5T6JA

Structure of the mind complex shows a regulatory focus of yeast kinetochore assembly
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
59
structure length
59
Chain Sequence
ANENILKLKLYRSLGVILDLENDQVLINRKNDGNIDILPLDNNLSDFYKTKYIWERLGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the MIND Complex Defines a Regulatory Focus for Yeast Kinetochore Assembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Cell cycle
molecule keywords Kinetochore protein SPC24
total genus 15
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2016-09-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.430 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5t6jA00
5T6JA 4GEQB 2FTXB 2FV4B
chains in the Genus database with same CATH superfamily
1AAYA 1ZBQA 2ENAA 5F3WA 2EN4A 1T4OA 2EM0A 2CPNA 2EM2A 2VQEE 2V83A 2YSPA 2UXBE 1A1FA 4ZYDA 2JP9A 4RHBB 2LBSB 1IMUA 2LO3A 4M2ZA 2LCEA 1WRJA 2YTEA 2F4VE 2IHR1 2ENHA 3C4BA 2D9HA 2EPPA 4DV5E 2DLQA 2NUEA 2EQ1A 3KWRA 1PKPA 2EMAA 1PJTA 4LFCE 2UU9E 4ZYHA 2RSMA 2L2MA 4RH8A 4M9VC 2N3GA 1T4LB 2EMHA 3BIDA 1B69A 2EMKA 5T6JA 2YPNA 5KL4A 1YUIA 2MKDA 1MEYC 3H09A 4R2PA 4LF4E 2UUBE 2DRPA 2YTOA 1YFHA 2EMZA 2ELZA 4DV6E 2EM5A 4JYAE 1ZU1A 4YHHE 5LMUE 2EL6A 2JR1A 4L5NC 4X9JA 2EMWA 4F54A 2GHFA 2JOXA 3C4TA 4HEIA 2V89A 2WBSA 1N3GA 3ADGA 1O0WA 1NEIA 2YTPA 5A6BA 1P47A 2EMCA 1EH6A 2EMYA 2NUFA 3AV0A 4I8OA 2RS7A 2CSHA 2LRSA 1Z1BA 4BS9A 4L8NA 2L33A 2ENCA 4R2SA 2YSOA 1X49A 3BBGA 4MLVA 2MKNA 1EH8A 2EQ3A 2EL5A 3DF6A 1DGCA 4WFTA 3HQ1A 2YTQA 4DV7E 5IWAE 3HXLA 2EM6A 3MSWA 2YTJA 2EOFA 3OTOE 4Q35B 4R8OA 4DMIA 1EH7A 2V85A 1WJPA 1X48A 2EPLX 2JY9A 2ZM6E 2YTIA 5KL7A 4LFAE 2CTDA 2EM3A 5FLXC 2V87A 2EP3A 2EM9A 5AE1A 4DR4E 2JPAA 2M1SA 4X8WA 2MC6A 4B3SE 2EL4A 4DV2E 4B3TE 5BR8E 2JOBA 3MHSC 1A1GA 1XNQE 2EWLA 4O5GA 2NUGA 4GZNC 1DI2A 1TF6A 2EPCA 1PJSA 1YSAC 4WX9A 2EOHA 2L3JA 1YUJA 1STUA 2YT4A 3VYXA 4K0KE 2EPNA 2JXPA 2ODRC 4BCAA 2EE8A 4WSGA 2EMIA 3M99B 2FTXB 3J81C 2UXDE 2EMGA 4B3ME 1RMDA 2YRHA 3FIGA 4KHPE 4GKJE 3RMPA 1UBDC 2EN1A 2LTRA 2I9IA 2EN7A 4YY3E 2UUAE 4JI1E 3THNA 2DIXA 1A1IA 2EOQA 1YYWA 4WXCA 