5T6JA

Structure of the mind complex shows a regulatory focus of yeast kinetochore assembly
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
59
structure length
59
Chain Sequence
ANENILKLKLYRSLGVILDLENDQVLINRKNDGNIDILPLDNNLSDFYKTKYIWERLGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords Kinetochore protein SPC24
publication title Structure of the MIND Complex Defines a Regulatory Focus for Yeast Kinetochore Assembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 15
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2016-09-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.430 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5t6jA00
4GEQB 2FTXB 2FV4B 5T6JA
chains in the Genus database with same CATH superfamily
2L2MA 2N8XA 2EM9A 4TUGA 4JI5E 2LUQA 2YU5A 3BGHA 4K0KE 2HJJA 2EMHA 2EN6A 2YTJA 2M4IA 4MLVA 2YRHA 2L6MA 5AC4A 2JOXA 2JXPA 4LU9A 2YTIA 1N3GA 1A1GA 1YZ9A 2B7VA 2VRDA 3DJWA 2RSIA 3BIDA 4X64E 4BC9A 5AE3A 4YY3E 4M9VC 1PJTA 1BB8A 2K7IA 2EMIA 2VF1A 1AH5A 3ADIA 4J8ZA 2D9HA 2L3CA 1HNWE 4LF7E 1A1HA 3ZOQB 1PJQA 5IXMB 2M7QA 1YPNA 2BB8A 2UU9E 2RS6A 5IT9C 3JU0A 5KL4A 3MHSC 1XMQE 2LMZA 1G2DC 3L00A 2EPUA 5ADZA 2DLKA 3JAMC 4DV6E 4ZYHA 4B3TE 4O43A 4B3SE 2YT4A 2A25A 2FGGA 3HQ1A 5A6BA 2BBGA 4ZYDA 2EN4A 1L4SA 4WXDA 4TUIA 2EPPA 2ENAA 4BS9A 1A1FA 3VK6A 4LF5E 2MDGA 4DV5E 2EWLA 2EP3A 1PJSA 2EQ1A 2EM0A 4ZYEA 4R2QA 2LBSB 2EOEA 4HTGA 2EN1A 2WBUA 2M9AA 2V8QB 4B3ME 4LFBE 2LE2A 1IQSA 1N32E 1X6EA 4R2RA 1ZAAC 1XNQE 1PKPA 1WHQA 4WX9A 1B69A 3HTXA 5KL6A 3C6KA 1TF6A 1X5WA 1FKAE 2ELYA 4P7DA 5KL5A 2EOMA 2ODRC 2YTNA 3EPLA 1FJGE 2LTSA 3HXLA 4RH8A 2V83A 4WXCA 4WSPA 2EM4A 1GZ6A 2YPNA 4WPYA 1T39A 2EMCA 2EPLX 4OOGC 4JI0E 2EJ4A 1HR0E 1T4OA 1NEIA 2EM5A 2FTXB 1TN9A 5AE2A 3UK3C 5LLQA 2EN8A 2WCC3 4ZYGA 1IBKE 2HHHE 4GZNC 1J5EE 2YRMA 4R2PA 3T1HE 3KWRA 2JOBA 5AASA 2B3TB 4WFTA 4DUYE 3EPJA 4JV5E 3J80C 2YTEA 5A6AA 1P47A 4F2JC 2EN7A 1X3CA 2YTGA 1GTKA 5FLXC 3EQ1A 2EM3A 5KL2A 4BC7A 3C6MA 2B7TA 2YRKA 2EOIA 2LVHA 2LUPB 3K6QA 4JI1E 2UXDE 2EPXA 5A2QC 1XMOE 4JI6E 2NUGA 2RSMA 1A1IA 2MKNA 2CTDA 2UXCE 2R1FA 2JPAA 2EMZA 