5T6JA

Structure of the mind complex shows a regulatory focus of yeast kinetochore assembly
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
59
structure length
59
Chain Sequence
ANENILKLKLYRSLGVILDLENDQVLINRKNDGNIDILPLDNNLSDFYKTKYIWERLGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the MIND Complex Defines a Regulatory Focus for Yeast Kinetochore Assembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Cell cycle
molecule keywords Kinetochore protein SPC24
total genus 15
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2016-09-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.430 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5t6jA00
2FTXB 2FV4B 4GEQB 5T6JA
chains in the Genus database with same CATH superfamily
4LF4E 4O24A 2EM3A 3BF2A 3VYYA 2EOJA 2K7IA 3ADGA 2L2KB 5T6JA 2B7VA 1PJTA 2N3GA 2K4VA 2YSOA 2EMHA 2V89A 1AAYA 4HTGA 2EN1A 5F3WA 1T39A 2HGHA 2EN8A 1AH5A 1A1GA 2JYAA 2HHHE 5TSEA 4JI7E 3ECRA 4KWYA 2EN4A 4WXCA 2EQ3A 4BC7A 4LTYA 1QU6A 1PDAA 2B3TB 4M30A 2EPZA 2L92A 4F9AB 4DR2E 3KZYA 4ZYDA 1A1JA 4NXME 2ENHA 4R2DA 4DMIA 4ZYGA 1YZ9A 1YPNA 1IBME 1DQ3A 2EMWA 2EPCA 1Z1BA 2EWLA 1FJGE 2V83A 2L33A 4LF7E 2VRDA 4F9BB 2RTXA 1IBLE 3DJWA 3JTZA 1X3CA 2EMXA 4DUZE 5KL6A 4DV3E 2YTPA 2EM5A 3F6HA 4JI1E 1T4NA 3T1YE 2V8QB 1BBGA 2LUQA 4DR6E 3P1XA 2PRTA 4HEIA 2JR1A 2UXBE 1HR0E 5BR8E 2V88A 4DR4E 3HXLA 4DV1E 2ENAA 3ADLA 3HTXA 4JYAE 1X49A 4R8OA 2EOFA 3J81C 4R2CA 4DV2E 2YWQA 2EMFA 2EMIA 4P78A 3BIDA 4DV5E 2G7HA 2EN2A 3H09A 2EE8A 2V86A 3HPZA 1IQOA 2EM9A 3QG5C 2EOMA 2MDRA 2YTQA 5AE1A 4GKJE 2M1SA 4M2ZA 4NZVA 3HQ1A 4DR5E 4R2QA 2EOIA 4BHBA 4TUIA 4LF6E 2M4IA 1YFHA 4BBYA 2EMKA 2EPAA 5IXMB 4M9VC 2YTEA 1T4OA 2JY9A 2EOQA 2WCC3 1HNWE 2EPUA 1JK1A 1PKPA 3VK6A 2ADRA 2EMCA 3C6MA 2ENCA 2YTJA 2A25A 2JOBA 4ZYEA 3IWCA 3AV0A 3ZOQB 2EPPA 2CT1A 3JAMC 2YTOA 3K6QA 2UUAE 4X64E 1UILA 5KL5A 1X6EA 1I94E 4KHPE 2BBGA 4J8ZA 4JI4E 4GKKE 1KJKA 2EMYA 2EN7A 3KZZA 2YPNA 1X5WA 2EL6A 2EM4A 4F6MA 1ZAAC 2FGGA 5LL6R 1A1LA 3TQMA 2EPMX 3EQ1A 4DV4E 3IWDA 4DKKA 3MHHC 1RMDA 1J26A 2EPOA 1YYWA 2M9AA 2YT4A 2E1MA 2L2MA 2N8XA 4F6NA 