5T6JA

Structure of the mind complex shows a regulatory focus of yeast kinetochore assembly
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
59
structure length
59
Chain Sequence
b'ANENILKLKLYRSLGVILDLENDQVLINRKNDGNIDILPLDNNLSDFYKTKYIWERLGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Kinetochore protein SPC24
publication title Structure of the MIND Complex Defines a Regulatory Focus for Yeast Kinetochore Assembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Cell cycle
total genus 15
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2016-09-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.430 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5t6jA00
5T6JA 2FTXB 4GEQB 2FV4B
chains in the Genus database with same CATH superfamily
1DQ3A 2YTQA 3BGHA 2VQFE 4LTYA 2PRTA 2ADRA 4J8ZA 4WFTA 2V86A 3TQMA 1PJQA 4NXME 1T4OA 2EOMA 2UXDE 1YYWA 5KL3A 1TF3A 4O4KA 2CPNA 2YTPA 5BR8E 2BB8A 5A69A 1UHZA 4HEIA 2EPPA 1J26A 4DR3E 4X65E 3HQ1A 3KZYA 1O0WA 3EPLA 1PJSA 2NUEA 4F54A 4JI3E 2N8XA 1LLMC 1N36E 5IT9C 4O5GA 4ZYGA 2EWLA 1EH8A 1MGTA 1IQOA 2ODRC 2EL5A 2LBSB 2YSPA 3L00A 3C4TA 2YPNA 5IXMB 1SFEA 4R8OA 4OOGC 2L8TA 2EMLA 2LUPB 2HC5A 3EQ1A 1FJGE 2LUQA 5IV8B 3HXLA 4L8NA 1T39A 2JWOA 2RS6A 4BC7A 5KL4A 2DSYA 3J7AG 2EMHA 2N3HA 2EOZA 3H09A 4R2CA 2EMXA 4F6NA 1IQSA 2A25A 3THOB 1JK2A 2CTDA 4M30A 2LMZA 3VHTB 2DLQA 1RC7A 2V89A 4M0VA 4B3TE 4WXCA 4ZYEA 1IBLE 5KL7A 2RTXA 4WXDA 4X66E 2R76A 2MC6A 4DR6E 3VYXA 5KL2A 2NUFA 3KWRA 2LVHA 4WYQB 1YUJA 4GKJE 4P7DA 2UUCE 2EQ0A 2B7VA 2EPXA 4YY3E 4BBYA 2F8BA 1B69A 3LLHA 2WBUA 4DKKA 2DMYA 4Q35B 2M7QA 4WSPA 3BIDA 1KYQA 4R2PA 1DGCA 4DV5E 4DV0E 5LL6R 3ZOQB 2L2KB 4B3ME 2MKNA 2RS7A 4NZVA 5DNYA 2RSIA 1L4SA 1GQEA 2FGGA 4WX9A 4DMIA 5F3WA 4R2QA 2L92A 3IWCA 1A1LA 2LT7A 2EN4A 1A1JA 2JR1A 4R2RA 2EM8A 4DV4E 4YHHE 1GTKA 2VRDA 1ZU1A 2JVAA 2ELYA 1UN6B 3ADIA 2LV2A 1RMDA 4Q28A 4BC9A 2RQLA 2ELZA 4JI0E 3MSWA 4F9CB 2DRPA 4WPYA 4JI1E 2EMGA 1T4LB 4B3SE 1XMQE 3HPSA 2B9DA 4TUGA 1YPNA 2ENHA 2Q8UA 3EPJA 2LCEA 1STUA 2H36X 4LF4E 2YSOA 2RPCA 3VYYA 5KL5A 3FIGA 2KHXA 2HJJA 1PKPA 1X6EA 1X5WA 3C6KA 