2EMHA

Solution structure of the c2h2 type zinc finger (region 491-523) of human zinc finger protein 484
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGERPYICTVCGKAFTDRSNLIKHQKIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 484
publication title Solution structure of the C2H2 type zinc finger (region 491-523) of human Zinc finger protein 484
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 8
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emhA01
2LT7A 4R2SA 1RMDA 1A1FA 2EPAA 1WJPA 2YTFA 2EN4A 1MEYC 4R2PA 1A1KA 2JPAA 2EN8A 2YTPA 2YSOA 3M99B 1A1GA 4F2JC 2EM3A 2YTGA 2PRTA 1YUIA 1AAYA 2JP9A 2YSPA 2YTNA 1A1JA 2EOQA 2EM5A 2YTDA 2YTIA 2EOXA 2EMLA 2EM6A 2EOJA 2EPRA 4F6MA 4GZNC 1ZU1A 2EP3A 2WCC3 1ZR9A 2EMKA 2EPXA 3EPHA 2EJ4A 1A1IA 3VHTB 2RPCA 5KL3A 1JK1A 2YTEA 2M9AA 2R1FA 2EMGA 1B69A 2EN7A 5KL7A 2EMZA 2YTOA 2EMHA 2EMBA 2EN3A 4IJDA 4F6NA 2EOEA 1X3CA 1YUJA 2EOMA 1JK2A 2WBTA 1NCSA 4R2EA 4M9VC 2ENAA 2EPZA 2LVHA 3MHSC 2CT1A 2BB8A 2EORA 3EPJA 1LLMC 2MKNA 2EOZA 1BBOA 2EQ1A 1KJKA 2HGHA 2YU8A 2EMWA 1X6FA 2EMAA 2EL4A 2EOSA 2EE8A 4WSGA 2EM0A 2ENHA 2J7JA 2GLIA 1X5WA 2EM7A 2YRKA 1YSAC 2EMCA 5KL4A 2DGCA 1BB8A 4R2CA 1TF6A 5KL6A 2ELZA 2YTQA 2EQ3A 2E72A 3UK3C 4R2DA 2D9HA 1X6HA 2WBSA 2DMIA 4X9JA 1Z1BA 1TF3A 2YRMA 2A25A 2EPPA 2EMFA 2DLQA 2NABA 2EMIA 2EPUA 4IS1C 2DLKA 5KL5A 2EPCA 2GHFA 1A1HA 1A1LA 1UN6B 4FK5C 1G2FC 2EN2A 2EOYA 2EOFA 5KL2A 2EM9A 2EM2A 2EM4A 2EOOA 2MDGA 2YRHA 4R2RA 2EN1A 2ELYA 2I13A 2YU5A 2CTDA 2VRDA 2EQ0A 1UBDC 3EPKA 2EOHA 2EN6A 2CSHA 2EMXA 1F2IG 4R2AA 2WBUA 1TN9A 1X6EA 4R2QA 2EMYA 2LO3A 1G2DC 2RSIA 2EL5A 1DGCA 2LCEA 2LV2A 1P47A 2EOIA 2MKDA 2DRPA 1ZAAC 2YTJA 3MHHC 2ENCA 2EM8A 2ADRA 3EPLA 2EL6A
chains in the Genus database with same CATH superfamily