5AE3A 2LV2A 1SFEA 1RC7A 2IHR1 1KYQA 4F54A 5KL2A 4JI0E 2RSMA 2F4VE 2GHFA 5ADZA 2LE2A 2YU8A 1J5EE 1WRJA 3ADJA 1N3GA 2JWOA 2EORA 2RPCA 1F2IG 4M0VA 4LF5E 3IWBA 4BS9A 4AQYE 4YHHE 1DI2A 1IMUA 3C6KA 4R2RA 3KWRA 4JI5E 3OTOE 3EPKA 2E5LE 1IBKE 1WHNA 1YYKA 2I13A 4X9JA 2EN6A 1YUJA 4DR3E 2EOOA 4L5NC 4JI3E 2HJJA 3RMPA 2DMYA 2VF1A 5A2QC 1YSAC 1EH6A 2M7QA 2NA2A 4OOGC 2JOXA 2EP3A 1ZR9A 4JV5E 2EZ6A 4BHCA 5IT9C 1JK2A 4GEQB 2EOZA 2YTIA 1PJQA 5DNYA 2YSPA 4RHBB 2JP9A 2CTDA 2JVAA 2B7TA 4WXDA 4WPYA 1T4LB 2L3JA 3JU0A 4DUYE 1TN9A 2KHXA 4B3SE 2KOUA 3LLHA 1HNXE 2D9HA 1XMOE 4BMJA 2NUEA 4DV7E 2WBUA 4DV0E 2ODRC 2YRMA 2DGCA 1P47A 2CPNA 5AC4A 2JPAA 2CSHA 4JI6E 4K0KE 1X47A 1N33E 1EKZA 2FTXB 2EOEA 4LFCE 4LU9A 5IV8B 1YUIA 2EM8A 2RS7A 3MSWA 1YYOA 3C4BA 4NHRA 1NEIA 3T1HE 2DMIA 1XNRE 4JI8E 1XNQE 1QNTA 2VQFE 2EJ4A 2GLIA 4WX9A 4X65E 4WSPA 2EMGA 2VQEE 4NXNE 1TF6A 2N3HA 1STUA 2YRKA 4GZNC 2UXDE 1GZ6A 2EM7A 4LFBE 2WZOA 2ELYA 4BCAA 2EOYA 2EMAA 4Q28A 4F2JC 4R2SA 3OMLA 4F9CB 4IS1C 2MDGA 4WFTA 3THOB 1IQSA 4X66E 1A1FA 3AUZA 3HPSA 2I9IA 1UBDC 3MHSC 4R2AA 4B3ME 2E72A 2KONA 3BGHA 1HNZE 4IJDA 2LJHA 2GPIA 2WBTA 2EM6A 2L6MA 2YZTA 1ZBTA 2LMZA 5LLQA 5KL4A 2YTFA 4DR1E 1N32E 1ZU1A 2EL5A 3UK3C 5LMUE 1EH8A 2LCEA 1X6FA 2EQ0A 2LRSA 2EMLA 1N36E 2EOXA 4TUGA 3L00A 5A6AA 2UUCE 1GTKA 3ADIA 2RQLA 2MKNA 1FKAE 2LVHA 2LBSB 1GQEA 1PJSA 1X48A 4BC9A 2L2NA 1A1HA 5LMNE 2EN3A 2EPRA 2EPKX 4N4RB 1UHZA 2UXCE 2YTNA 2MC6A 2YU5A 5AE2A 4R03A 2EOHA 2EMZA 2UUBE 5AC5A 3EPHA 2EPLX 2Q8UA 1MGTA 2ELZA 4R2PA 1L4SA 2LJUA 1BB8A 4LFAE 2DIXA 2EM0A 3C4TA 4JI2E 1X6HA 2R76A 3VHTB 4YY3E 2LO3A 3LMLA 4P7DA 2B9DA 4DV6E 4B3RE 1WHQA 4LF9E 2ODRD 3DF6A 1DGCA 1EH7A 2DB2A 2UU9E 3EPLA 5FLXC 5KL3A 1A1KA 3M99B 2LUPB 1T38A 4MLVA 2NUFA 3J7Yp 1LLMC 4X62E 4OX9E 5KL7A 2V87A 2YRHA 2V85A 2VE7C 1G2FC 4WSGA 1NCSA 2YTGA 4MLQA 2EPXA 3FIGA 1TF3A 1UN6B 3F6GA 4X8WA 5A6JA 4Q35B 4RH8A 2EL4A 4WYQB 1ZBQA 3J7AG 4LF8E 1O0WA 4O43A 2EMBA 4L8NA 1A1IA 4I8OA 2L3CA 2LTSA 4KZSA 2F8BA 5CFFE 2EM2A 5IWAE 2MC5A 2MKDA 2DSYA 5AASA 1N34E 3J80C 3VYXA 5A6BA 5A69A 2RS6A 1RQ0A 2JXPA 2NABA 1G2DC 4ZYHA 2NUGA 3THNA 2LTRA 2RSIA 2DLQA 2HC5A 4O5GA 5A6KA 2FV4B 4FK5C 5A6BD 2EPNA 1B69A 2H36X 2LT7A 1XMQE 2R1FA 1WXRA 2L8TA 1WJPA 4R2EA 3EPJA 2YTDA 1SR9A 2EOSA 2BB8A 2DLKA 1BBOA 4O4KA 2DRPA 4B3TE 2EQ1A 2WBSA 2ZM6E 3BBGA 4DR7E 2J7JA 1MEYC
