4F9AB

Human cdc7 kinase in complex with dbf4 and nucleotide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
129
structure length
90
Chain Sequence
b'RLKKPFVKVEDMSQLYRPFYLQLTNMPFINYSIQKPCSPFDGYCECCLQKYEDLETHLLSEQHRNFAQSNQYQVVDDIVSKLVFDFVEYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cell division cycle 7-related protein kinase
publication title Crystal structure of human CDC7 kinase in complex with its activator DBF4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 14
structure length 90
sequence length 129
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07535 zf-DBF DBF zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.680 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4f9aB02
4F9CB 4F9BB 4F9AB
chains in the Genus database with same CATH superfamily
2E1MA 1X49A 2HC5A 2G7HA 4DV4E 1YYOA 3IWCA 1TN9A 4HEIA 4NZVA 2EOZA 2DIXA 2GHFA 2ELZA 2EPRA 4F6MA 4JI1E 4OX9E 4L8NA 3MSWA 5KL2A 2WBTA 2K4VA 1ZBQA 2LJUA 5IXMB 3THOB 2CT1A 2DGCA 2N8XA 2EMZA 5AC4A 2V83A 5KL4A 4DUZE 3F6HA 1X6HA 2B9DA 2EMBA 2RS6A 4P78A 2EM9A 3AUZA 2EMFA 1BBOA 5IV8B 3M99B 1SR9A 2V89A 2EPMX 2EM6A 2MKDA 5KL6A 2JPAA 2V87A 2K7IA 4JI0E 2EL4A 2L33A 1LLMC 4LF4E 1F2IG 4F6NA 1PDAA 5A6BA 4LU9A 2JOXA 4R2QA 2EOSA 4KZSA 2EWLA 3ADIA 1G2FC 2LRSA 1YYKA 4GKJE 2EOEA 4J8ZA 2Q8UA 2JP9A 2DB2A 4MLQA 5LLQA 3EPKA 2DRPA 4DV3E 3C6KA 4TUIA 1N36E 1DI2A 1N33E 3BIDA 2DMIA 2EOIA 3ADJA 4JI7E 2EQ3A 4R2CA 5LL6R 5A2QC 2YPNA 2EM2A 2EMKA 2VE7C 2EMHA 4X62E 1SFEA 1J5EE 4DR7E 2I9IA 2M9AA 2YTNA 1GZ6A 2LJHA 2LMZA 2M1SA 5KL7A 2LCEA 4DV2E 4O43A 3T1YE 2RS7A 5FLXC 5BR8E 2EM0A 2EOMA 2UUCE 1KYQA 4DV1E 4X8WA 4O5GA 2EPUA 2RPCA 4N4RB 1A1HA 2YTDA 2EOJA 4RH8A 2LTSA 1NCSA 1XNRE 1A1LA 5A6JA 2LVHA 1JK1A 1T38A 4BBYA 2YWQA 4LF6E 2LO3A 2LBSB 2ELYA 1HNZE 1N32E 1XNQE 2KOUA 4O4KA 5A6KA 1A1FA 1ZAAC 1P47A 1YYWA 1QU6A 4IS1C 2ENCA 1YZ9A 2E5LE 2LUPB 1WRJA 2EPNA 4LF9E 2EMLA 3VHTB 1Z1BA 1YFHA 4TUGA 1IBKE 3UK3C 2UXDE 2BBGA 4R03A 4ZYEA 4MLVA 4NXME 3BGHA 2EOOA 3EPHA 2WBUA 2EOXA 3C4TA 3VK6A 4JV5E 1EH6A 1HNWE 2N3HA 1RC7A 2EN1A 1T39A 1UBDC 2EMYA 2PRTA 2RTXA 5AE2A 1HNXE 1HR0E 