3C6MA 1A1FA 2EN4A 2JR1A 2E1MA 4R2PA 2UUBE 2NUEA 3F6HA 5BR8E 3M99B 2VQFE 1EH6A 2YTGA 1T4NA 1GZ6A 4DV2E 1T39A 2JP9A 2YSPA 1T4OA 3VYYA 4B3RE 2EOQA 2EMLA 2EOJA 1AH5A 1PJQA 3BBGA 3ADIA 2EMKA 4JI6E 2V87A 1YPNA 2EPXA 2EJ4A 4LF7E 2G7HA 2EPMX 5AE2A 3H09A 2NUGA 1WHQA 4DR5E 2RTXA 3THOB 1HR0E 2WBTA 3FIGA 1NCSA 3T1HE 2ENAA 4NZVA 2EPZA 2E5LE 2BB8A 3IWDA 2EORA 4BHCA 1KYQA 4GKJE 5A69A 1BBGA 3L00A 4WX9A 2JOXA 2YU8A 4F9AB 2EMWA 2EMAA 2EL4A 5T6JA 1IBLE 4WSGA 1XNRE 2EM0A 2ENHA 2GPIA 3C6KA 5AASA 1STUA 4LU9A 4X62E 1XMQE 4WXCA 1IBKE 4BHBA 2UUCE 4B3ME 5LMUE 3LLHA 2YTQA 2B7VA 2LE2A 3UK3C 3T1YE 2R76A 2WBSA 4DR3E 2NA2A 2RS6A 4B3SE 2A25A 3F6GA 2LRSA 2EPOA 5KL5A 2JXPA 1UN6B 1A1LA 2UXDE 4FK5C 4I8OA 2ZM6E 1L4SA 4WPYA 2UU9E 4NXME 1HNZE 2ELYA 2L2KB 2K4VA 2YU5A 2VRDA 5IV8B 1N32E 1QU6A 2CSHA 2EMXA 1X49A 3THNA 2HC5A 4R2QA 4X64E 4L5NC 2L3CA 1DI2A 2EOIA 2MKDA 4ZYDA 2DRPA 1ZAAC 2EM8A 2LT7A 1YYWA 3JU0A 1SFEA 4JV5E 5A6KA 2JPAA 2EN8A 4NHRA 2YSOA 4WFTA 1PJTA 1A1GA 1IQSA 1NEIA 3ECRA 4F2JC 2V89A 3C4BA 4YY3E 2PRTA 1QNTA 1AAYA 1A1JA 2YTNA 3VYXA 5AE3A 3IWBA 4HTGA 2YT4A 4LFBE 1GQEA 2L92A 4JYAE 2EM6A 2B7TA 4GZNC 1N34E 1ZU1A 2EP3A 2VF1A 5ADZA 1I94E 3LMLA 1SR9A 3BIDA 4K0KE 2RPCA 4OX9E 2FTXB 2YTEA 2M9AA 2R1FA 1FJGE 4DR4E 2DMYA 1UHZA 2EMZA 2YTOA 2UUAE 4BMJA 4X66E 3RMPA 3HTXA 4F6NA 3J7Yp 3KZZA 1FKAE 4LFAE 4R2EA 2MDRA 3VK6A 4BBYA 4LF6E 4DR1E 3EPJA 2KONA 2MKNA 2EOZA 4DUZE 1BBOA 1IBME 2RS7A 3DF6A 4F9BB 5AC5A 2EE8A 4DR6E 3AUZA 4M0VA 2EMCA 2IHR1 1BB8A 4R2CA 3KZYA 2ELZA 3QG5C 2D9HA 1X6HA 1T4LB 4X65E 2JWOA 4N4RB 2DMIA 4X9JA 3TQMA 1Z1BA 1TF3A 4HEIA 2DLQA 3HXLA 2JOBA 1O0WA 2DSYA 1RC7A 2H36X 2N8XA 5KL2A 2JVAA 2B3TB 2MDGA 2MC6A 3HQ1A 4RHBB 4TUIA 2I13A 3MSWA 4M2ZA 4F54A 1GTKA 2EPNA 1EKZA 1TN9A 4B3TE 1X6EA 2JY9A 2RSIA 1DQ3A 2CPNA 2LV2A 4DKKA 2LUPB 1P47A 4WXDA 2BBGA 2ENCA 4L8NA 2ADRA 3EPLA 2EL6A 5LLQA 4LFCE 4R2SA 1RMDA 3BGHA 2EPAA 1EH8A 1WJPA 2YTFA 1MEYC 3J80C 4KWYA 1A1KA 4WSPA 2KOUA 3P1XA 5DNYA 1WXRA 1YFHA 1PJSA 4LF9E 4X8WA 1YYKA 4LF8E 2UXCE 2EM5A 3DJWA 4ZYHA 3JAMC 2WCC3 5LL6R 1WHNA 2MC5A 3EPHA 4DV0E 3VHTB 3K6QA 2L6MA 4JI1E 1JK1A 2HJJA 1B69A 2N3HA 2YWQA 1T38A 1PDAA 2EMHA 2N3GA 1MGTA 