chains in the Genus database with same CATH topology
4LF4E 2KHXA 3VYYA 4B3SE 2KOUA 3LLHA 1HNXE 1T4OA 2JY9A 3ADGA 1XMOE 4BMJA 2L2KB 4LFAE 2NUEA 1HNWE 5T6JA 4DV7E 2B7VA 2DIXA 4DV0E 2ODRC 3C4TA 4JI2E 2N3GA 2K4VA 4YY3E 1PKPA 2CPNA 3LMLA 2V89A 2B9DA 4P7DA 3VK6A 4DV6E 4JI6E 1WHQA 4LF9E 2ODRD 2JOBA 3DF6A 5F3WA 4K0KE 3IWCA 2DB2A 2UU9E 3AV0A 2HHHE 3ZOQB 1X47A 1N33E 3JAMC 1EKZA 3K6QA 4JI7E 2FTXB 2UUAE 5FLXC 4LFCE 4LU9A 1UILA 4X64E 1I94E 2RS7A 3MSWA 4KHPE 1YYOA 3C4BA 4J8ZA 3T1HE 4JI4E 1XNRE 4JI8E 1XNQE 2VQFE 4GKKE 4BC7A 4LTYA 4X65E 2LUPB 1QU6A 4WSPA 2NUFA 2VQEE 3J7Yp 4X62E 4NXNE 4OX9E 2V87A 2B3TB 2N3HA 4M30A 2V85A 2L92A 1STUA 2VE7C 4F9AB 4DR2E 4NXME 2UXDE 1GZ6A 2FGGA 5LL6R 4LFBE 2WZOA 3FIGA 4BCAA 4DV4E 3IWDA 4DKKA 4DMIA 1YZ9A 3F6GA 1IBME 1DQ3A 4Q28A 3OMLA 4F9CB 1J26A 4X8WA 1YYWA 2EWLA 4WFTA 1FJGE 2V83A 2YT4A 2E1MA 2L2MA 2L33A 4LF7E 4X66E 5AE3A 4F9BB 2RTXA 3AUZA 3HPSA 1RC7A 4WYQB 2IHR1 1IBLE 3DJWA 1ZBQA 4F54A 4JI0E 4B3ME 2RSMA 3J7AG 2F4VE 2KONA 4LF8E 1HNZE 1O0WA 5ADZA 3JTZA 2LE2A 1J5EE 4L8NA 2LJHA 4DUZE 4I8OA 3ADJA 4DV3E 3F6HA 2JWOA 2L6MA 4JI1E 2L3CA 1T4NA 2LTSA 4KZSA 3T1YE 2F8BA 2YZTA 4M0VA 5CFFE 1ZBTA 3IWBA 2V8QB 4BS9A 2LMZA 2LUQA 5IWAE 2MC5A 4AQYE 4YHHE 4DR6E 4DR1E 1N32E 1DI2A 3P1XA 2DSYA 4LF5E 5LMUE 2JR1A 4B3RE 2UXBE 5AASA 1N34E 5BR8E 3J80C 1HR0E 3VYXA 2V88A 3KWRA 4JI5E 4DR4E 3HXLA 2LRSA 4DV1E 1N36E 2RS6A 1RQ0A 3OTOE 4TUGA 3ADLA 3HTXA 2E5LE 1IBKE 1WHNA 4JYAE 1YYKA 1X49A 4R8OA 2UUCE 2NUGA 2LTRA 3ADIA 3J81C 4DR3E 4DV2E 4L5NC 1FKAE 4JI3E 2LBSB 3RMPA 2DMYA 2VF1A 4P78A 1GQEA 4DV5E 5A2QC 1X48A 2FV4B 2G7HA 4BC9A 3H09A 2L2NA 2V86A 2H36X 3HPZA 2M7QA 5LMNE 1XMQE 2NA2A 4OOGC 2JOXA 1WXRA 2L8TA 2MDRA 5AE1A 4GKJE 4JV5E 1UHZA 2EZ6A 2UXCE 1SR9A 5IT9C 2M1SA 4M2ZA 3HQ1A 2MC6A 4GEQB 4DR5E 5AE2A 5DNYA 4B3TE 4R03A 4TUIA 2ZM6E 2JVAA 4LF6E 2B7TA 4DR7E 2M4IA 2UUBE 4WPYA 1T4LB 4BBYA 2L3JA 3JU0A 4DUYE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FTX B;  2FV4 B;  4GEQ B;  5T6J A; 