3J7Yp 5KL2A 5AC5A 1N36E 1I94E 2EOOA 2JYAA 1XMOE 4DV0E 4KWYA 2ADRA 2B9DA 2G7HA 3JTZA 4R2DA 1HNWE 4O43A 1TF3A 2B7TA 2H36X 4X62E 2K7IA 2BBGA 3THOB 2FV4B 2MDRA 2EPUA 2GPIA 1J5EE 2EPRA 4GEQB 1N34E 1IQSA 1YZ9A 4NZVA 2L6MA 1BB8A 3DJWA 4F9CB 2EPMX 2DGCA 3ADIA 4X66E 2RS6A 4DKKA 2I13A 1T4NA 1BBOA 1N32E 2EM7A 1NCSA 2B7VA 2E5LE 1IQOA 3TQMA 1X6HA 5A6BD 1UILA 2WBTA 3KZZA 5KL6A 1GZ6A 2N8XA 2YZTA 2EPAA 2YRMA 2EM8A 5A6AA 1DQ3A 1PDAA 3C6KA 4WPYA 2EOMA 3T1YE 1PJQA 4DR2E 1RC7A 4R2EA 1RQ0A 4IS1C 4LF5E 4DUZE 3HPZA 1X6FA 2VF1A 4MLQA 4R2AA 1A1KA 4AQYE 4B3RE 1J26A 3EPHA 3MHHC 2EMBA 2HC5A 1JK2A 4JI6E 4BMJA 1WXRA 4WSPA 2K4VA 2WBUA 2LE2A 2V88A 1MGTA 3T1HE 4FK5C 2KHXA 1ZR9A 3VYYA 3QG5C 2YTDA 4F2JC 1LLMC 4WYQB 2EMXA 2B3TB 4F6NA 2EOIA 2YTGA 1WHNA 4P78A 3LMLA 4R2QA 2J7JA 1WHQA 2YRKA 2R1FA 4BBYA 5ADZA 1FJGE 2E72A 2L92A 2M7QA 2EQ0A 1F2IG 5AASA 2N3HA 3IWCA 2DB2A 3F6GA 2YU8A 2L3CA 2MDGA 4ZYGA 2LVHA 1YYOA 2EOEA 2EPXA 2F8BA 1N33E 1BBGA 1UHZA 2E1MA 2LJHA 2LUQA 4BC7A 4X65E 2VQFE 5CFFE 4LF8E 1G2DC 2RTXA 2EOXA 5IV8B 4NXME 4LFBE 4DUYE 3AUZA 4OOGC 2EMFA 4F9BB 4JI3E 1KJKA 5IXMB 2NABA 2RSIA 2L8TA 4DR3E 1G2FC 2WCC3 2YWQA 4NHRA 1XMQE 1ZAAC 1XNRE 2EORA 5A6KA 4JI5E 3BF2A 4Q28A 2LV2A 3EPKA 4LTYA 2MC5A 2HGHA 4R03A 4R2CA 1A1LA 1FKAE 2EN3A 4TUGA 4JV5E 4N4RB 3L00A 2ELYA 1QNTA 1IBKE 2A25A 4GKKE 1KYQA 2EN2A 5IT9C 2EOYA 4F9AB 4JI4E 4R2RA 2V8QB 2EN8A 2WZOA 2EJ4A 4LU9A 1IBME 2CT1A 1QU6A 2DMIA 2LJUA 1EKZA 5AC4A 1A1JA 4BHBA 4JI7E 2ODRD 2LTSA 4O24A 1JK1A 4DR7E 3EQ1A 4DV4E 3C6MA 2GLIA 2VRDA 2RPCA 3EPJA 2JVAA 3JAMC 1X47A 1YPNA 1TN9A 4JI8E 4HTGA 4KZSA 3KZYA 5LMNE 3P1XA 3F6HA 4BC9A 1T38A 5DNYA 3LLHA 1ZBTA 3HPSA 2LT7A 5AE3A 1AH5A 4LF9E 5AE2A 2HJJA 4M0VA 2EZ6A 3ECRA 2EN6A 3IWDA 2EPOA 2JWOA 4LF6E 2EMLA 3OMLA 2BB8A 2M4IA 2R76A 1A1HA 5LLQA 4X64E 4O4KA 1X3CA 3BGHA 3ADLA 5A2QC 4NXNE 3J7AG 4LF7E 2HHHE 2UUCE 3VK6A 1HR0E 2VE7C 1YYKA 3UK3C 4DR6E 2UXCE 3J80C 2M9AA 2PRTA 4DR5E 4OX9E 2YU5A 4DR1E 2LUPB 2KONA 3ZOQB 1L4SA 1GTKA 2L2KB 1T39A 4F6MA 3ADJA 1HNXE 4ZYEA 1X5WA 2RQLA 5KL5A 2V86A 2EOSA 4JI2E 5LL6R 4BHCA 2L2NA 3IWBA 2EPZA 2LMZA 5A69A 1GQEA 2EM4A 2YTFA 3VHTB 4P7DA 4DV3E 2NA2A 2DMYA 1UN6B 4JI0E 1X6EA 3K6QA 4DV1E 2EPKX 2EOJA 5KL3A 1IBLE 2FGGA 2DLKA 2YTNA 2Q8UA 4WXDA 4M30A 2EOZA 4IJDA 5TSEA 3EPLA 1HNZE 2KOUA 4J8ZA 1SR9A 2DSYA 3JU0A 5A6JA 3HTXA 1SFEA 4TUIA