3AV0A 1X5WA 4YHHE 3L00A 4Q28A 2GLIA 2UU9E 3H09A 1ZU1A 2EMIA 2LTRA 4BC9A 2UUAE 1AH5A 4DR6E 4I8OA 4IJDA 2JWOA 3EQ1A 1PJTA 2L8TA 2EN3A 5IT9C 3ADGA 2YRKA 2MC6A 2VQFE 1IBLE 1KJKA 2HGHA 4B3RE 1X6EA 2YTJA 2EN8A 1X6FA 2DSYA 3RMPA 1IQOA 2L2MA 2VRDA 2YSPA 4LFCE 4ZYDA 1STUA 2YTIA 2V86A 5A6AA 2DMYA 3IWDA 4WXDA 4R2SA 4X66E 4WPYA 2V8QB 4JI6E 4Q35B 2WCC3 4DR2E 4ZYHA 2M7QA 2JYAA 2YRMA 1YUJA 1AAYA 2EP3A 4WSPA 1XMQE 2YTPA 3EPLA 3KWRA 3QG5C 2L2KB 4F9CB 2RSMA 5AC5A 2V88A 4AQYE 4LFBE 1N3GA 5KL3A 4F9BB 4WXCA 1TF6A 1UN6B 2EOQA 4R2DA 4DR5E 5LMUE 2UXBE 4WYQB 5DNYA 3HPZA 3DF6A 3KZZA 4LFAE 2JVAA 2EOFA 2BB8A 4F9AB 4R2EA 4X65E 4R2PA 1UHZA 4L5NC 1A1JA 2EPPA 4KWYA 2EN7A 2EM5A 2EJ4A 2EM3A 5KL5A 4M30A 1WHNA 1PKPA 3JTZA 2EN4A 2EM7A 2H36X 5AE1A 1G2DC 2YSOA 3BF2A 5IWAE 4BHCA 2YZTA 3MHSC 3ECRA 4BHBA 3HTXA 2B7TA 2EMWA 1J26A 4F54A 1B69A 2L2NA 1PJSA 5A69A 4ZYGA 2EMXA 2VQEE 1ZBTA 2RQLA 2HJJA 1FJGE 2L6MA 2CTDA 2D9HA 4JI8E 1IMUA 1QNTA 4M2ZA 4R2RA 2EPZA 1BBGA 2MDGA 2V85A 1GQEA 3F6GA 2EMCA 2EPAA 2EZ6A 1EH8A 3C4BA 5ADZA 3J7AG 2EPLX 2JY9A 4KHPE 1IQSA 2F4VE 4DR4E 1YPNA 1X3CA 2EPOA 1A1KA 2LV2A 2YT4A 2YTFA 4B3ME 2JOBA 1ZR9A 2M4IA 2EL5A 3THNA 2WBSA 5TSEA 4BCAA 2NA2A 4LTYA 5AASA 3T1HE 4GKKE 2FV4B 2LE2A 1T4LB 1PJQA 2EMGA 2EL6A 4X9JA 2JXPA 3KZYA 4R2AA 3LLHA 4O24A 3HQ1A 5CFFE 2YU5A 2NUGA 4DV7E 2I13A 4NXNE 1X47A 2MKNA 2L3JA 2EORA 2GPIA 4JI5E 2ODRD 4DMIA 2J7JA 2A25A 2CSHA 4DR1E 2R76A 2RSIA 1T4OA 3DJWA 4F2JC 4M0VA 4R8OA 1NEIA 1BB8A 4DV0E 4RHBB 1EKZA 2EE8A 2IHR1 4DR3E 1MEYC 2EM8A 2F8BA 1A1GA 1JK2A 2YTOA 4JYAE 2WZOA 2EQ1A 4JI2E 2CPNA 3HXLA 3OTOE 3FIGA 2ODRC 3HPSA 2ENHA 4GEQB 2NUEA 2NUFA 1YSAC 4WFTA 1IBME 2L3CA 2DLKA 2KONA 2MC5A 3OMLA 4B3SE 4BS9A 5A6BD 4WX9A 1WHQA 4P7DA 4M9VC 1FKAE 3IWBA 1TF3A 4YY3E 1DGCA 3ZOQB 3J81C 2YTQA 3LMLA 4BC7A 4X64E 1O0WA 1EH7A 2EN6A 3VYYA 4LF7E 2ENAA 2EPXA 1YUIA 2EMAA 2FTXB 3EPJA 4FK5C 2FGGA 2JR1A 4OOGC 5AE3A 2YU8A 4DV5E 4K0KE 2LUQA 2N3GA 3C6MA 2ADRA 3ADLA 5LMNE 3MHHC 4JI4E 4LF8E 2MDRA 5F3WA 2LT7A 3VYXA 2EPKX 4WSGA 1RQ0A 4LF5E 1RMDA 2EPCA 2YRHA 3JU0A 4B3TE 2R1FA 4DV6E 3P1XA 4BMJA 1I94E 3K6QA 1WJPA 2UUBE 1XMOE 4GZNC 2VF1A 2NABA 2B3TB 2E72A 1N34E 1UILA 3TQMA 1A1IA 2DLQA 2YTEA 1T4NA 2L92A 5T6JA 4DKKA 3J7Yp 2EQ0A 1MGTA 4DUYE 3J80C 2EOHA 4HTGA 2B7VA 1DQ3A 2KHXA 3BBGA 2EOYA 4JI3E 2UXCE 2YTGA 2ZM6E 2EM4A 3JAMC 4NHRA 1X48A 1GTKA 2HHHE 2EN2A 1L4SA 1WXRA