#chains in the Genus database with same CATH topology
 4LF4 E;  4O24 A;  2EM3 A;  3BF2 A;  3VYY A;  2EOJ A;  2K7I A;  3ADG A;  2L2K B;  5T6J A;  2B7V A;  1PJT A;  2N3G A;  2K4V A;  2YSO A;  2EMH A;  2V89 A;  1AAY A;  4HTG A;  2EN1 A;  5F3W A;  1T39 A;  2HGH A;  2EN8 A;  1AH5 A;  1A1G A;  2JYA A;  2HHH E;  5TSE A;  4JI7 E;  3ECR A;  4KWY A;  2EN4 A;  4WXC A;  2EQ3 A;  4BC7 A;  4LTY A;  1QU6 A;  1PDA A;  2B3T B;  4M30 A;  2EPZ A;  2L92 A;  4F9A B;  4DR2 E;  3KZY A;  4ZYD A;  1A1J A;  4NXM E;  2ENH A;  4R2D A;  4DMI A;  4ZYG A;  1YZ9 A;  1YPN A;  1IBM E;  1DQ3 A;  2EMW A;  2EPC A;  1Z1B A;  2EWL A;  1FJG E;  2V83 A;  2L33 A;  4LF7 E;  2VRD A;  4F9B B;  2RTX A;  1IBL E;  3DJW A;  3JTZ A;  1X3C A;  2EMX A;  4DUZ E;  5KL6 A;  4DV3 E;  2YTP A;  2EM5 A;  3F6H A;  4JI1 E;  1T4N A;  3T1Y E;  2V8Q B;  1BBG A;  2LUQ A;  4DR6 E;  3P1X A;  2PRT A;  4HEI A;  2JR1 A;  2UXB E;  1HR0 E;  5BR8 E;  2V88 A;  4DR4 E;  3HXL A;  4DV1 E;  2ENA A;  3ADL A;  3HTX A;  4JYA E;  1X49 A;  4R8O A;  2EOF A;  3J81 C;  4R2C A;  4DV2 E;  2YWQ A;  2EMF A;  2EMI A;  4P78 A;  3BID A;  4DV5 E;  2G7H A;  2EN2 A;  3H09 A;  2EE8 A;  2V86 A;  3HPZ A;  1IQO A;  2EM9 A;  3QG5 C;  2EOM A;  2MDR A;  2YTQ A;  5AE1 A;  4GKJ E;  2M1S A;  4M2Z A;  4NZV A;  3HQ1 A;  4DR5 E;  4R2Q A;  2EOI A;  4BHB A;  4TUI A;  4LF6 E;  2M4I A;  1YFH A;  4BBY A;  2EMK A;  2EPA A;  5IXM B;  4M9V C;  2YTE A;  1T4O A;  2JY9 A;  2EOQ A;  2WCC 3;  1HNW E;  2EPU A;  1JK1 A;  1PKP A;  3VK6 A;  2ADR A;  2EMC A;  3C6M A;  2ENC A;  2YTJ A;  2A25 A;  2JOB A;  4ZYE A;  3IWC A;  3AV0 A;  3ZOQ B;  2EPP A;  2CT1 A;  3JAM C;  2YTO A;  3K6Q A;  2UUA E;  4X64 E;  1UIL A;  5KL5 A;  1X6E A;  1I94 E;  4KHP E;  2BBG A;  4J8Z A;  4JI4 E;  4GKK E;  1KJK A;  2EMY A;  2EN7 A;  3KZZ A;  2YPN A;  1X5W A;  2EL6 A;  2EM4 A;  4F6M A;  1ZAA C;  2FGG A;  5LL6 R;  1A1L A;  3TQM A;  2EPM X;  3EQ1 A;  4DV4 E;  3IWD A;  4DKK A;  3MHH C;  1RMD A;  1J26 A;  2EPO A;  1YYW A;  2M9A A;  2YT4 A;  2E1M A;  2L2M A;  2N8X A;  4F6N