4IJDA 2UXBE 5A6JA 1X3CA 3HPZA 1YUJA 1N33E 1JK2A 5A6BA 4JI2E 4M9VC 3OTOE 2EPLX 3ADGA 5FLXC 4JI4E 2LVHA 2CT1A 3C4TA 4WYQB 4M30A 1LLMC 4Q35B 2EQ1A 1KJKA 2HGHA 1ZBQA 2V8QB 1X6FA 2EOSA 4LF5E 2J7JA 2GLIA 3J7AG 1X5WA 4KHPE 2DIXA 4BC7A 1YSAC 4TUGA 4P78A 5KL4A 3OMLA 2DGCA 2L3JA 1TF6A 5KL6A 4NXNE 1X48A 2E72A 4O24A 1IQOA 4RH8A 2NUFA 2RQLA 2YRMA 2EPPA 2EMIA 2KHXA 5A6BD 5LMNE 2ODRC 2EPCA 4DV6E 3JTZA 1YZ9A 1G2FC 2EN2A 4YHHE 4BCAA 4DMIA 2EM4A 4BS9A 5IXMB 4DR2E 4DV5E 4KZSA 4DV4E 2L8TA 2YRHA 2EN1A 1HNWE 2M4IA 4JI3E 2CTDA 3EPKA 3BF2A 2EOHA 2EN6A 1F2IG 4P7DA 5F3WA 4R2AA 4O43A 2HHHE 2LO3A 2EL5A 2LCEA 2V83A 2I9IA 2YTJA 3MHHC 1J26A 2F8BA 2EM2A 4DV1E 4MLQA 1IMUA 2YTPA 3KWRA 4Q28A 4JI8E 2EM3A 1YUIA 1X47A 4GEQB 2L33A 4AQYE 1N36E 2B9DA 2YTDA 2YTIA 2EOXA 2EPRA 2LTRA 2Q8UA 4ZYEA 4BC9A 4DUYE 4F6MA 4O4KA 3J81C 1ZR9A 1HNXE 2LMZA 2ODRD 5A6AA 4JI7E 1A1IA 2K7IA 3ADJA 2F4VE 4O5GA 5KL3A 5CFFE 4LF4E 4DR7E 2WZOA 2EMGA 1PKPA 2DB2A 2EN7A 2L2MA 2V88A 5KL7A 4DV3E 2JYAA 3ZOQB 4OOGC 2EMBA 2EN3A 4MLVA 2EOEA 4DV7E 1UILA 2EOMA 2YZTA 5AE1A 2FV4B 2LBSB 2M7QA 2LUQA 1XNQE 3MHSC 3AV0A 2FGGA 5IT9C 2V86A 1WRJA 5AC4A 4F9CB 2EM7A 2YRKA 2EPKX 4JI5E 5A2QC 2EQ3A 2LTSA 4R2DA 4GKKE 5IWAE 2EMFA 2NABA 2V85A 2EPUA 1ZBTA 2L2NA 4IS1C 2DLKA 1N3GA 2GHFA 2M1SA 3EQ1A 1XMOE 1A1HA 3HPSA 1J5EE 2EOYA 4R03A 2EOFA 2EM9A 1RQ0A 1YYOA 2EOOA 2YPNA 4R2RA 2EWLA 2RSMA 4LTYA 2EQ0A 1UBDC 3ADLA 2LJHA 5TSEA 2WBUA 4JI0E 2EZ6A 2VE7C 2EMYA 1G2DC 1DGCA 4ZYGA 1EH7A 4J8ZA 3IWCA 2VQEE 2LJUA 4R8OA
chains in the Genus database with same CATH topology
2LT7A 4R2SA 1RMDA 1A1FA 2EPAA 1WJPA 2YTFA 2EN4A 1MEYC 4R2PA 1A1KA 2JPAA 2EN8A 2YTPA 2YSOA 3M99B 1A1GA 4F2JC 2EM3A 2YTGA 2PRTA 1YUIA 1AAYA 2JP9A 2YSPA 2YTNA 1A1JA 2EOQA 2EM5A 2YTDA 2YTIA 2EOXA 2EMLA 2EM6A 2EOJA 2EPRA 4F6MA 4GZNC 1ZU1A 2EP3A 2WCC3 1ZR9A 2EMKA 2EPXA 3EPHA 2EJ4A 1A1IA 3VHTB 2RPCA 5KL3A 1JK1A 2YTEA 2M9AA 2R1FA 2EMGA 1B69A 2EN7A 5KL7A 2EMZA 2YTOA 2EMHA 2EMBA 2EN3A 4IJDA 4F6NA 2EOEA 1X3CA 1YUJA 2EOMA 1JK2A 2WBTA 1NCSA 4R2EA 4M9VC 2ENAA 2EPZA 2LVHA 3MHSC 2CT1A 2BB8A 2EORA 3EPJA 1LLMC 2MKNA 2EOZA 1BBOA 2EQ1A 1KJKA 2HGHA 2YU8A 2EMWA 1X6FA 2EMAA 2EL4A 2EOSA 2EE8A 4WSGA 2EM0A 2ENHA 2J7JA 2GLIA 1X5WA 2EM7A 2YRKA 1YSAC 2EMCA 5KL4A 2DGCA 1BB8A 4R2CA 1TF6A 5KL6A 2ELZA 2YTQA 2EQ3A 2E72A 3UK3C 4R2DA 2D9HA 1X6HA 2WBSA 2DMIA 4X9JA 1Z1BA 1TF3A 2YRMA 2A25A 2EPPA 2EMFA 2DLQA 2NABA 2EMIA 2EPUA 4IS1C 2DLKA 5KL5A 2EPCA 2GHFA 1A1HA 1A1LA 1UN6B 4FK5C 1G2FC 2EN2A 2EOYA 2EOFA 5KL2A 2EM9A 2EM2A 2EM4A 2EOOA 2MDGA 2YRHA 4R2RA 2EN1A 2ELYA 2I13A 2YU5A 2CTDA 2VRDA 2EQ0A 1UBDC 3EPKA 2EOHA 2EN6A 2CSHA 2EMXA 1F2IG 4R2AA 2WBUA 1TN9A 1X6EA 4R2QA 2EMYA 2LO3A 1G2DC 2RSIA 2EL5A 1DGCA 2LCEA 2LV2A 1P47A 2EOIA 2MKDA 2DRPA 1ZAAC 2YTJA 3MHHC 2ENCA 2EM8A 2ADRA 3EPLA 2EL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LT7 A;  4R2S A;  1RMD A;  1A1F A;  2EPA A;  1WJP A;  2YTF A;  2EN4 A;  1MEY C;  4R2P A;  1A1K A;  2JPA A;  2EN8 A;  2YTP A;  2YSO A;  3M99 B;  1A1G A;  4F2J C;  2EM3 A;  2YTG A;  2PRT A;  1YUI A;  1AAY A;  2JP9 A;  2YSP A;  2YTN A;  1A1J A;  2EOQ A;  2EM5 A;  2YTD A;  2YTI A;  2EOX A;  2EML A;  2EM6 A;  2EOJ A;  2EPR A;  4F6M A;  4GZN C;  1ZU1 A;  2EP3 A;  2WCC 3;  1ZR9 A;  2EMK A;  2EPX A;  3EPH A;  2EJ4 A;  1A1I A;  3VHT B;  2RPC A;  5KL3 A;  1JK1 A;  2YTE A;  2M9A A;  2R1F A;  2EMG A;  1B69 A;  2EN7 A;  5KL7 A;  2EMZ A;  2YTO A;  2EMH A;  2EMB A;  2EN3 A;  4IJD A;  4F6N A;  2EOE A;  1X3C A;  1YUJ A;  2EOM A;  1JK2 A;  2WBT A;  1NCS A;  4R2E A;  4M9V C;  2ENA A;  2EPZ A;  2LVH A;  3MHS C;  2CT1 A;  2BB8 A;  2EOR A;  3EPJ A;  1LLM C;  2MKN A;  2EOZ A;  1BBO A;  2EQ1 A;  1KJK A;  2HGH A;  2YU8 A;  2EMW A;  1X6F A;  2EMA A;  2EL4 A;  2EOS A;  2EE8 A;  4WSG A;  2EM0 A;  2ENH A;  2J7J A;  2GLI A;  1X5W A;  2EM7 A;  2YRK A;  1YSA C;  2EMC A;  5KL4 A;  2DGC A;  1BB8 A;  4R2C A;  1TF6 A;  5KL6 A;  2ELZ A;  2YTQ A;  2EQ3 A;  2E72 A;  3UK3 C;  