chains in the Genus database with same CATH topology
2WZOA 5FLXC 4LF5E 4LU9A 1IBME 4DUZE 1QU6A 1ZBQA 2V87A 2VF1A 3HPZA 5AE1A 5F3WA 1T4OA 4AQYE 4B3RE 2M1SA 2CPNA 4X8WA 1EKZA 4DR4E 2MC6A 1J26A 4JI7E 2VQEE 2ODRD 2V83A 2LTSA 4B3SE 4DR7E 4DV2E 4B3TE 5BR8E 2UXBE 4DV4E 2JOBA 4JI6E 1XNQE 2EWLA 4BMJA 2LBSB 1WXRA 2NUGA 4WSPA 2K4VA 1DI2A 4M2ZA 2LE2A 2F4VE 2V88A 3T1HE 2IHR1 2JVAA 3JAMC 1X47A 2L3JA 3C4BA 2KHXA 3VYYA 4JI8E 1STUA 2YT4A 4KZSA 4DV5E 3VYXA 5LMNE 3P1XA 2ODRC 3F6HA 4K0KE 2NUEA 4WYQB 3KWRA 2B3TB 4BC9A 3LLHA 5DNYA 1ZBTA 3HPSA 4BCAA 1PKPA 5AE3A 1WHNA 4LFCE 4LF9E 4P78A 2FTXB 5AE2A 3LMLA 4M0VA 3J81C 2UU9E 2RSMA 4B3ME 3FIGA 2EZ6A 4KHPE 4GKJE 1WHQA 3RMPA 2L2MA 2ZM6E 3IWDA 2N3GA 5ADZA 4BBYA 2LTRA 1T4LB 1FJGE 2JWOA 4LF6E 3OMLA 2L92A 2M7QA 4YY3E 2M4IA 2UUAE 4X64E 5T6JA 5AASA 4JI1E 3ADLA 5A2QC 2DIXA 2N3HA 3IWCA 3H09A 4NXNE 1YYWA 3J7AG 2DB2A 3F6GA 3J7Yp 2UUBE 4LF4E 2L3CA 4LF7E 1N36E 1I94E 2HHHE 1YYOA 2UUCE 3VK6A 5LMUE 1XMOE 2F8BA 4DV0E 1N33E 1UHZA 2E1MA 2LJHA 4DV6E 1HR0E 4JYAE 2VE7C 2LUQA 2B9DA 4BC7A 4YHHE 2G7HA 2JR1A 3JTZA 4L5NC 4X65E 2VQFE 4DR6E 5CFFE 4LF8E 2UXCE 4F54A 2JOXA 1HNWE 3C4TA 3J80C 2RTXA 2V89A 4DR5E 4OX9E 3ADGA 1O0WA 2B7TA 4DR1E 2H36X 2LUPB 2KONA 4NXME 4LFBE 3ZOQB 4X62E 4DUYE 2L2KB 3AUZA 2UXDE 2FV4B 2MDRA 4OOGC 3ADJA 1J5EE 1HNXE 4GEQB 4F9BB 1N34E 4JI3E 1YZ9A 2V86A 1YYKA 2L6MA 2L8TA 4DR3E 3AV0A 4I8OA 2RS7A 2L2NA 3IWBA 5LL6R 3DJWA 2NUFA 4JI2E 2LMZA 4F9CB 2LRSA 1GQEA 3ADIA 4BS9A 4L8NA 4P7DA 2L33A 4X66E 2NA2A 2DMYA 2RS6A 4DV3E 1XMQE 1XNRE 4DKKA 4JI5E 4JI0E 3K6QA 4DV1E 1T4NA 4Q28A 1N32E 1X49A 4LTYA 2B7VA 1IBLE 2MC5A 2E5LE 2FGGA 4R03A 1UILA 4M30A 1FKAE 3DF6A 4TUGA 4WFTA 1GZ6A 2YZTA 3HQ1A 4JV5E 4DV7E 1HNZE 5IWAE 2KOUA 3HXLA 3MSWA 1DQ3A 1IBKE 3OTOE 4J8ZA 4GKKE 1SR9A 4R8OA 5IT9C 4F9AB 2DSYA 4DMIA 4WPYA 3JU0A 4JI4E 2V85A 1X48A 3T1YE 4LFAE 2JY9A 4DR2E 3HTXA 1RC7A 2V8QB 1RQ0A 4TUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5T6J A;  4GEQ B;  2FTX B;  2FV4 B; 