2ADRA 2Q8UA 5A6JA 4L8NA 4X65E 2HC5A 1IQOA 2EMYA 1IMUA 3J7AG 4KHPE 3P1XA 2V88A 1KJKA 2DMYA 2EM6A 3ADGA 5CFFE 2EM7A 2EN3A 4M2ZA 1AAYA 3MSWA 5IWAE 2KOUA 2DGCA 4RHBB 3BF2A 1YYWA 1EH7A 4NXNE 2LJUA 2DIXA 2JY9A 2V87A 1UILA 2RS7A 2EOXA 2RTXA 2JYAA 2NA2A 3ECRA 4WYQB 4NHRA 3KZZA 1STUA 5LL6R 5KL7A 4JI4E 2V89A 4LTYA 5IV8B 4IS1C 3M99B 5DNYA 4DV2E 2I13A 2UUBE 4BHBA 3C4TA 2YSOA 4P78A 2E5LE 2NABA 2EL6A 2JVAA 5KL3A 5F3WA 4LF9E 3LMLA 3H09A 1YUIA 4R2DA 2EOFA 2V86A 4DV7E 1EH8A 1QU6A 4MLQA 1X48A 1A1JA 5A6KA 1GQEA 2LRSA 1WJPA 1ZR9A 2EMFA 2ENHA 1RC7A 1IBME 4FK5C 1HNXE 4LFCE 4GKKE 1N34E 1ZBQA 1O0WA 4JYAE 2F4VE 3TQMA 2EL4A 1YSAC 1I94E 2M1SA 2UXBE 4BMJA 2YTQA 5AE1A 5BR8E 4R2CA 4DUZE 2H36X 2EPOA 3OTOE 2MDRA 5T6JA 4O5GA 2L8TA 1RQ0A 2EPZA 4KWYA 4O4KA 2EPRA 4R2SA 1ZBTA 1WHNA 1XNRE 4O24A 2CSHA 2DLQA 1T4LB 4N4RB 1X49A 2GPIA 1EH6A 2EM8A 4KZSA 2EOZA 2DMIA 1ZU1A 2K4VA 4GEQB 4Q28A 1T4NA 4X8WA 1DQ3A 2WBSA 2LT7A 2J7JA 2DSYA 5A69A 2ENCA 4F9AB 2LO3A 2CT1A 4L5NC 2EPAA 2EMGA 2EPNA 2MKDA 2FV4B 4BBYA 2DRPA 4JI2E 2EL5A 3THOB 1RMDA 2YZTA 1EKZA 2GHFA 2VQEE 1NCSA 4JI3E 2NUEA 5TSEA 2E72A 2F8BA 2MC5A 2UUCE 2YU8A 2EPKX 3ADJA 1UHZA 4DR5E 2JP9A 4DV1E 2HGHA 3J7Yp 3AUZA 4DR6E 2EZ6A 2L2KB 1WRJA 3THNA 2MC6A 4OX9E 1UBDC 2E1MA 2G7HA 2EMLA 2EOQA 3JTZA 1WXRA 3DF6A 1MGTA 4R2AA 2LTRA 4DKKA 2I9IA 2EOOA 4DR4E 1QNTA 1IBLE 3VYXA 1LLMC 2EORA 5LMUE 1JK2A 1KYQA 3EPHA 2EPMX 5LMNE 4DR3E 4YHHE 2EOHA 1YYOA 2YTFA 3OMLA 2YTPA 4M30A 2LV2A 3F6GA 4AQYE 4R2EA 4LFAE 2EQ0A 1N36E 1T38A 4M0VA 2WZOA 3EPKA 4R8OA 4LF4E 1X6HA 2N3HA 4DR2E 2CPNA 2EOYA 1BBOA 2L2NA 3J81C 2EOSA 3HPZA 3IWBA 4I8OA 1DI2A 2YWQA 2DB2A 2V85A 4GKJE 2L3JA 2EMWA 2EMAA 2JR1A 3AV0A 1UN6B 3VHTB 2RQLA 4NZVA 2LCEA 2YTDA 4B3RE 1DGCA 3IWCA 4HEIA 2L92A 3C4BA 4F9BB 4F6NA 4BHCA 2ZM6E 2L33A 5AC5A 4JI8E 4DMIA 2RPCA 4IJDA 2N3GA 1YFHA 5A6BD 2IHR1 4JI7E 2UUAE 2EMBA 3ADLA 2ELZA 4R03A 3QG5C 2NUFA 4F54A 2B9DA 2JWOA 2KHXA 1G2FC 1SR9A 3KZYA 3MHHC 4DV3E 1PDAA 4NXME 4WSGA 1Z1BA 2WBTA 4Q35B 1X47A 2EE8A 1JK1A 2YSPA 2EMKA 2LJHA 2EOJA 2R76A 2VE7C 1MEYC 2EMXA 3VYYA 4LF6E 2GLIA 2VQFE 1A1KA 4DR7E 2EN2A 3HPSA 2YTOA 3BBGA 1J26A 2EQ3A 1X6FA 3T1YE 2ODRD 1N33E 4DR1E 1BBGA 1YUJA 3F6HA 2PRTA 2KONA 4X66E 1YYKA 2EM2A 1TF3A 1A1LA 4LF8E 1F2IG 3RMPA 4X9JA 4DV4E 1SFEA 4DV0E 4X62E 2EPCA 4BCAA 3LLHA 4F6MA 1HNZE 4F9CB 3IWDA 3FIGA