chains in the Genus database with same CATH topology
2E1MA 1XNRE 2CPNA 3HXLA 1X49A 3OTOE 2G7HA 4DV4E 4BBYA 4DR5E 3IWCA 1YYOA 5LMUE 3FIGA 2LBSB 4LF6E 2ODRC 3HPSA 2DIXA 4WYQB 5DNYA 3HPZA 1HNZE 1N32E 3DF6A 4GEQB 1XNQE 2NUEA 2KOUA 4LFAE 2NUFA 2JVAA 4JI1E 4WFTA 4F9AB 4X65E 2L3CA 1IBME 1UHZA 4OX9E 1YYWA 1QU6A 2KONA 2MC5A 3OMLA 4L5NC 4L8NA 4B3SE 4BS9A 1YZ9A 2E5LE 2LUPB 3MSWA 4M30A 4LF9E 1WHNA 1WHQA 1PKPA 3JTZA 4P7DA 2K4VA 1ZBQA 1FKAE 2H36X 3IWBA 5AE1A 4TUGA 1IBKE 4YY3E 5IWAE 3ZOQB 3J81C 2UXDE 4R03A 2YZTA 3LMLA 4BC7A 4X64E 2V83A 1O0WA 4NXME 3HTXA 4DUZE 3VYYA 4LF7E 2B7TA 2B9DA 3F6HA 2RS6A 4P78A 3C4TA 2FTXB 3AUZA 3VK6A 4JV5E 1J26A 4F54A 2FGGA 2L2NA 2JR1A 4OOGC 5AE3A 1HNWE 2N3HA 2VQEE 1SR9A 1ZBTA 2LUQA 4DV5E 4K0KE 1FJGE 2N3GA 2L6MA 1RC7A 2V89A 4JI8E 4M2ZA 3ADLA 5LMNE 2V87A 4JI0E 2L33A 2V85A 4JI4E 4LF8E 1GQEA 2MDRA 2RTXA 3F6GA 5AE2A 1HNXE 1HR0E 4LF4E 3AV0A 4YHHE 2UU9E 4Q28A 2EZ6A 5F3WA 3H09A 3C4BA 5ADZA 3J7AG 3VYXA 4BC9A 2LTRA 4LU9A 2JOXA 2UUAE 4DR6E 2JY9A 4I8OA 4KHPE 2F4VE 1RQ0A 2EWLA 2JWOA 4KZSA 4LF5E 3ADIA 4DR4E 2L8TA 2YT4A 5IT9C 4B3ME 3JU0A 4B3TE 2JOBA 3ADGA 2LRSA 2M4IA 1YYKA 2MC6A 2VQFE 1IBLE 4DV6E 4GKJE 3P1XA 4J8ZA 4BMJA 1I94E 4B3RE 2DB2A 4BCAA 2DSYA 2NA2A 3RMPA 3K6QA 4LTYA 2L2MA 5AASA 2UUBE 4DV3E 3T1HE 4LFCE 4GKKE 2FV4B 2LE2A 4TUIA 1STUA 1XMOE 1N36E 1T4LB 4JI2E 2VF1A 1DI2A 1N33E 2B3TB 3ADJA 4JI7E 1N34E 5A2QC 2V86A 1UILA 2DMYA 3IWDA 5LL6R 3LLHA 2VE7C 4X66E 4X62E 1J5EE 4DR7E 4WPYA 2V8QB 3HQ1A 5CFFE 4JI6E 2NUGA 4DV7E 4DR2E 4NXNE 1X47A 1GZ6A 2LJHA 2LMZA 2M1SA 2M7QA 2L3JA 1T4NA 2L92A 5T6JA 4DKKA 3J7Yp 4DV2E 3T1YE 4DUYE 4JI5E 2ODRD 3J80C 4DMIA 2B7VA 1DQ3A 2KHXA 4WSPA 4DR1E 2RS7A 5FLXC 1XMQE 1T4OA 3KWRA 3DJWA 5BR8E 4M0VA 4R8OA 2L2KB 4DV0E 4F9CB 2UUCE 4JI3E 2RSMA 2UXCE 1EKZA 2ZM6E 2IHR1 4DV1E 4X8WA 3JAMC 4DR3E 2UXBE 2V88A 2F8BA 4AQYE 1X48A 4JYAE 4LFBE 2HHHE 2WZOA 1WXRA 4F9BB 2LTSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F9C B;  4F9B B;  4F9A B; 