4GKKE 3AUZA 1XMOE 2EN8A 4OX9E 2EM4A 3JAMC 2EL4A 1EKZA 2LJHA 2WZOA 3OTOE 2UXBE 4KHPE 2F4VE 2EP3A 2I9IA 2V83A 2MDGA 2JY9A 2LTSA 2E5LE 1ZR9A 1BB8A 1A1IA 3KZZA 2DB2A 5KL6A 4IJDA 2LE2A 5A6BA 2V87A 2JYAA 3T1YE 1T4NA 1YYKA 5A6BD 2FV4B 1T38A 2L2MA 4ZYHA 4DV1E 2EQ1A 5TSEA 2EPKX 5IWAE 2YRHA 2EJ4A 4L5NC 1JK1A 2IHR1 2EOYA 3IWDA 4KWYA 3MHHC 3VK6A 2EN2A 2EOSA 4DUYE 2EOIA 2L2NA 2EM2A 3C6MA 2KOUA 2VQEE 2MKDA 2ENAA 4DV7E 1GZ6A 2YTOA 1I94E 2JP9A 4DUZE 2YT4A 4GZNC 1X6HA 4BMJA 2EPLX 4F9BB 3F6HA 3DJWA 2YTJA 2GLIA 2WBTA 4LF6E 4X8WA 1DI2A 2NUGA 3THNA 2EE8A 5A6JA 4F6MA 3F6GA 2EM3A 4MLQA 2L6MA 2R1FA 2GPIA 4BHCA 1A1FA 2UXCE 1F2IG 2YRMA 4ZYDA 4FK5C 4JI6E 4N4RB 2EPRA 1TF6A 2UU9E 1X3CA 1EH6A 3HPZA 1FKAE 5ADZA 2EOXA 4LFBE 2EM7A 1P47A 1KJKA 3ADGA 1HNWE 4F2JC 2RSMA 2EMWA 2EPOA 1WRJA 5A2QC 1N32E 2V85A 5AC4A 2VF1A 2VE7C 2YTFA 1MEYC 2HGHA 1EH7A 4DR2E 2JOBA 2YTIA 2EMFA 3T1HE 4NHRA 5AE3A 4X9JA 5AASA 1YSAC 2E1MA 2EMZA 4MLVA 2I13A 1QNTA 4BS9A 4M2ZA 1XNRE 1RQ0A 3HTXA 2L3JA 3QG5C 1G2DC 2N3GA 1G2FC 2EM5A 2DGCA 2E72A 2LO3A 2B7TA 1WJPA 4B3RE 2CT1A 1HR0E 4LF7E 1UILA 4R2DA 4DV2E 2JPAA 2EN7A 5A6AA 4WSGA 2LJUA 2EM9A 2EM6A 1UBDC 4DR5E 2EOFA 3M99B 5T6JA 5A6KA 4JI7E 2JOXA 2YZTA 2UUBE 2ODRD 1BBGA 1ZBTA 4DV3E 3LMLA 3ADLA 2V88A 2EPUA 2EOOA 2EMCA 4R2EA 1X47A 1ZBQA 2ENCA 2YRKA 5AE2A 2NABA 1N3GA 2M4IA 3J81C 3EPHA 2EPZA 2YWQA 4DR7E 1IMUA 2K7IA 4X64E 3K6QA 3UK3C 1IBKE 1X6FA 1AAYA 4O43A 1N33E 2EMIA 4BHBA 1N34E 1IBME 1A1GA 1YYOA 4LF8E 4O24A 4AQYE 1WHNA 4R03A 2J7JA 5AC5A 1WHQA 4DR4E 2GHFA 4RH8A 4BCAA 1YFHA 1Z1BA 4K0KE 2EPNA 2YTGA 2EQ3A 3RMPA 1BBOA 4X62E 4R2SA 3DF6A 5LMNE 2EPAA 2MC5A 4KZSA 4JI5E 2YTEA 2ZM6E 2YU8A 3JU0A 2K4VA 1YUIA 1TN9A 2WCC3 1HNZE 2M9AA 3BF2A 2L3CA 2EOJA 1J5EE 1XNQE 1PDAA 1YZ9A 2DMIA 3EPKA 3ECRA 4P78A 4JI4E 4M9VC 4LU9A 3ADJA 4JYAE 4I8OA 3IWBA 2EN6A 1HNXE 1A1HA 1AH5A 2DIXA 2EOHA 5LLQA 5LMUE 5FLXC 4DV6E 2EMAA 2LRSA 4LF9E 1PJTA 4RHBB 2YTNA 4LFCE 2EM0A 4TUIA 4LF5E 2EN1A 2WBSA 4JI8E 2KONA 3MHSC 2EZ6A 3C4BA 5AE1A 2EMKA 1QU6A 2EMBA 2FTXB 4R2AA 4DR1E 2BBGA 1X49A 4NXNE 5CFFE 2G7HA 2UUAE 1SR9A 2JXPA 2CSHA 4F9AB 4IS1C 1ZAAC 2NA2A 2DLKA 1X48A 2EPMX 2L33A 4JV5E 2EORA 1NCSA 2LTRA 2D9HA 3JTZA 2YU5A 2V8QB 3OMLA 4JI2E 2EPCA 2M1SA 1WXRA 2EN3A 1A1KA 4LFAE 1NEIA 3AV0A 2YTDA 2EMYA 3J80C 4GEQB 2EOQA 4HTGA 2HHHE 2MDRA 2B3TB 3BBGA 3J7Yp 3P1XA 2EL6A 2EOEA