chains in the Genus database with same CATH topology
2L2MA 4M30A 4TUGA 4JI5E 1GQEA 3F6GA 2LUQA 4AQYE 2LRSA 4WPYA 4LFAE 1RC7A 1IBME 1N36E 4GKKE 1HNXE 4M0VA 4LFCE 2WZOA 4K0KE 1N34E 1ZBQA 4OOGC 4JI0E 1O0WA 4JYAE 4R8OA 4LF4E 2M4IA 1HR0E 2N3HA 4DR2E 1T4OA 2F4VE 2CPNA 2L6MA 2L2NA 3J81C 1I94E 3HPZA 2M1SA 2FTXB 3IWBA 2JOXA 4I8OA 1DI2A 4BMJA 5AE1A 2UXBE 5BR8E 5AE2A 4DUZE 2H36X 4LU9A 2DB2A 3OTOE 2MDRA 2V85A 1IBKE 5T6JA 4GKJE 2HHHE 2L3JA 2L8TA 1RQ0A 1J5EE 3T1HE 2JR1A 3AV0A 3KWRA 1YZ9A 2B7VA 2JOBA 5AASA 2B3TB 1WHNA 1ZBTA 3DJWA 4WFTA 4X64E 4DUYE 4JV5E 4BC9A 5AE3A 4YY3E 3J80C 1XNRE 4B3RE 3IWCA 2VF1A 2L92A 3C4BA 4F9BB 1T4LB 3ADIA 1X49A 5FLXC 4J8ZA 4KZSA 4BC7A 2ZM6E 2L3CA 1HNWE 4LF7E 2B7TA 3ZOQB 2L33A 2K4VA 4GEQB 4Q28A 2M7QA 4JI8E 4DMIA 2UU9E 1T4NA 2RS6A 4X8WA 1DQ3A 3K6QA 2LUPB 5IT9C 3JU0A 4JI1E 2N3GA 2UXDE 2DSYA 1XMQE 2IHR1 5A2QC 1XMOE 4F9AB 2LMZA 2RSMA 4JI7E 4JI6E 2UUAE 2NUGA 5ADZA 4L5NC 3JAMC 4DV6E 2UXCE 4B3TE 3ADLA 4R03A 4B3SE 2YT4A 2NUFA 4X65E 4L8NA 2FGGA 3HQ1A 4F54A 2FV4B 4BBYA 2B9DA 2JWOA 2KHXA 1FJGE 3J7AG 4JI2E 4KHPE 1SR9A 4TUIA 3P1XA 2V88A 3FIGA 4BS9A 4DV3E 2YZTA 1EKZA 4NXME 3VK6A 2VQEE 2DMYA 5CFFE 3ADGA 4JI3E 4LF5E 2NUEA 4DV5E 1X47A 2F8BA 2MC5A 4M2ZA 2EWLA 2UUCE 3MSWA 2LJHA 3ADJA 1UHZA 2VE7C 5IWAE 2KOUA 3VYYA 2LBSB 4LF6E 4DR5E 2VQFE 1YYWA 4DV1E 4DR7E 2V8QB 3J7Yp 3HPSA 3AUZA 4B3ME 4NXNE 4LFBE 2JY9A 2DIXA 2LE2A 2V87A 1N32E 1UILA 4DR6E 2RS7A 1J26A 2RTXA 2EZ6A 1XNQE 2L2KB 1PKPA 2NA2A 2MC6A 4OX9E 1WHQA 3T1YE 2ODRD 2E1MA 4WYQB 1N33E 1STUA 2G7HA 3JTZA 5LL6R 1WXRA 4DR1E 4JI4E 2V89A 3DF6A 4LTYA 3HTXA 2LTRA 3F6HA 4DKKA 2KONA 5DNYA 4X66E 4DV2E 2UUBE 1YYKA 1FKAE 3C4TA 4P78A 2E5LE 4P7DA 4LF8E 4DR4E 1IBLE 3VYXA 3RMPA 4DV4E 5LMUE 2JVAA 5F3WA 4LF9E 2ODRC 5LMNE 4DV0E 3LMLA 4X62E 4YHHE 3H09A 4DR3E 2LTSA 2V86A 3HXLA 4BCAA 2V83A 3LLHA 1QU6A 4WSPA 4DV7E 1YYOA 1HNZE 1X48A 4F9CB 3IWDA 1GZ6A 3OMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GEQ B;  2FTX B;  2FV4 B;  5T6J A; 