#chains in the Genus database with same CATH topology
 2E1M A;  1X49 A;  2HC5 A;  2G7H A;  4DV4 E;  1YYO A;  3IWC A;  1TN9 A;  4HEI A;  4NZV A;  2EOZ A;  2DIX A;  2GHF A;  2ELZ A;  2EPR A;  4F6M A;  4JI1 E;  4OX9 E;  4L8N A;  3MSW A;  5KL2 A;  2WBT A;  2K4V A;  1ZBQ A;  2LJU A;  5IXM B;  3THO B;  2CT1 A;  2DGC A;  2N8X A;  2EMZ A;  5AC4 A;  2V83 A;  5KL4 A;  4DUZ E;  3F6H A;  1X6H A;  2B9D A;  2EMB A;  2RS6 A;  4P78 A;  2EM9 A;  3AUZ A;  2EMF A;  1BBO A;  5IV8 B;  3M99 B;  1SR9 A;  2V89 A;  2EPM X;  2EM6 A;  2MKD A;  5KL6 A;  2JPA A;  2V87 A;  2K7I A;  4JI0 E;  2EL4 A;  2L33 A;  1LLM C;  4LF4 E;  1F2I G;  4F6N A;  1PDA A;  5A6B A;  4LU9 A;  2JOX A;  4R2Q A;  2EOS A;  4KZS A;  2EWL A;  3ADI A;  1G2F C;  2LRS A;  1YYK A;  4GKJ E;  2EOE A;  4J8Z A;  2Q8U A;  2JP9 A;  2DB2 A;  4MLQ A;  5LLQ A;  3EPK A;  2DRP A;  4DV3 E;  3C6K A;  4TUI A;  1N36 E;  1DI2 A;  1N33 E;  3BID A;  2DMI A;  2EOI A;  3ADJ A;  4JI7 E;  2EQ3 A;  4R2C A;  5LL6 R;  5A2Q C;  2YPN A;  2EM2 A;  2EMK A;  2VE7 C;  2EMH A;  4X62 E;  1SFE A;  1J5E E;  4DR7 E;  2I9I A;  2M9A A;  2YTN A;  1GZ6 A;  2LJH A;  2LMZ A;  2M1S A;  5KL7 A;  2LCE A;  4DV2 E;  4O43 A;  3T1Y E;  2RS7 A;  5FLX C;  5BR8 E;  2EM0 A;  2EOM A;  2UUC E;  1KYQ A;  4DV1 E;  4X8W A;  4O5G A;  2EPU A;  2RPC A;  4N4R B;  1A1H A;  2YTD A;  2EOJ A;  4RH8 A;  2LTS A;  1NCS A;  1XNR E;  1A1L A;  5A6J A;  2LVH A;  1JK1 A;  1T38 A;  4BBY A;  2YWQ A;  4LF6 E;  2LO3 A;  2LBS B;  2ELY A;  1HNZ E;  1N32 E;  1XNQ E;  2KOU A;  4O4K A;  5A6K A;  1A1F A;  1ZAA C;  1P47 A;  1YYW A;  1QU6 A;  4IS1 C;  2ENC A;  1YZ9 A;  2E5L E;  2LUP B;  1WRJ A;  2EPN A;  4LF9 E;  2EML A;  3VHT B;  1Z1B A;  1YFH A;  4TUG A;  1IBK E;  3UK3 C;  2UXD E;  2BBG A;  4R03 A;  4ZYE A;  4MLV A;  4NXM E;  3BGH A;  2EOO A;  3EPH A;  2WBU A;  2EOX A;  3C4T A;  3VK6 A;  4JV5 E;  1EH6 A;  1HNW E;  2N3H A;  1RC7 A;  2EN1 A;  1T39 A;  1UBD C;  2EMY A;  2PRT A;  2RTX A;  5AE2 A;  1HNX E;  1HR0 E;  3AV0 A;  1X5W A;  4YHH E;  3L00 A;  