chains in the Genus database with same CATH topology
1DQ3A 4F9BB 2VQFE 4DR7E 2RS7A 4X64E 4LTYA 3K6QA 1IBKE 3F6HA 4J8ZA 3DJWA 4WFTA 5DNYA 2V86A 1GQEA 4NXME 2FGGA 1N33E 4DMIA 5F3WA 1IBME 2L92A 1T4OA 1N34E 3IWCA 4LF8E 1YYOA 4LF6E 2UXDE 4X8WA 1YYWA 4AQYE 1WHNA 2CPNA 4R03A 1DI2A 2JR1A 1WHQA 5BR8E 2NUGA 4DR4E 4BCAA 4DV4E 4K0KE 4YHHE 1UHZA 3F6GA 3RMPA 4X62E 5LMNE 3DF6A 2L6MA 1J26A 2MC5A 4KZSA 4JI5E 2JVAA 2UXCE 4DR3E 4X65E 2ZM6E 3ADIA 3JU0A 2K4VA 3HQ1A 1O0WA 4Q28A 4BC9A 4JI0E 3MSWA 4F9CB 1HNZE 2L3CA 4WPYA 4JI6E 2NUEA 4JI1E 4F54A 1J5EE 1XNQE 1YZ9A 1T4LB 2UU9E 1XMQE 4B3SE 3HPSA 4JI3E 3HPZA 1FKAE 1N36E 5ADZA 2B9DA 5IT9C 4LFBE 4P78A 4TUGA 2EWLA 3ADGA 1STUA 1HNWE 4JI4E 2H36X 2RSMA 2ODRC 4LF4E 2LBSB 4LU9A 3ADJA 5A2QC 4I8OA 4JYAE 1N32E 2V85A 3IWBA 2VF1A 3VYYA 1HNXE 2VE7C 3C4TA 2DIXA 5LMUE 4DV6E 5FLXC 3FIGA 2KHXA 2LRSA 1PKPA 4LF9E 4R8OA 4OOGC 4DR2E 2L8TA 2LUPB 4LFCE 2JOBA 3AUZA 4GKKE 1XMOE 3T1HE 4OX9E 4TUIA 4LF5E 1FJGE 2LUQA 3JAMC 1EKZA 2LJHA 3HXLA 2WZOA 4L8NA 2JWOA 4JI8E 2RS6A 2KONA 4BC7A 3OTOE 2UXBE 2DSYA 2EZ6A 4KHPE 5AE3A 2F4VE 3J7AG 2N3HA 2V83A 3C4BA 2JY9A 2LTSA 5AE1A 5AASA 2E5LE 3H09A 1QU6A 2E1MA 4DR1E 2FTXB 2DB2A 1X49A 4BS9A 4M2ZA 4NXNE 1XNRE 1RQ0A 5CFFE 2L3JA 2LE2A 2G7HA 2LMZA 2V87A 4M30A 2UUAE 2N3GA 3T1YE 1SR9A 1T4NA 1YYKA 2FV4B 2L2MA 4F9AB 4DV1E 1RC7A 2V89A 2B7TA 4M0VA 4B3TE 4B3RE 2NA2A 1HR0E 5IWAE 1UILA 4LF7E 1X48A 4DV2E 1IBLE 2L33A 4L5NC 4JV5E 2RTXA 4X66E 2IHR1 2LTRA 2MC6A 4DR5E 3JTZA 3IWDA 4DR6E 3OMLA 2V8QB 2NUFA 4JI2E 3VK6A 3VYXA 3KWRA 4WYQB 4GKJE 2M1SA 1WXRA 5T6JA 4P7DA 2UUCE 4LFAE 3AV0A 2B7VA 2JOXA 2YZTA 4JI7E 2UUBE 4YY3E 4DUYE 2ODRD 4BBYA 2L2NA 3J80C 1ZBTA 2F8BA 4GEQB 3LLHA 4DV3E 3LMLA 4DKKA 3ADLA 2DMYA 2KOUA 2V88A 2HHHE 2VQEE 4DV7E 1GZ6A 2M7QA 2MDRA 4WSPA 1X47A 1ZBQA 2B3TB 5AE2A 1I94E 4DV5E 4DV0E 4DUZE 3J7Yp 2M4IA 2YT4A 3J81C 5LL6R 3HTXA 4BMJA 3ZOQB 2L2KB 4B3ME 3P1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5T6J A;  2FTX B;  4GEQ B;  2FV4 B; 