#chains in the Genus database with same CATH topology
 2L2M A;  2N8X A;  2EM9 A;  4TUG A;  4JI5 E;  2LUQ A;  2YU5 A;  3BGH A;  4K0K E;  2HJJ A;  2EMH A;  2EN6 A;  2YTJ A;  2M4I A;  4MLV A;  2YRH A;  2L6M A;  5AC4 A;  2JOX A;  2JXP A;  4LU9 A;  2YTI A;  1N3G A;  1A1G A;  1YZ9 A;  2B7V A;  2VRD A;  3DJW A;  2RSI A;  3BID A;  4X64 E;  4BC9 A;  5AE3 A;  4YY3 E;  4M9V C;  1PJT A;  1BB8 A;  2K7I A;  2EMI A;  2VF1 A;  1AH5 A;  3ADI A;  4J8Z A;  2D9H A;  2L3C A;  1HNW E;  4LF7 E;  1A1H A;  3ZOQ B;  1PJQ A;  5IXM B;  2M7Q A;  1YPN A;  2BB8 A;  2UU9 E;  2RS6 A;  5IT9 C;  3JU0 A;  5KL4 A;  3MHS C;  1XMQ E;  2LMZ A;  1G2D C;  3L00 A;  2EPU A;  5ADZ A;  2DLK A;  3JAM C;  4DV6 E;  4ZYH A;  4B3T E;  4O43 A;  4B3S E;  2YT4 A;  2A25 A;  2FGG A;  3HQ1 A;  5A6B A;  2BBG A;  4ZYD A;  2EN4 A;  1L4S A;  4WXD A;  4TUI A;  2EPP A;  2ENA A;  4BS9 A;  1A1F A;  3VK6 A;  4LF5 E;  2MDG A;  4DV5 E;  2EWL A;  2EP3 A;  1PJS A;  2EQ1 A;  2EM0 A;  4ZYE A;  4R2Q A;  2LBS B;  2EOE A;  4HTG A;  2EN1 A;  2WBU A;  2M9A A;  2V8Q B;  4B3M E;  4LFB E;  2LE2 A;  1IQS A;  1N32 E;  1X6E A;  4R2R A;  1ZAA C;  1XNQ E;  1PKP A;  1WHQ A;  4WX9 A;  1B69 A;  3HTX A;  5KL6 A;  3C6K A;  1TF6 A;  1X5W A;  1FKA E;  2ELY A;  4P7D A;  5KL5 A;  2EOM A;  2ODR C;  2YTN A;  3EPL A;  1FJG E;  2LTS A;  3HXL A;  4RH8 A;  2V83 A;  4WXC A;  4WSP A;  2EM4 A;  1GZ6 A;  2YPN A;  4WPY A;  1T39 A;  2EMC A;  2EPL X;  4OOG C;  4JI0 E;  2EJ4 A;  1HR0 E;  1T4O A;  1NEI A;  2EM5 A;  2FTX B;  1TN9 A;  5AE2 A;  3UK3 C;  5LLQ A;  2EN8 A;  2WCC 3;  4ZYG A;  1IBK E;  2HHH E;  4GZN C;  1J5E E;  2YRM A;  4R2P A;  3T1H E;  3KWR A;  2JOB A;  5AAS A;  2B3T B;  4WFT A;  4DUY E;  3EPJ A;  4JV5 E;  3J80 C;  2YTE A;  5A6A A;  1P47 A;  4F2J C;  2EN7 A;  1X3C A;  2YTG A;  1GTK A;  5FLX C;  3EQ1 A;  2EM3 A;  5KL2 A;  4BC7 A;  3C6M A;  2B7T A;  2YRK A;  2EOI A;  2LVH A;  2LUP B;  3K6Q A;  4JI1 E;  2UXD E;  2EPX A;  5A2Q C;  1XMO E;  4JI6 E;  2NUG A;  2RSM A;  1A1I A;  2MKN A;  2CTD A;  2UXC E;  2R1F A;  2JPA A;  