4Q28 A;  2GLI A;  2UU9 E;  3H09 A;  1ZU1 A;  2EMI A;  2LTR A;  4BC9 A;  2UUA E;  1AH5 A;  4DR6 E;  4I8O A;  4IJD A;  2JWO A;  3EQ1 A;  1PJT A;  2L8T A;  2EN3 A;  5IT9 C;  3ADG A;  2YRK A;  2MC6 A;  2VQF E;  1IBL E;  1KJK A;  2HGH A;  4B3R E;  1X6E A;  2YTJ A;  2EN8 A;  1X6F A;  2DSY A;  3RMP A;  1IQO A;  2L2M A;  2VRD A;  2YSP A;  4LFC E;  4ZYD A;  1STU A;  2YTI A;  2V86 A;  5A6A A;  2DMY A;  3IWD A;  4WXD A;  4R2S A;  4X66 E;  4WPY A;  2V8Q B;  4JI6 E;  4Q35 B;  2WCC 3;  4DR2 E;  4ZYH A;  2M7Q A;  2JYA A;  2YRM A;  1YUJ A;  1AAY A;  2EP3 A;  4WSP A;  1XMQ E;  2YTP A;  3EPL A;  3KWR A;  3QG5 C;  2L2K B;  4F9C B;  2RSM A;  5AC5 A;  2V88 A;  4AQY E;  4LFB E;  1N3G A;  5KL3 A;  4F9B B;  4WXC A;  1TF6 A;  1UN6 B;  2EOQ A;  4R2D A;  4DR5 E;  5LMU E;  2UXB E;  4WYQ B;  5DNY A;  3HPZ A;  3DF6 A;  3KZZ A;  4LFA E;  2JVA A;  2EOF A;  2BB8 A;  4F9A B;  4R2E A;  4X65 E;  4R2P A;  1UHZ A;  4L5N C;  1A1J A;  2EPP A;  4KWY A;  2EN7 A;  2EM5 A;  2EJ4 A;  2EM3 A;  5KL5 A;  4M30 A;  1WHN A;  1PKP A;  3JTZ A;  2EN4 A;  2EM7 A;  2H36 X;  5AE1 A;  1G2D C;  2YSO A;  3BF2 A;  5IWA E;  4BHC A;  2YZT A;  3MHS C;  3ECR A;  4BHB A;  3HTX A;  2B7T A;  2EMW A;  1J26 A;  4F54 A;  1B69 A;  2L2N A;  1PJS A;  5A69 A;  4ZYG A;  2EMX A;  2VQE E;  1ZBT A;  2RQL A;  2HJJ A;  1FJG E;  2L6M A;  2CTD A;  2D9H A;  4JI8 E;  1IMU A;  1QNT A;  4M2Z A;  4R2R A;  2EPZ A;  1BBG A;  2MDG A;  2V85 A;  1GQE A;  3F6G A;  2EMC A;  2EPA A;  2EZ6 A;  1EH8 A;  3C4B A;  5ADZ A;  3J7A G;  2EPL X;  2JY9 A;  4KHP E;  1IQS A;  2F4V E;  4DR4 E;  1YPN A;  1X3C A;  2EPO A;  1A1K A;  2LV2 A;  2YT4 A;  2YTF A;  4B3M E;  2JOB A;  1ZR9 A;  2M4I A;  2EL5 A;  3THN A;  2WBS A;  5TSE A;  4BCA A;  2NA2 A;  4LTY A;  5AAS A;  3T1H E;  4GKK E;  2FV4 B;  2LE2 A;  1T4L B;  1PJQ A;  2EMG A;  2EL6 A;  4X9J A;  2JXP A;  3KZY A;  4R2A A;  3LLH A;  4O24 A;  3HQ1 A;  5CFF E;  2YU5 A;  2NUG A;  4DV7 E;  2I13 A;  4NXN E;  1X47 A;  2MKN A;  2L3J A;  2EOR A;  2GPI A;  4JI5 E;  2ODR D;  4DMI A;  2J7J A;  2A25 A;  2CSH A;  4DR1 E;  2R76 A;  2RSI A;  1T4O A;  3DJW A;  4F2J