E;  1N32 E;  4LFB E;  2KON A;  5DNY A;  5AAS A;  1YYO A;  1XMO E;  4WYQ B;  2ODR C;  2NUF A;  1DQ3 A;  1QU6 A;  1RQ0 A;  2ODR D;  3HQ1 A;  1GZ6 A;  4L8N A;  1IBK E;  4TUG A;  1HNZ E;  2DSY A;  2VE7 C;  4F9B B;  2FV4 B;  2L2N A;  2VF1 A;  4BBY A;  1T4L B;  1ZBT A;  4B3T E;  2UXC E;  2V88 A;  2UXB E;  1RC7 A;  4X66 E;  3IWB A;  4JI8 E;  3HXL A;  2HHH E;  4P7D A;  2L6M A;  1UIL A;  2UUC E;  4LF9 E;  1X49 A;  2DB2 A;  4R03 A;  4JI1 E;  2JVA A;  3P1X A;  2V83 A;  4X8W A;  2ZM6 E;  4DR2 E;  4DR6 E;  2RS7 A;  4DKK A;  3KWR A;  3AV0 A;  2UUA E;  2M1S A;  4B3M E;  4DV5 E;  2LTS A;  3OTO E;  4LF4 E;  4F9A B;  2LMZ A;  2WZO A;  4K0K E;  4WFT A;  4JI2 E;  1O0W A;  4JI7 E;  3IWC A;  4JYA E;  4DR4 E;  4DR1 E;  3J7Y p;  2JY9 A;  4F9C B;  2B9D A;  2DIX A;  4NXM E;  5ADZ A;  2V85 A;  4Q28 A;  4DR7 E;  4JI0 E;  3H09 A;  2LTR A;  4X64 E;  4DR5 E;  3T1H E;  2G7H A;  4DMI A;  3DF6 A;  4M2Z A;  2JOX A;  2L92 A;  3C4B A;  4WPY A;  3HTX A;  4TUI A;  1IBL E;  4LU9 A;  1X48 A;  4BC7 A;  3VYX A;  3FIG A;  2CPN A;  3ADJ A;  3IWD A;  4GEQ B;  2LE2 A;  4P78 A;  4YY3 E;  4WSP A;  1YYK A;  3J7A G;  4GKJ E;  2JWO A;  4L5N C;  4DV6 E;  1N34 E;  4LF5 E;  1HNW E;  2EWL A;  4DV7 E;  2YT4 A;  2DMY A;  2L2K B;  3ZOQ B;  4LTY A;  2L3J A;  2V86 A;  2RTX A;  1GQE A;  1STU A;  4JI5 E;  3ADG A;  1T4N A;  1J5E E;  1XNR E;  4OX9 E;  1DI2 A;  4BS9 A;  1EKZ A;  3J81 C;  4NXN E;  2MC5 A;  3ADL A;  4BC9 A;  2EZ6 A;  2H36 X;  2E5L E;  1YZ9 A;  2NUE A;  3HPZ A;  4F54 A;  1HNX E;  2L8T A;  3T1Y E;  4LFC E;  4JI4 E;  1J26 A;  2B3T B;  1IBM E;  1YYW A;  3AUZ A;  4JI3 E;  2RSM A;  4DV1 E;  3F6G A;  5F3W A;  2F8B A;  2VQF E;  3MSW A;  5LMN E;  5AE1 A;  4DV3 E;  4J8Z A;  4JV5 E;  1WHN A;  2N3G A;  4LFA E;  2N3H A;  3F6H A;  2VQE E;  3OML A;  1FJG E;  4R8O A;  4GKK E;  4LF8 E;  4B3R E;  1N33 E;  3JU0 A;  5LMU E;  1I94 E;  3LLH A;  4DUY E;  4JI6 E;  3JTZ A;  2UXD E;  2LBS B;  4OOG C;  4DV2 E;  1UHZ A;  2MC6 A;  2V87 A;  3JAM C;  5IWA E;  1FKA E;  4YHH E;  4BCA A;  2LJH A;  3K6Q A;  1T4O A;  5T6J A;  5AE3 A;  1HR0 E;  1X47 A;  4AQY E;  2V89 A;  3ADI A;  1PKP A;  2KOU A;  4KZS A;  2V8Q B;  4DV0 E;  1XNQ E;  2FTX B;  3DJW A;  1SR9 A;  2JR1 A;  5A2Q C;  3J80 C;  2RS6 A;  2NUG A;  4BMJ A;  2B7V A;  2B7T A;  2LRS A;  2NA2 A;  3LML A;  5LL6 R;  2M7Q A;  2IHR 1;  4X62 E;  5CFF E;  2L3C A;  3VYY A;  4DV4 E;  2LUP B;  3RMP A;  2K4V A;  2F4V E;  1N36 E;  2L33 A;  2M4I A;  4X65 E;  1WHQ A;  2KHX A;  4DUZ E;  4DR3 E;  2FGG A;  2UU9 E;  2YZT A;  1WXR A;  2UUB E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...