A;  5AE3 A;  2LV2 A;  1SFE A;  1RC7 A;  2IHR 1;  1KYQ A;  4F54 A;  5KL2 A;  4JI0 E;  2RSM A;  2F4V E;  2GHF A;  5ADZ A;  2LE2 A;  2YU8 A;  1J5E E;  1WRJ A;  3ADJ A;  1N3G A;  2JWO A;  2EOR A;  2RPC A;  1F2I G;  4M0V A;  4LF5 E;  3IWB A;  4BS9 A;  4AQY E;  4YHH E;  1DI2 A;  1IMU A;  3C6K A;  4R2R A;  3KWR A;  4JI5 E;  3OTO E;  3EPK A;  2E5L E;  1IBK E;  1WHN A;  1YYK A;  2I13 A;  4X9J A;  2EN6 A;  1YUJ A;  4DR3 E;  2EOO A;  4L5N C;  4JI3 E;  2HJJ A;  3RMP A;  2DMY A;  2VF1 A;  5A2Q C;  1YSA C;  1EH6 A;  2M7Q A;  2NA2 A;  4OOG C;  2JOX A;  2EP3 A;  1ZR9 A;  4JV5 E;  2EZ6 A;  4BHC A;  5IT9 C;  1JK2 A;  4GEQ B;  2EOZ A;  2YTI A;  1PJQ A;  5DNY A;  2YSP A;  4RHB B;  2JP9 A;  2CTD A;  2JVA A;  2B7T A;  4WXD A;  4WPY A;  1T4L B;  2L3J A;  3JU0 A;  4DUY E;  1TN9 A;  2KHX A;  4B3S E;  2KOU A;  3LLH A;  1HNX E;  2D9H A;  1XMO E;  4BMJ A;  2NUE A;  4DV7 E;  2WBU A;  4DV0 E;  2ODR C;  2YRM A;  2DGC A;  1P47 A;  2CPN A;  5AC4 A;  2JPA A;  2CSH A;  4JI6 E;  4K0K E;  1X47 A;  1N33 E;  1EKZ A;  2FTX B;  2EOE A;  4LFC E;  4LU9 A;  5IV8 B;  1YUI A;  2EM8 A;  2RS7 A;  3MSW A;  1YYO A;  3C4B A;  4NHR A;  1NEI A;  3T1H E;  2DMI A;  1XNR E;  4JI8 E;  1XNQ E;  1QNT A;  2VQF E;  2EJ4 A;  2GLI A;  4WX9 A;  4X65 E;  4WSP A;  2EMG A;  2VQE E;  4NXN E;  1TF6 A;  2N3H A;  1STU A;  2YRK A;  4GZN C;  2UXD E;  1GZ6 A;  2EM7 A;  4LFB E;  2WZO A;  2ELY A;  4BCA A;  2EOY A;  2EMA A;  4Q28 A;  4F2J C;  4R2S A;  3OML A;  4F9C B;  4IS1 C;  2MDG A;  4WFT A;  3THO B;  1IQS A;  4X66 E;  1A1F A;  3AUZ A;  3HPS A;  2I9I A;  1UBD C;  3MHS C;  4R2A A;  4B3M E;  2E72 A;  2KON A;  3BGH A;  1HNZ E;  4IJD A;  2LJH A;  2GPI A;  2WBT A;  2EM6 A;  2L6M A;  2YZT A;  1ZBT A;  2LMZ A;  5LLQ A;  5KL4 A;  2YTF A;  4DR1 E;  1N32 E;  1ZU1 A;  2EL5 A;  3UK3 C;  5LMU E;  1EH8 A;  2LCE A;  1X6F A;  2EQ0 A;  2LRS A;  2EML A;  1N36 E;  2EOX A;  4TUG A;  3L00 A;  5A6A A;  2UUC E;  1GTK A;  3ADI A;  2RQL A;  2MKN A;  1FKA E;  2LVH A;  2LBS B;  1GQE A;  1PJS A;  1X48 A;  4BC9 A;  2L2N A;  1A1H A;  5LMN E;  2EN3 A;  2EPR A;  2EPK X;  4N4R B;  1UHZ A;  