C;  4M0V A;  4R8O A;  1NEI A;  1BB8 A;  4DV0 E;  4RHB B;  1EKZ A;  2EE8 A;  2IHR 1;  4DR3 E;  1MEY C;  2EM8 A;  2F8B A;  1A1G A;  1JK2 A;  2YTO A;  4JYA E;  2WZO A;  2EQ1 A;  4JI2 E;  2CPN A;  3HXL A;  3OTO E;  3FIG A;  2ODR C;  3HPS A;  2ENH A;  4GEQ B;  2NUE A;  2NUF A;  1YSA C;  4WFT A;  1IBM E;  2L3C A;  2DLK A;  2KON A;  2MC5 A;  3OML A;  4B3S E;  4BS9 A;  5A6B D;  4WX9 A;  1WHQ A;  4P7D A;  4M9V C;  1FKA E;  3IWB A;  1TF3 A;  4YY3 E;  1DGC A;  3ZOQ B;  3J81 C;  2YTQ A;  3LML A;  4BC7 A;  4X64 E;  1O0W A;  1EH7 A;  2EN6 A;  3VYY A;  4LF7 E;  2ENA A;  2EPX A;  1YUI A;  2EMA A;  2FTX B;  3EPJ A;  4FK5 C;  2FGG A;  2JR1 A;  4OOG C;  5AE3 A;  2YU8 A;  4DV5 E;  4K0K E;  2LUQ A;  2N3G A;  3C6M A;  2ADR A;  3ADL A;  5LMN E;  3MHH C;  4JI4 E;  4LF8 E;  2MDR A;  5F3W A;  2LT7 A;  3VYX A;  2EPK X;  4WSG A;  1RQ0 A;  4LF5 E;  1RMD A;  2EPC A;  2YRH A;  3JU0 A;  4B3T E;  2R1F A;  4DV6 E;  3P1X A;  4BMJ A;  1I94 E;  3K6Q A;  1WJP A;  2UUB E;  1XMO E;  4GZN C;  2VF1 A;  2NAB A;  2B3T B;  2E72 A;  1N34 E;  1UIL A;  3TQM A;  1A1I A;  2DLQ A;  2YTE A;  1T4N A;  2L92 A;  5T6J A;  4DKK A;  3J7Y p;  2EQ0 A;  1MGT A;  4DUY E;  3J80 C;  2EOH A;  4HTG A;  2B7V A;  1DQ3 A;  2KHX A;  3BBG A;  2EOY A;  4JI3 E;  2UXC E;  2YTG A;  2ZM6 E;  2EM4 A;  3JAM C;  4NHR A;  1X48 A;  1GTK A;  2HHH E;  2EN2 A;  1L4S A;  1WXR A; 
#chains in the Genus database with same CATH homology
 2E1M A;  1XNR E;  2CPN A;  3HXL A;  1X49 A;  3OTO E;  2G7H A;  4DV4 E;  4BBY A;  4DR5 E;  3IWC A;  1YYO A;  5LMU E;  3FIG A;  2LBS B;  4LF6 E;  2ODR C;  3HPS A;  2DIX A;  4WYQ B;  5DNY A;  3HPZ A;  1HNZ E;  1N32 E;  3DF6 A;  4GEQ B;  1XNQ E;  2NUE A;  2KOU A;  4LFA E;  2NUF A;  2JVA A;  4JI1 E;  4WFT A;  4F9A B;  4X65 E;  2L3C A;  1IBM E;  1UHZ A;  4OX9 E;  1YYW A;  1QU6 A;  2KON A;  2MC5 A;  3OML A;  4L5N C;  4L8N A;  4B3S E;  4BS9 A;  1YZ9 A;  2E5L E;  2LUP B;  3MSW A;  4M30 A;  4LF9 E;  1WHN A;  1WHQ A;  1PKP A;  3JTZ A;  4P7D A;  2K4V A;  1ZBQ A;  1FKA E;  2H36 X;  3IWB A;  5AE1 A;  4TUG A;  1IBK E;  4YY3 E;  5IWA E;  3ZOQ B;  3J81 C;  