#chains in the Genus database with same CATH topology
 1DQ3 A;  2YTQ A;  3BGH A;  2VQF E;  4LTY A;  2PRT A;  2ADR A;  4J8Z A;  4WFT A;  2V86 A;  3TQM A;  1PJQ A;  4NXM E;  1T4O A;  2EOM A;  2UXD E;  1YYW A;  5KL3 A;  1TF3 A;  4O4K A;  2CPN A;  2YTP A;  5BR8 E;  2BB8 A;  5A69 A;  1UHZ A;  4HEI A;  2EPP A;  1J26 A;  4DR3 E;  4X65 E;  3HQ1 A;  3KZY A;  1O0W A;  3EPL A;  1PJS A;  2NUE A;  4F54 A;  4JI3 E;  2N8X A;  1LLM C;  1N36 E;  5IT9 C;  4O5G A;  4ZYG A;  2EWL A;  1EH8 A;  1MGT A;  1IQO A;  2ODR C;  2EL5 A;  2LBS B;  2YSP A;  3L00 A;  3C4T A;  2YPN A;  5IXM B;  1SFE A;  4R8O A;  4OOG C;  2L8T A;  2EML A;  2LUP B;  2HC5 A;  3EQ1 A;  1FJG E;  2LUQ A;  5IV8 B;  3HXL A;  4L8N A;  1T39 A;  2JWO A;  2RS6 A;  4BC7 A;  5KL4 A;  2DSY A;  3J7A G;  2EMH A;  2N3H A;  2EOZ A;  3H09 A;  4R2C A;  2EMX A;  4F6N A;  1IQS A;  2A25 A;  3THO B;  1JK2 A;  2CTD A;  4M30 A;  2LMZ A;  3VHT B;  2DLQ A;  1RC7 A;  2V89 A;  4M0V A;  4B3T E;  4WXC A;  4ZYE A;  1IBL E;  5KL7 A;  2RTX A;  4WXD A;  4X66 E;  2R76 A;  2MC6 A;  4DR6 E;  3VYX A;  5KL2 A;  2NUF A;  3KWR A;  2LVH A;  4WYQ B;  1YUJ A;  4GKJ E;  4P7D A;  2UUC E;  2EQ0 A;  2B7V A;  2EPX A;  4YY3 E;  4BBY A;  2F8B A;  1B69 A;  3LLH A;  2WBU A;  4DKK A;  2DMY A;  4Q35 B;  2M7Q A;  4WSP A;  3BID A;  1KYQ A;  4R2P A;  1DGC A;  4DV5 E;  4DV0 E;  5LL6 R;  3ZOQ B;  2L2K B;  4B3M E;  2MKN A;  2RS7 A;  4NZV A;  5DNY A;  2RSI A;  1L4S A;  1GQE A;  2FGG A;  4WX9 A;  4DMI A;  5F3W A;  4R2Q A;  2L92 A;  3IWC A;  1A1L A;  2LT7 A;  2EN4 A;  1A1J A;  2JR1 A;  4R2R A;  2EM8 A;  4DV4 E;  4YHH E;  1GTK A;  2VRD A;  1ZU1 A;  2JVA A;  2ELY A;  1UN6 B;  3ADI A;  2LV2 A;  1RMD A;  4Q28 A;  4BC9 A;  2RQL A;  2ELZ A;  4JI0 E;  3MSW A;  4F9C B;  2DRP A;  4WPY A;  4JI1 E;  2EMG A;  1T4L B;  4B3S E;  1XMQ E;  3HPS A;  2B9D A;  4TUG A;  1YPN A;  2ENH A;  2Q8U A;  3EPJ A;  2LCE A;  1STU A;  2H36 X;  4LF4 E;  2YSO A;  2RPC A;  3VYY A;  5KL5 A;  3FIG A;  2KHX A;  2HJJ A;  1PKP A;  1X6E A;  1X5W A;  3C6K A;  4GKK E;  