2UXC E;  2YTN A;  2MC6 A;  2YU5 A;  5AE2 A;  4R03 A;  2EOH A;  2EMZ A;  2UUB E;  5AC5 A;  3EPH A;  2EPL X;  2Q8U A;  1MGT A;  2ELZ A;  4R2P A;  1L4S A;  2LJU A;  1BB8 A;  4LFA E;  2DIX A;  2EM0 A;  3C4T A;  4JI2 E;  1X6H A;  2R76 A;  3VHT B;  4YY3 E;  2LO3 A;  3LML A;  4P7D A;  2B9D A;  4DV6 E;  4B3R E;  1WHQ A;  4LF9 E;  2ODR D;  3DF6 A;  1DGC A;  1EH7 A;  2DB2 A;  2UU9 E;  3EPL A;  5FLX C;  5KL3 A;  1A1K A;  3M99 B;  2LUP B;  1T38 A;  4MLV A;  2NUF A;  3J7Y p;  1LLM C;  4X62 E;  4OX9 E;  5KL7 A;  2V87 A;  2YRH A;  2V85 A;  2VE7 C;  1G2F C;  4WSG A;  1NCS A;  2YTG A;  4MLQ A;  2EPX A;  3FIG A;  1TF3 A;  1UN6 B;  3F6G A;  4X8W A;  5A6J A;  4Q35 B;  4RH8 A;  2EL4 A;  4WYQ B;  1ZBQ A;  3J7A G;  4LF8 E;  1O0W A;  4O43 A;  2EMB A;  4L8N A;  1A1I A;  4I8O A;  2L3C A;  2LTS A;  4KZS A;  2F8B A;  5CFF E;  2EM2 A;  5IWA E;  2MC5 A;  2MKD A;  2DSY A;  5AAS A;  1N34 E;  3J80 C;  3VYX A;  5A6B A;  5A69 A;  2RS6 A;  1RQ0 A;  2JXP A;  2NAB A;  1G2D C;  4ZYH A;  2NUG A;  3THN A;  2LTR A;  2RSI A;  2DLQ A;  2HC5 A;  4O5G A;  5A6K A;  2FV4 B;  4FK5 C;  5A6B D;  2EPN A;  1B69 A;  2H36 X;  2LT7 A;  1XMQ E;  2R1F A;  1WXR A;  2L8T A;  1WJP A;  4R2E A;  3EPJ A;  2YTD A;  1SR9 A;  2EOS A;  2BB8 A;  2DLK A;  1BBO A;  4O4K A;  2DRP A;  4B3T E;  2EQ1 A;  2WBS A;  2ZM6 E;  3BBG A;  4DR7 E;  2J7J A;  1MEY C; 
#chains in the Genus database with same CATH homology
 4LF4 E;  2KHX A;  3VYY A;  4B3S E;  2KOU A;  3LLH A;  1HNX E;  1T4O A;  2JY9 A;  3ADG A;  1XMO E;  4BMJ A;  2L2K B;  4LFA E;  2NUE A;  1HNW E;  5T6J A;  4DV7 E;  2B7V A;  2DIX A;  4DV0 E;  2ODR C;  3C4T A;  4JI2 E;  2N3G A;  2K4V A;  4YY3 E;  1PKP A;  2CPN A;  3LML A;  2V89 A;  2B9D A;  4P7D A;  3VK6 A;  4DV6 E;  4JI6 E;  1WHQ A;  4LF9 E;  2ODR D;  2JOB A;  3DF6 A;  5F3W A;  4K0K E;  3IWC A;  2DB2 A;  2UU9 E;  3AV0 A;  2HHH E;  3ZOQ B;  1X47 A;  1N33 E;  3JAM C;  1EKZ A;  3K6Q A;  4JI7 E;  2FTX B;  2UUA E;  5FLX C;  4LFC E;  4LU9 A;  1UIL A;  4X64 E;  1I94 E;  2RS7 A;  3MSW A;  4KHP E;  1YYO A;  3C4B A;  4J8Z A;  3T1H E;  4JI4 E;  1XNR E;  4JI8 E;  