2EMZ A;  2ADR A;  2Q8U A;  5A6J A;  4L8N A;  4X65 E;  2HC5 A;  1IQO A;  2EMY A;  1IMU A;  3J7A G;  4KHP E;  3P1X A;  2V88 A;  1KJK A;  2DMY A;  2EM6 A;  3ADG A;  5CFF E;  2EM7 A;  2EN3 A;  4M2Z A;  1AAY A;  3MSW A;  5IWA E;  2KOU A;  2DGC A;  4RHB B;  3BF2 A;  1YYW A;  1EH7 A;  4NXN E;  2LJU A;  2DIX A;  2JY9 A;  2V87 A;  1UIL A;  2RS7 A;  2EOX A;  2RTX A;  2JYA A;  2NA2 A;  3ECR A;  4WYQ B;  4NHR A;  3KZZ A;  1STU A;  5LL6 R;  5KL7 A;  4JI4 E;  2V89 A;  4LTY A;  5IV8 B;  4IS1 C;  3M99 B;  5DNY A;  4DV2 E;  2I13 A;  2UUB E;  4BHB A;  3C4T A;  2YSO A;  4P78 A;  2E5L E;  2NAB A;  2EL6 A;  2JVA A;  5KL3 A;  5F3W A;  4LF9 E;  3LML A;  3H09 A;  1YUI A;  4R2D A;  2EOF A;  2V86 A;  4DV7 E;  1EH8 A;  1QU6 A;  4MLQ A;  1X48 A;  1A1J A;  5A6K A;  1GQE A;  2LRS A;  1WJP A;  1ZR9 A;  2EMF A;  2ENH A;  1RC7 A;  1IBM E;  4FK5 C;  1HNX E;  4LFC E;  4GKK E;  1N34 E;  1ZBQ A;  1O0W A;  4JYA E;  2F4V E;  3TQM A;  2EL4 A;  1YSA C;  1I94 E;  2M1S A;  2UXB E;  4BMJ A;  2YTQ A;  5AE1 A;  5BR8 E;  4R2C A;  4DUZ E;  2H36 X;  2EPO A;  3OTO E;  2MDR A;  5T6J A;  4O5G A;  2L8T A;  1RQ0 A;  2EPZ A;  4KWY A;  4O4K A;  2EPR A;  4R2S A;  1ZBT A;  1WHN A;  1XNR E;  4O24 A;  2CSH A;  2DLQ A;  1T4L B;  4N4R B;  1X49 A;  2GPI A;  1EH6 A;  2EM8 A;  4KZS A;  2EOZ A;  2DMI A;  1ZU1 A;  2K4V A;  4GEQ B;  4Q28 A;  1T4N A;  4X8W A;  1DQ3 A;  2WBS A;  2LT7 A;  2J7J A;  2DSY A;  5A69 A;  2ENC A;  4F9A B;  2LO3 A;  2CT1 A;  4L5N C;  2EPA A;  2EMG A;  2EPN A;  2MKD A;  2FV4 B;  4BBY A;  2DRP A;  4JI2 E;  2EL5 A;  3THO B;  1RMD A;  2YZT A;  1EKZ A;  2GHF A;  2VQE E;  1NCS A;  4JI3 E;  2NUE A;  5TSE A;  2E72 A;  2F8B A;  2MC5 A;  2UUC E;  2YU8 A;  2EPK X;  3ADJ A;  1UHZ A;  4DR5 E;  2JP9 A;  4DV1 E;  2HGH A;  3J7Y p;  3AUZ A;  4DR6 E;  2EZ6 A;  2L2K B;  1WRJ A;  3THN A;  2MC6 A;  4OX9 E;  1UBD C;  2E1M A;  2G7H A;  2EML A;  2EOQ A;  3JTZ A;  1WXR A;  3DF6 A;  1MGT A;  4R2A A;  2LTR A;  4DKK A;  2I9I A;  2EOO A;  4DR4 E;  1QNT A;  1IBL E;  3VYX A;  1LLM C;  2EOR A;  5LMU E;  1JK2 A;  1KYQ A;  3EPH A;  2EPM X;  5LMN E;  4DR3 E;  