3AUZ A;  1XMO E;  2EN8 A;  4OX9 E;  2EM4 A;  3JAM C;  2EL4 A;  1EKZ A;  2LJH A;  2WZO A;  3OTO E;  2UXB E;  4KHP E;  2F4V E;  2EP3 A;  2I9I A;  2V83 A;  2MDG A;  2JY9 A;  2LTS A;  2E5L E;  1ZR9 A;  1BB8 A;  1A1I A;  3KZZ A;  2DB2 A;  5KL6 A;  4IJD A;  2LE2 A;  5A6B A;  2V87 A;  2JYA A;  3T1Y E;  1T4N A;  1YYK A;  5A6B D;  2FV4 B;  1T38 A;  2L2M A;  4ZYH A;  4DV1 E;  2EQ1 A;  5TSE A;  2EPK X;  5IWA E;  2YRH A;  2EJ4 A;  4L5N C;  1JK1 A;  2IHR 1;  2EOY A;  3IWD A;  4KWY A;  3MHH C;  3VK6 A;  2EN2 A;  2EOS A;  4DUY E;  2EOI A;  2L2N A;  2EM2 A;  3C6M A;  2KOU A;  2VQE E;  2MKD A;  2ENA A;  4DV7 E;  1GZ6 A;  2YTO A;  1I94 E;  2JP9 A;  4DUZ E;  2YT4 A;  4GZN C;  1X6H A;  4BMJ A;  2EPL X;  4F9B B;  3F6H A;  3DJW A;  2YTJ A;  2GLI A;  2WBT A;  4LF6 E;  4X8W A;  1DI2 A;  2NUG A;  3THN A;  2EE8 A;  5A6J A;  4F6M A;  3F6G A;  2EM3 A;  4MLQ A;  2L6M A;  2R1F A;  2GPI A;  4BHC A;  1A1F A;  2UXC E;  1F2I G;  2YRM A;  4ZYD A;  4FK5 C;  4JI6 E;  4N4R B;  2EPR A;  1TF6 A;  2UU9 E;  1X3C A;  1EH6 A;  3HPZ A;  1FKA E;  5ADZ A;  2EOX A;  4LFB E;  2EM7 A;  1P47 A;  1KJK A;  3ADG A;  1HNW E;  4F2J C;  2RSM A;  2EMW A;  2EPO A;  1WRJ A;  5A2Q C;  1N32 E;  2V85 A;  5AC4 A;  2VF1 A;  2VE7 C;  2YTF A;  1MEY C;  2HGH A;  1EH7 A;  4DR2 E;  2JOB A;  2YTI A;  2EMF A;  3T1H E;  4NHR A;  5AE3 A;  4X9J A;  5AAS A;  1YSA C;  2E1M A;  2EMZ A;  4MLV A;  2I13 A;  1QNT A;  4BS9 A;  4M2Z A;  1XNR E;  1RQ0 A;  3HTX A;  2L3J A;  3QG5 C;  1G2D C;  2N3G A;  1G2F C;  2EM5 A;  2DGC A;  2E72 A;  2LO3 A;  2B7T A;  1WJP A;  4B3R E;  2CT1 A;  1HR0 E;  4LF7 E;  1UIL A;  4R2D A;  4DV2 E;  2JPA A;  2EN7 A;  5A6A A;  4WSG A;  2LJU A;  2EM9 A;  2EM6 A;  1UBD C;  4DR5 E;  2EOF A;  3M99 B;  5T6J A;  5A6K A;  4JI7 E;  2JOX A;  2YZT A;  2UUB E;  2ODR D;  1BBG A;  1ZBT A;  4DV3 E;  3LML A;  3ADL A;  2V88 A;  2EPU A;  2EOO A;  2EMC A;  4R2E A;  1X47 A;  1ZBQ A;  2ENC A;  2YRK A;  5AE2 A;  2NAB A;  1N3G A;  2M4I A;  3J81 C;  3EPH A;  2EPZ A;  2YWQ A;  4DR7 E;  1IMU A;  2K7I A;  4X64 E;  3K6Q A;  3UK3 C;  1IBK E;  1X6F A;  1AAY A;  4O43 A;  