2UXD E;  4R03 A;  2YZT A;  3LML A;  4BC7 A;  4X64 E;  2V83 A;  1O0W A;  4NXM E;  3HTX A;  4DUZ E;  3VYY A;  4LF7 E;  2B7T A;  2B9D A;  3F6H A;  2RS6 A;  4P78 A;  3C4T A;  2FTX B;  3AUZ A;  3VK6 A;  4JV5 E;  1J26 A;  4F54 A;  2FGG A;  2L2N A;  2JR1 A;  4OOG C;  5AE3 A;  1HNW E;  2N3H A;  2VQE E;  1SR9 A;  1ZBT A;  2LUQ A;  4DV5 E;  4K0K E;  1FJG E;  2N3G A;  2L6M A;  1RC7 A;  2V89 A;  4JI8 E;  4M2Z A;  3ADL A;  5LMN E;  2V87 A;  4JI0 E;  2L33 A;  2V85 A;  4JI4 E;  4LF8 E;  1GQE A;  2MDR A;  2RTX A;  3F6G A;  5AE2 A;  1HNX E;  1HR0 E;  4LF4 E;  3AV0 A;  4YHH E;  2UU9 E;  4Q28 A;  2EZ6 A;  5F3W A;  3H09 A;  3C4B A;  5ADZ A;  3J7A G;  3VYX A;  4BC9 A;  2LTR A;  4LU9 A;  2JOX A;  2UUA E;  4DR6 E;  2JY9 A;  4I8O A;  4KHP E;  2F4V E;  1RQ0 A;  2EWL A;  2JWO A;  4KZS A;  4LF5 E;  3ADI A;  4DR4 E;  2L8T A;  2YT4 A;  5IT9 C;  4B3M E;  3JU0 A;  4B3T E;  2JOB A;  3ADG A;  2LRS A;  2M4I A;  1YYK A;  2MC6 A;  2VQF E;  1IBL E;  4DV6 E;  4GKJ E;  3P1X A;  4J8Z A;  4BMJ A;  1I94 E;  4B3R E;  2DB2 A;  4BCA A;  2DSY A;  2NA2 A;  3RMP A;  3K6Q A;  4LTY A;  2L2M A;  5AAS A;  2UUB E;  4DV3 E;  3T1H E;  4LFC E;  4GKK E;  2FV4 B;  2LE2 A;  4TUI A;  1STU A;  1XMO E;  1N36 E;  1T4L B;  4JI2 E;  2VF1 A;  1DI2 A;  1N33 E;  2B3T B;  3ADJ A;  4JI7 E;  1N34 E;  5A2Q C;  2V86 A;  1UIL A;  2DMY A;  3IWD A;  5LL6 R;  3LLH A;  2VE7 C;  4X66 E;  4X62 E;  1J5E E;  4DR7 E;  4WPY A;  2V8Q B;  3HQ1 A;  5CFF E;  4JI6 E;  2NUG A;  4DV7 E;  4DR2 E;  4NXN E;  1X47 A;  1GZ6 A;  2LJH A;  2LMZ A;  2M1S A;  2M7Q A;  2L3J A;  1T4N A;  2L92 A;  5T6J A;  4DKK A;  3J7Y p;  4DV2 E;  3T1Y E;  4DUY E;  4JI5 E;  2ODR D;  3J80 C;  4DMI A;  2B7V A;  1DQ3 A;  2KHX A;  4WSP A;  4DR1 E;  2RS7 A;  5FLX C;  1XMQ E;  1T4O A;  3KWR A;  3DJW A;  5BR8 E;  4M0V A;  4R8O A;  2L2K B;  4DV0 E;  4F9C B;  2UUC E;  4JI3 E;  2RSM A;  2UXC E;  1EKZ A;  2ZM6 E;  2IHR 1;  4DV1 E;  4X8W A;  3JAM C;  4DR3 E;  2UXB E;  2V88 A;  2F8B A;  4AQY E;  1X48 A;  4JYA E;  4LFB E;  2HHH E;  2WZO A;  1WXR A;  4F9B B;  2LTS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...