4YHH E;  2EOH A;  1YYO A;  2YTF A;  3OML A;  2YTP A;  4M30 A;  2LV2 A;  3F6G A;  4AQY E;  4R2E A;  4LFA E;  2EQ0 A;  1N36 E;  1T38 A;  4M0V A;  2WZO A;  3EPK A;  4R8O A;  4LF4 E;  1X6H A;  2N3H A;  4DR2 E;  2CPN A;  2EOY A;  1BBO A;  2L2N A;  3J81 C;  2EOS A;  3HPZ A;  3IWB A;  4I8O A;  1DI2 A;  2YWQ A;  2DB2 A;  2V85 A;  4GKJ E;  2L3J A;  2EMW A;  2EMA A;  2JR1 A;  3AV0 A;  1UN6 B;  3VHT B;  2RQL A;  4NZV A;  2LCE A;  2YTD A;  4B3R E;  1DGC A;  3IWC A;  4HEI A;  2L92 A;  3C4B A;  4F9B B;  4F6N A;  4BHC A;  2ZM6 E;  2L33 A;  5AC5 A;  4JI8 E;  4DMI A;  2RPC A;  4IJD A;  2N3G A;  1YFH A;  5A6B D;  2IHR 1;  4JI7 E;  2UUA E;  2EMB A;  3ADL A;  2ELZ A;  4R03 A;  3QG5 C;  2NUF A;  4F54 A;  2B9D A;  2JWO A;  2KHX A;  1G2F C;  1SR9 A;  3KZY A;  3MHH C;  4DV3 E;  1PDA A;  4NXM E;  4WSG A;  1Z1B A;  2WBT A;  4Q35 B;  1X47 A;  2EE8 A;  1JK1 A;  2YSP A;  2EMK A;  2LJH A;  2EOJ A;  2R76 A;  2VE7 C;  1MEY C;  2EMX A;  3VYY A;  4LF6 E;  2GLI A;  2VQF E;  1A1K A;  4DR7 E;  2EN2 A;  3HPS A;  2YTO A;  3BBG A;  1J26 A;  2EQ3 A;  1X6F A;  3T1Y E;  2ODR D;  1N33 E;  4DR1 E;  1BBG A;  1YUJ A;  3F6H A;  2PRT A;  2KON A;  4X66 E;  1YYK A;  2EM2 A;  1TF3 A;  1A1L A;  4LF8 E;  1F2I G;  3RMP A;  4X9J A;  4DV4 E;  1SFE A;  4DV0 E;  4X62 E;  2EPC A;  4BCA A;  3LLH A;  4F6M A;  1HNZ E;  4F9C B;  3IWD A;  3FIG A; 
#chains in the Genus database with same CATH homology
 2L2M A;  4M30 A;  4TUG A;  4JI5 E;  1GQE A;  3F6G A;  2LUQ A;  4AQY E;  2LRS A;  4WPY A;  4LFA E;  1RC7 A;  1IBM E;  1N36 E;  4GKK E;  1HNX E;  4M0V A;  4LFC E;  2WZO A;  4K0K E;  1N34 E;  1ZBQ A;  4OOG C;  4JI0 E;  1O0W A;  4JYA E;  4R8O A;  4LF4 E;  2M4I A;  1HR0 E;  2N3H A;  4DR2 E;  1T4O A;  2F4V E;  2CPN A;  2L6M A;  2L2N A;  3J81 C;  1I94 E;  3HPZ A;  2M1S A;  2FTX B;  3IWB A;  2JOX A;  4I8O A;  1DI2 A;  4BMJ A;  5AE1 A;  2UXB E;  5BR8 E;  5AE2 A;  4DUZ E;  2H36 X;  4LU9 A;  2DB2 A;  3OTO E;  2MDR A;  2V85 A;  1IBK E;  5T6J A;  4GKJ E;  2HHH E;  2L3J A;  2L8T A;  1RQ0 A;  1J5E E;  3T1H E;  2JR1 A;  3AV0 A;  3KWR A;  1YZ9 A;  2B7V A;  2JOB