#chains in the Genus database with same CATH topology
 1AAY A;  1ZBQ A;  2ENA A;  5F3W A;  2EN4 A;  1T4O A;  2EM0 A;  2CPN A;  2EM2 A;  2VQE E;  2V83 A;  2YSP A;  2UXB E;  1A1F A;  4ZYD A;  2JP9 A;  4RHB B;  2LBS B;  1IMU A;  2LO3 A;  4M2Z A;  2LCE A;  1WRJ A;  2YTE A;  2F4V E;  2IHR 1;  2ENH A;  3C4B A;  2D9H A;  2EPP A;  4DV5 E;  2DLQ A;  2NUE A;  2EQ1 A;  3KWR A;  1PKP A;  2EMA A;  1PJT A;  4LFC E;  2UU9 E;  4ZYH A;  2RSM A;  2L2M A;  4RH8 A;  4M9V C;  2N3G A;  1T4L B;  2EMH A;  3BID A;  1B69 A;  2EMK A;  5T6J A;  2YPN A;  5KL4 A;  1YUI A;  2MKD A;  1MEY C;  3H09 A;  4R2P A;  4LF4 E;  2UUB E;  2DRP A;  2YTO A;  1YFH A;  2EMZ A;  2ELZ A;  4DV6 E;  2EM5 A;  4JYA E;  1ZU1 A;  4YHH E;  5LMU E;  2EL6 A;  2JR1 A;  4L5N C;  4X9J A;  2EMW A;  4F54 A;  2GHF A;  2JOX A;  3C4T A;  4HEI A;  2V89 A;  2WBS A;  1N3G A;  3ADG A;  1O0W A;  1NEI A;  2YTP A;  5A6B A;  1P47 A;  2EMC A;  1EH6 A;  2EMY A;  2NUF A;  3AV0 A;  4I8O A;  2RS7 A;  2CSH A;  2LRS A;  1Z1B A;  4BS9 A;  4L8N A;  2L33 A;  2ENC A;  4R2S A;  2YSO A;  1X49 A;  3BBG A;  4MLV A;  2MKN A;  1EH8 A;  2EQ3 A;  2EL5 A;  3DF6 A;  1DGC A;  4WFT A;  3HQ1 A;  2YTQ A;  4DV7 E;  5IWA E;  3HXL A;  2EM6 A;  3MSW A;  2YTJ A;  2EOF A;  3OTO E;  4Q35 B;  4R8O A;  4DMI A;  1EH7 A;  2V85 A;  1WJP A;  1X48 A;  2EPL X;  2JY9 A;  2ZM6 E;  2YTI A;  5KL7 A;  4LFA E;  2CTD A;  2EM3 A;  5FLX C;  2V87 A;  2EP3 A;  2EM9 A;  5AE1 A;  4DR4 E;  2JPA A;  2M1S A;  4X8W A;  2MC6 A;  4B3S E;  2EL4 A;  4DV2 E;  4B3T E;  5BR8 E;  2JOB A;  3MHS C;  1A1G A;  1XNQ E;  2EWL A;  4O5G A;  2NUG A;  4GZN C;  1DI2 A;  1TF6 A;  2EPC A;  1PJS A;  1YSA C;  4WX9 A;  2EOH A;  2L3J A;  1YUJ A;  1STU A;  2YT4 A;  3VYX A;  4K0K E;  2EPN A;  2JXP A;  2ODR C;  4BCA A;  2EE8 A;  4WSG A;  2EMI A;  3M99 B;  2FTX B;  3J81 C;  2UXD E;  2EMG A;  4B3M E;  1RMD A;  2YRH A;  3FIG A;  4KHP E;  4GKJ E;  3RMP A;  1UBD C;  2EN1 A;  2LTR A;  2I9I A;  2EN7 A;  4YY3 E;  2UUA E;  4JI1 E;  3THN A;  2DIX A;  1A1I A;  2EOQ A;  1YYW A;  4WXC