1XNQ E;  2VQF E;  4GKK E;  4BC7 A;  4LTY A;  4X65 E;  2LUP B;  1QU6 A;  4WSP A;  2NUF A;  2VQE E;  3J7Y p;  4X62 E;  4NXN E;  4OX9 E;  2V87 A;  2B3T B;  2N3H A;  4M30 A;  2V85 A;  2L92 A;  1STU A;  2VE7 C;  4F9A B;  4DR2 E;  4NXM E;  2UXD E;  1GZ6 A;  2FGG A;  5LL6 R;  4LFB E;  2WZO A;  3FIG A;  4BCA A;  4DV4 E;  3IWD A;  4DKK A;  4DMI A;  1YZ9 A;  3F6G A;  1IBM E;  1DQ3 A;  4Q28 A;  3OML A;  4F9C B;  1J26 A;  4X8W A;  1YYW A;  2EWL A;  4WFT A;  1FJG E;  2V83 A;  2YT4 A;  2E1M A;  2L2M A;  2L33 A;  4LF7 E;  4X66 E;  5AE3 A;  4F9B B;  2RTX A;  3AUZ A;  3HPS A;  1RC7 A;  4WYQ B;  2IHR 1;  1IBL E;  3DJW A;  1ZBQ A;  4F54 A;  4JI0 E;  4B3M E;  2RSM A;  3J7A G;  2F4V E;  2KON A;  4LF8 E;  1HNZ E;  1O0W A;  5ADZ A;  3JTZ A;  2LE2 A;  1J5E E;  4L8N A;  2LJH A;  4DUZ E;  4I8O A;  3ADJ A;  4DV3 E;  3F6H A;  2JWO A;  2L6M A;  4JI1 E;  2L3C A;  1T4N A;  2LTS A;  4KZS A;  3T1Y E;  2F8B A;  2YZT A;  4M0V A;  5CFF E;  1ZBT A;  3IWB A;  2V8Q B;  4BS9 A;  2LMZ A;  2LUQ A;  5IWA E;  2MC5 A;  4AQY E;  4YHH E;  4DR6 E;  4DR1 E;  1N32 E;  1DI2 A;  3P1X A;  2DSY A;  4LF5 E;  5LMU E;  2JR1 A;  4B3R E;  2UXB E;  5AAS A;  1N34 E;  5BR8 E;  3J80 C;  1HR0 E;  3VYX A;  2V88 A;  3KWR A;  4JI5 E;  4DR4 E;  3HXL A;  2LRS A;  4DV1 E;  1N36 E;  2RS6 A;  1RQ0 A;  3OTO E;  4TUG A;  3ADL A;  3HTX A;  2E5L E;  1IBK E;  1WHN A;  4JYA E;  1YYK A;  1X49 A;  4R8O A;  2UUC E;  2NUG A;  2LTR A;  3ADI A;  3J81 C;  4DR3 E;  4DV2 E;  4L5N C;  1FKA E;  4JI3 E;  2LBS B;  3RMP A;  2DMY A;  2VF1 A;  4P78 A;  1GQE A;  4DV5 E;  5A2Q C;  1X48 A;  2FV4 B;  2G7H A;  4BC9 A;  3H09 A;  2L2N A;  2V86 A;  2H36 X;  3HPZ A;  2M7Q A;  5LMN E;  1XMQ E;  2NA2 A;  4OOG C;  2JOX A;  1WXR A;  2L8T A;  2MDR A;  5AE1 A;  4GKJ E;  4JV5 E;  1UHZ A;  2EZ6 A;  2UXC E;  1SR9 A;  5IT9 C;  2M1S A;  4M2Z A;  3HQ1 A;  2MC6 A;  4GEQ B;  4DR5 E;  5AE2 A;  5DNY A;  4B3T E;  4R03 A;  4TUI A;  2ZM6 E;  2JVA A;  4LF6 E;  2B7T A;  4DR7 E;  2M4I A;  2UUB E;  4WPY A;  1T4L B;  4BBY A;  2L3J A;  3JU0 A;  4DUY E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...