1N33 E;  2EMI A;  4BHB A;  1N34 E;  1IBM E;  1A1G A;  1YYO A;  4LF8 E;  4O24 A;  4AQY E;  1WHN A;  4R03 A;  2J7J A;  5AC5 A;  1WHQ A;  4DR4 E;  2GHF A;  4RH8 A;  4BCA A;  1YFH A;  1Z1B A;  4K0K E;  2EPN A;  2YTG A;  2EQ3 A;  3RMP A;  1BBO A;  4X62 E;  4R2S A;  3DF6 A;  5LMN E;  2EPA A;  2MC5 A;  4KZS A;  4JI5 E;  2YTE A;  2ZM6 E;  2YU8 A;  3JU0 A;  2K4V A;  1YUI A;  1TN9 A;  2WCC 3;  1HNZ E;  2M9A A;  3BF2 A;  2L3C A;  2EOJ A;  1J5E E;  1XNQ E;  1PDA A;  1YZ9 A;  2DMI A;  3EPK A;  3ECR A;  4P78 A;  4JI4 E;  4M9V C;  4LU9 A;  3ADJ A;  4JYA E;  4I8O A;  3IWB A;  2EN6 A;  1HNX E;  1A1H A;  1AH5 A;  2DIX A;  2EOH A;  5LLQ A;  5LMU E;  5FLX C;  4DV6 E;  2EMA A;  2LRS A;  4LF9 E;  1PJT A;  4RHB B;  2YTN A;  4LFC E;  2EM0 A;  4TUI A;  4LF5 E;  2EN1 A;  2WBS A;  4JI8 E;  2KON A;  3MHS C;  2EZ6 A;  3C4B A;  5AE1 A;  2EMK A;  1QU6 A;  2EMB A;  2FTX B;  4R2A A;  4DR1 E;  2BBG A;  1X49 A;  4NXN E;  5CFF E;  2G7H A;  2UUA E;  1SR9 A;  2JXP A;  2CSH A;  4F9A B;  4IS1 C;  1ZAA C;  2NA2 A;  2DLK A;  1X48 A;  2EPM X;  2L33 A;  4JV5 E;  2EOR A;  1NCS A;  2LTR A;  2D9H A;  3JTZ A;  2YU5 A;  2V8Q B;  3OML A;  4JI2 E;  2EPC A;  2M1S A;  1WXR A;  2EN3 A;  1A1K A;  4LFA E;  1NEI A;  3AV0 A;  2YTD A;  2EMY A;  3J80 C;  4GEQ B;  2EOQ A;  4HTG A;  2HHH E;  2MDR A;  2B3T B;  3BBG A;  3J7Y p;  3P1X A;  2EL6 A;  2EOE A; 
#chains in the Genus database with same CATH homology
 1DQ3 A;  4F9B B;  2VQF E;  4DR7 E;  2RS7 A;  4X64 E;  4LTY A;  3K6Q A;  1IBK E;  3F6H A;  4J8Z A;  3DJW A;  4WFT A;  5DNY A;  2V86 A;  1GQE A;  4NXM E;  2FGG A;  1N33 E;  4DMI A;  5F3W A;  1IBM E;  2L92 A;  1T4O A;  1N34 E;  3IWC A;  4LF8 E;  1YYO A;  4LF6 E;  2UXD E;  4X8W A;  1YYW A;  4AQY E;  1WHN A;  2CPN A;  4R03 A;  1DI2 A;  2JR1 A;  1WHQ A;  5BR8 E;  2NUG A;  4DR4 E;  4BCA A;  4DV4 E;  4K0K E;  4YHH E;  1UHZ A;  3F6G A;  3RMP A;  4X62 E;  5LMN E;  3DF6 A;  2L6M A;  1J26 A;  2MC5 A;  4KZS A;  4JI5 E;  2JVA A;  2UXC E;  4DR3 E;  4X65 E;  2ZM6 E;  3ADI A;  3JU0 A;  2K4V A;  3HQ1 A;  1O0W A;  4Q28 A;  4BC9 A;  4JI0 E;  3MSW A;  4F9C B;  1HNZ E;  2L3C A;  4WPY A;  4JI6 E;  2NUE A;  4JI1 E;  4F54 A;  1J5E E;  1XNQ E;  1YZ9 A;  1T4L B;  2UU9 E;  1XMQ E;  4B3S E;  3HPS A;  4JI3 E;  3HPZ A;  1FKA E;  1N36 E;  5ADZ A;  2B9D A;  5IT9 C;  4LFB E;  4P78 A;  4TUG A;  2EWL A;  3ADG A;  1STU A;  1HNW E;  4JI4 E;  2H36 X;  2RSM A;  2ODR C;  4LF4 E;  2LBS B;  4LU9 A;  3ADJ A;  5A2Q C;  4I8O A;  4JYA E;  1N32 E;  2V85 A;  3IWB A;  2VF1 A;  3VYY A;  1HNX E;  2VE7 C;  3C4T A;  2DIX A;  5LMU E;  4DV6 E;  5FLX C;  3FIG A;  2KHX A;  2LRS A;  1PKP A;  4LF9 E;  4R8O A;  4OOG C;  4DR2 E;  2L8T A;  2LUP B;  4LFC E;  2JOB A;  3AUZ A;  4GKK E;  1XMO E;  3T1H E;  4OX9 E;  4TUI A;  4LF5 E;  1FJG E;  2LUQ A;  3JAM C;  1EKZ A;  2LJH A;  3HXL A;  2WZO A;  4L8N A;  2JWO A;  4JI8 E;  2RS6 A;  2KON A;  4BC7 A;  3OTO E;  2UXB E;  2DSY A;  2EZ6 A;  4KHP E;  5AE3 A;  2F4V E;  3J7A G;  2N3H A;  2V83 A;  3C4B A;  2JY9 A;  2LTS A;  5AE1 A;  5AAS A;  2E5L E;  3H09 A;  1QU6 A;  2E1M A;  4DR1 E;  2FTX B;  2DB2 A;  1X49 A;  4BS9 A;  4M2Z A;  4NXN E;  1XNR E;  1RQ0 A;  5CFF E;  2L3J A;  2LE2 A;  2G7H A;  2LMZ A;  2V87 A;  4M30 A;  2UUA E;  2N3G A;  3T1Y E;  1SR9 A;  1T4N A;  1YYK A;  2FV4 B;  2L2M A;  4F9A B;  4DV1 E;  1RC7 A;  2V89 A;  2B7T A;  4M0V A;  4B3T E;  4B3R E;  2NA2 A;  1HR0 E;  5IWA E;  1UIL A;  4LF7 E;  1X48 A;  4DV2 E;  1IBL E;  2L33 A;  4L5N C;  4JV5 E;  2RTX A;  4X66 E;  2IHR 1;  2LTR A;  2MC6 A;  4DR5 E;  3JTZ A;  3IWD A;  4DR6 E;  3OML A;  2V8Q B;  2NUF A;  4JI2 E;  3VK6 A;  3VYX A;  3KWR A;  4WYQ B;  4GKJ E;  2M1S A;  1WXR A;  5T6J A;  4P7D A;  2UUC E;  4LFA E;  3AV0 A;  2B7V A;  2JOX A;  2YZT A;  4JI7 E;  2UUB E;  4YY3 E;  4DUY E;  2ODR D;  4BBY A;  2L2N A;  3J80 C;  1ZBT A;  2F8B A;  4GEQ B;  3LLH A;  4DV3 E;  3LML A;  4DKK A;  3ADL A;  2DMY A;  2KOU A;  2V88 A;  2HHH E;  2VQE E;  4DV7 E;  1GZ6 A;  2M7Q A;  2MDR A;  4WSP A;  1X47 A;  1ZBQ A;  2B3T B;  5AE2 A;  1I94 E;  4DV5 E;  4DV0 E;  4DUZ E;  3J7Y p;  2M4I A;  2YT4 A;  3J81 C;  5LL6 R;  3HTX A;  4BMJ A;  3ZOQ B;  2L2K B;  4B3M E;  3P1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...