A;  3J7Y p;  5KL2 A;  5AC5 A;  1N36 E;  1I94 E;  2EOO A;  2JYA A;  1XMO E;  4DV0 E;  4KWY A;  2ADR A;  2B9D A;  2G7H A;  3JTZ A;  4R2D A;  1HNW E;  4O43 A;  1TF3 A;  2B7T A;  2H36 X;  4X62 E;  2K7I A;  2BBG A;  3THO B;  2FV4 B;  2MDR A;  2EPU A;  2GPI A;  1J5E E;  2EPR A;  4GEQ B;  1N34 E;  1IQS A;  1YZ9 A;  4NZV A;  2L6M A;  1BB8 A;  3DJW A;  4F9C B;  2EPM X;  2DGC A;  3ADI A;  4X66 E;  2RS6 A;  4DKK A;  2I13 A;  1T4N A;  1BBO A;  1N32 E;  2EM7 A;  1NCS A;  2B7V A;  2E5L E;  1IQO A;  3TQM A;  1X6H A;  5A6B D;  1UIL A;  2WBT A;  3KZZ A;  5KL6 A;  1GZ6 A;  2N8X A;  2YZT A;  2EPA A;  2YRM A;  2EM8 A;  5A6A A;  1DQ3 A;  1PDA A;  3C6K A;  4WPY A;  2EOM A;  3T1Y E;  1PJQ A;  4DR2 E;  1RC7 A;  4R2E A;  1RQ0 A;  4IS1 C;  4LF5 E;  4DUZ E;  3HPZ A;  1X6F A;  2VF1 A;  4MLQ A;  4R2A A;  1A1K A;  4AQY E;  4B3R E;  1J26 A;  3EPH A;  3MHH C;  2EMB A;  2HC5 A;  1JK2 A;  4JI6 E;  4BMJ A;  1WXR A;  4WSP A;  2K4V A;  2WBU A;  2LE2 A;  2V88 A;  1MGT A;  3T1H E;  4FK5 C;  2KHX A;  1ZR9 A;  3VYY A;  3QG5 C;  2YTD A;  4F2J C;  1LLM C;  4WYQ B;  2EMX A;  2B3T B;  4F6N A;  2EOI A;  2YTG A;  1WHN A;  4P78 A;  3LML A;  4R2Q A;  2J7J A;  1WHQ A;  2YRK A;  2R1F A;  4BBY A;  5ADZ A;  1FJG E;  2E72 A;  2L92 A;  2M7Q A;  2EQ0 A;  1F2I G;  5AAS A;  2N3H A;  3IWC A;  2DB2 A;  3F6G A;  2YU8 A;  2L3C A;  2MDG A;  4ZYG A;  2LVH A;  1YYO A;  2EOE A;  2EPX A;  2F8B A;  1N33 E;  1BBG A;  1UHZ A;  2E1M A;  2LJH A;  2LUQ A;  4BC7 A;  4X65 E;  2VQF E;  5CFF E;  4LF8 E;  1G2D C;  2RTX A;  2EOX A;  5IV8 B;  4NXM E;  4LFB E;  4DUY E;  3AUZ A;  4OOG C;  2EMF A;  4F9B B;  4JI3 E;  1KJK A;  5IXM B;  2NAB A;  2RSI A;  2L8T A;  4DR3 E;  1G2F C;  2WCC 3;  2YWQ A;  4NHR A;  1XMQ E;  1ZAA C;  1XNR E;  2EOR A;  5A6K A;  4JI5 E;  3BF2 A;  4Q28 A;  2LV2 A;  3EPK A;  4LTY A;  2MC5 A;  2HGH A;  4R03 A;  4R2C A;  1A1L A;  1FKA E;  2EN3 A;  4TUG A;  4JV5 E;  4N4R B;  3L00 A;  2ELY A;  1QNT A;  1IBK E;  2A25 A;  4GKK E;  1KYQ A;  2EN2 A;  5IT9 C;  2EOY A;  4F9A B;  4JI4 E;  4R2R A;  2V8Q B;  2EN8 A;  2WZO A;  2EJ4 A;  4LU9 A;  1IBM E;  2CT1 