A;  5AAS A;  2B3T B;  1WHN A;  1ZBT A;  3DJW A;  4WFT A;  4X64 E;  4DUY E;  4JV5 E;  4BC9 A;  5AE3 A;  4YY3 E;  3J80 C;  1XNR E;  4B3R E;  3IWC A;  2VF1 A;  2L92 A;  3C4B A;  4F9B B;  1T4L B;  3ADI A;  1X49 A;  5FLX C;  4J8Z A;  4KZS A;  4BC7 A;  2ZM6 E;  2L3C A;  1HNW E;  4LF7 E;  2B7T A;  3ZOQ B;  2L33 A;  2K4V A;  4GEQ B;  4Q28 A;  2M7Q A;  4JI8 E;  4DMI A;  2UU9 E;  1T4N A;  2RS6 A;  4X8W A;  1DQ3 A;  3K6Q A;  2LUP B;  5IT9 C;  3JU0 A;  4JI1 E;  2N3G A;  2UXD E;  2DSY A;  1XMQ E;  2IHR 1;  5A2Q C;  1XMO E;  4F9A B;  2LMZ A;  2RSM A;  4JI7 E;  4JI6 E;  2UUA E;  2NUG A;  5ADZ A;  4L5N C;  3JAM C;  4DV6 E;  2UXC E;  4B3T E;  3ADL A;  4R03 A;  4B3S E;  2YT4 A;  2NUF A;  4X65 E;  4L8N A;  2FGG A;  3HQ1 A;  4F54 A;  2FV4 B;  4BBY A;  2B9D A;  2JWO A;  2KHX A;  1FJG E;  3J7A G;  4JI2 E;  4KHP E;  1SR9 A;  4TUI A;  3P1X A;  2V88 A;  3FIG A;  4BS9 A;  4DV3 E;  2YZT A;  1EKZ A;  4NXM E;  3VK6 A;  2VQE E;  2DMY A;  5CFF E;  3ADG A;  4JI3 E;  4LF5 E;  2NUE A;  4DV5 E;  1X47 A;  2F8B A;  2MC5 A;  4M2Z A;  2EWL A;  2UUC E;  3MSW A;  2LJH A;  3ADJ A;  1UHZ A;  2VE7 C;  5IWA E;  2KOU A;  3VYY A;  2LBS B;  4LF6 E;  4DR5 E;  2VQF E;  1YYW A;  4DV1 E;  4DR7 E;  2V8Q B;  3J7Y p;  3HPS A;  3AUZ A;  4B3M E;  4NXN E;  4LFB E;  2JY9 A;  2DIX A;  2LE2 A;  2V87 A;  1N32 E;  1UIL A;  4DR6 E;  2RS7 A;  1J26 A;  2RTX A;  2EZ6 A;  1XNQ E;  2L2K B;  1PKP A;  2NA2 A;  2MC6 A;  4OX9 E;  1WHQ A;  3T1Y E;  2ODR D;  2E1M A;  4WYQ B;  1N33 E;  1STU A;  2G7H A;  3JTZ A;  5LL6 R;  1WXR A;  4DR1 E;  4JI4 E;  2V89 A;  3DF6 A;  4LTY A;  3HTX A;  2LTR A;  3F6H A;  4DKK A;  2KON A;  5DNY A;  4X66 E;  4DV2 E;  2UUB E;  1YYK A;  1FKA E;  3C4T A;  4P78 A;  2E5L E;  4P7D A;  4LF8 E;  4DR4 E;  1IBL E;  3VYX A;  3RMP A;  4DV4 E;  5LMU E;  2JVA A;  5F3W A;  4LF9 E;  2ODR C;  5LMN E;  4DV0 E;  3LML A;  4X62 E;  4YHH E;  3H09 A;  4DR3 E;  2LTS A;  2V86 A;  3HXL A;  4BCA A;  2V83 A;  3LLH A;  1QU6 A;  4WSP A;  4DV7 E;  1YYO A;  1HNZ E;  1X48 A;  4F9C B;  3IWD A;  1GZ6 A;  3OML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...