A;  1QU6 A;  2DMI A;  2LJU A;  1EKZ A;  5AC4 A;  1A1J A;  4BHB A;  4JI7 E;  2ODR D;  2LTS A;  4O24 A;  1JK1 A;  4DR7 E;  3EQ1 A;  4DV4 E;  3C6M A;  2GLI A;  2VRD A;  2RPC A;  3EPJ A;  2JVA A;  3JAM C;  1X47 A;  1YPN A;  1TN9 A;  4JI8 E;  4HTG A;  4KZS A;  3KZY A;  5LMN E;  3P1X A;  3F6H A;  4BC9 A;  1T38 A;  5DNY A;  3LLH A;  1ZBT A;  3HPS A;  2LT7 A;  5AE3 A;  1AH5 A;  4LF9 E;  5AE2 A;  2HJJ A;  4M0V A;  2EZ6 A;  3ECR A;  2EN6 A;  3IWD A;  2EPO A;  2JWO A;  4LF6 E;  2EML A;  3OML A;  2BB8 A;  2M4I A;  2R76 A;  1A1H A;  5LLQ A;  4X64 E;  4O4K A;  1X3C A;  3BGH A;  3ADL A;  5A2Q C;  4NXN E;  3J7A G;  4LF7 E;  2HHH E;  2UUC E;  3VK6 A;  1HR0 E;  2VE7 C;  1YYK A;  3UK3 C;  4DR6 E;  2UXC E;  3J80 C;  2M9A A;  2PRT A;  4DR5 E;  4OX9 E;  2YU5 A;  4DR1 E;  2LUP B;  2KON A;  3ZOQ B;  1L4S A;  1GTK A;  2L2K B;  1T39 A;  4F6M A;  3ADJ A;  1HNX E;  4ZYE A;  1X5W A;  2RQL A;  5KL5 A;  2V86 A;  2EOS A;  4JI2 E;  5LL6 R;  4BHC A;  2L2N A;  3IWB A;  2EPZ A;  2LMZ A;  5A69 A;  1GQE A;  2EM4 A;  2YTF A;  3VHT B;  4P7D A;  4DV3 E;  2NA2 A;  2DMY A;  1UN6 B;  4JI0 E;  1X6E A;  3K6Q A;  4DV1 E;  2EPK X;  2EOJ A;  5KL3 A;  1IBL E;  2FGG A;  2DLK A;  2YTN A;  2Q8U A;  4WXD A;  4M30 A;  2EOZ A;  4IJD A;  5TSE A;  3EPL A;  1HNZ E;  2KOU A;  4J8Z A;  1SR9 A;  2DSY A;  3JU0 A;  5A6J A;  3HTX A;  1SFE A;  4TUI A; 
#chains in the Genus database with same CATH homology
 2WZO A;  5FLX C;  4LF5 E;  4LU9 A;  1IBM E;  4DUZ E;  1QU6 A;  1ZBQ A;  2V87 A;  2VF1 A;  3HPZ A;  5AE1 A;  5F3W A;  1T4O A;  4AQY E;  4B3R E;  2M1S A;  2CPN A;  4X8W A;  1EKZ A;  4DR4 E;  2MC6 A;  1J26 A;  4JI7 E;  2VQE E;  2ODR D;  2V83 A;  2LTS A;  4B3S E;  4DR7 E;  4DV2 E;  4B3T E;  5BR8 E;  2UXB E;  4DV4 E;  2JOB A;  4JI6 E;  1XNQ E;  2EWL A;  4BMJ A;  2LBS B;  1WXR A;  2NUG A;  4WSP A;  2K4V A;  1DI2 A;  4M2Z A;  2LE2 A;  2F4V E;  2V88 A;  3T1H E;  2IHR 1;  2JVA A;  3JAM C;  1X47 A;  2L3J A;  3C4B A;  2KHX A;  3VYY A;  4JI8 E;  1STU A;  2YT4 A;  4KZS A;  4DV5 E;  3VYX A;  5LMN E;  3P1X A;  2ODR C;  3F6H A;  4K0K E;  2NUE A;  4WYQ B;  3KWR A;  2B3T B;  4BC9 A;  3LLH A;  5DNY A;  1ZBT A;  3HPS A;  4BCA A;  1PKP A;  5AE3 A;  1WHN A;  4LFC E;  4LF9 E;  4P78 A;  2FTX B;  5AE2 A;  3LML A;  4M0V A;  3J81 C;  2UU9 E;  2RSM A;  4B3M E;  3FIG A;  2EZ6 A;  4KHP E;  4GKJ E;  1WHQ A;  3RMP A;  2L2M A;  2ZM6 E;  3IWD A;  2N3G A;  5ADZ A;  4BBY A;  2LTR A;  1T4L B;  1FJG E;  2JWO A;  4LF6 E;  3OML A;  2L92 A;  2M7Q A;  4YY3 E;  2M4I A;  2UUA E;  4X64 E;  5T6J A;  5AAS A;  4JI1 E;  3ADL A;  5A2Q C;  2DIX A;  2N3H A;  3IWC A;  3H09 A;  4NXN E;  1YYW A;  3J7A G;  2DB2 A;  3F6G A;  3J7Y p;  2UUB E;  4LF4 E;  2L3C A;  4LF7 E;  1N36 E;  1I94 E;  2HHH E;  1YYO A;  2UUC E;  3VK6 A;  5LMU E;  1XMO E;  2F8B A;  4DV0 E;  1N33 E;  1UHZ A;  2E1M A;  2LJH A;  4DV6 E;  1HR0 E;  4JYA E;  2VE7 C;  2LUQ A;  2B9D A;  4BC7 A;  4YHH E;  2G7H A;  2JR1 A;  3JTZ A;  4L5N C;  4X65 E;  2VQF E;  4DR6 E;  5CFF E;  4LF8 E;  2UXC E;  4F54 A;  2JOX A;  1HNW E;  3C4T A;  3J80 C;  2RTX A;  2V89 A;  4DR5 E;  4OX9 E;  3ADG A;  1O0W A;  2B7T A;  4DR1 E;  2H36 X;  2LUP B;  2KON A;  4NXM E;  4LFB E;  3ZOQ B;  4X62 E;  4DUY E;  2L2K B;  3AUZ A;  2UXD E;  2FV4 B;  2MDR A;  4OOG C;  3ADJ A;  1J5E E;  1HNX E;  4GEQ B;  4F9B B;  1N34 E;  4JI3 E;  1YZ9 A;  2V86 A;  1YYK A;  2L6M A;  2L8T A;  4DR3 E;  3AV0 A;  4I8O A;  2RS7 A;  2L2N A;  3IWB A;  5LL6 R;  3DJW A;  2NUF A;  4JI2 E;  2LMZ A;  4F9C B;  2LRS A;  1GQE A;  3ADI A;  4BS9 A;  4L8N A;  4P7D A;  2L33 A;  4X66 E;  2NA2 A;  2DMY A;  2RS6 A;  4DV3 E;  1XMQ E;  1XNR E;  4DKK A;  4JI5 E;  4JI0 E;  3K6Q A;  4DV1 E;  1T4N A;  4Q28 A;  1N32 E;  1X49 A;  4LTY A;  2B7V A;  1IBL E;  2MC5 A;  2E5L E;  2FGG A;  4R03 A;  1UIL A;  4M30 A;  1FKA E;  3DF6 A;  4TUG A;  4WFT A;  1GZ6 A;  2YZT A;  3HQ1 A;  4JV5 E;  4DV7 E;  1HNZ E;  5IWA E;  2KOU A;  3HXL A;  3MSW A;  1DQ3 A;  1IBK E;  3OTO E;  4J8Z A;  4GKK E;  1SR9 A;  4R8O A;  5IT9 C;  4F9A B;  2DSY A;  4DMI A;  4WPY A;  3JU0 A;  4JI4 E;  2V85 A;  1X48 A;  3T1Y E;  4LFA E;  2JY9 A;  4DR2 E;  3HTX A;  1RC7 A;  2V8Q B;  1RQ0 A;  4TUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...