4R2D A;  2D9H A;  1X6H A;  2WBS A;  2DMI A;  4X9J A;  1Z1B A;  1TF3 A;  2YRM A;  2A25 A;  2EPP A;  2EMF A;  2DLQ A;  2NAB A;  2EMI A;  2EPU A;  4IS1 C;  2DLK A;  5KL5 A;  2EPC A;  2GHF A;  1A1H A;  1A1L A;  1UN6 B;  4FK5 C;  1G2F C;  2EN2 A;  2EOY A;  2EOF A;  5KL2 A;  2EM9 A;  2EM2 A;  2EM4 A;  2EOO A;  2MDG A;  2YRH A;  4R2R A;  2EN1 A;  2ELY A;  2I13 A;  2YU5 A;  2CTD A;  2VRD A;  2EQ0 A;  1UBD C;  3EPK A;  2EOH A;  2EN6 A;  2CSH A;  2EMX A;  1F2I G;  4R2A A;  2WBU A;  1TN9 A;  1X6E A;  4R2Q A;  2EMY A;  2LO3 A;  1G2D C;  2RSI A;  2EL5 A;  1DGC A;  2LCE A;  2LV2 A;  1P47 A;  2EOI A;  2MKD A;  2DRP A;  1ZAA C;  2YTJ A;  3MHH C;  2ENC A;  2EM8 A;  2ADR A;  3EPL A;  2EL6 A; 
#chains in the Genus database with same CATH topology
 3C6M A;  1A1F A;  2EN4 A;  2JR1 A;  2E1M A;  4R2P A;  2UUB E;  2NUE A;  3F6H A;  5BR8 E;  3M99 B;  2VQF E;  1EH6 A;  2YTG A;  1T4N A;  1GZ6 A;  4DV2 E;  1T39 A;  2JP9 A;  2YSP A;  1T4O A;  3VYY A;  4B3R E;  2EOQ A;  2EML A;  2EOJ A;  1AH5 A;  1PJQ A;  3BBG A;  3ADI A;  2EMK A;  4JI6 E;  2V87 A;  1YPN A;  2EPX A;  2EJ4 A;  4LF7 E;  2G7H A;  2EPM X;  5AE2 A;  3H09 A;  2NUG A;  1WHQ A;  4DR5 E;  2RTX A;  3THO B;  1HR0 E;  2WBT A;  3FIG A;  1NCS A;  3T1H E;  2ENA A;  4NZV A;  2EPZ A;  2E5L E;  2BB8 A;  3IWD A;  2EOR A;  4BHC A;  1KYQ A;  4GKJ E;  5A69 A;  1BBG A;  3L00 A;  4WX9 A;  2JOX A;  2YU8 A;  4F9A B;  2EMW A;  2EMA A;  2EL4 A;  5T6J A;  1IBL E;  4WSG A;  1XNR E;  2EM0 A;  2ENH A;  2GPI A;  3C6K A;  5AAS A;  1STU A;  4LU9 A;  4X62 E;  1XMQ E;  4WXC A;  1IBK E;  4BHB A;  2UUC E;  4B3M E;  5LMU E;  3LLH A;  2YTQ A;  2B7V A;  2LE2 A;  3UK3 C;  3T1Y E;  2R76 A;  2WBS A;  4DR3 E;  2NA2 A;  2RS6 A;  4B3S E;  2A25 A;  3F6G A;  2LRS A;  2EPO A;  5KL5 A;  2JXP A;  1UN6 B;  1A1L A;  2UXD E;  4FK5 C;  4I8O A;  2ZM6 E;  1L4S A;  4WPY A;  2UU9 E;  4NXM E;  1HNZ E;  2ELY A;  2L2K B;  2K4V A;  2YU5 A;  2VRD A;  5IV8 B;  1N32 E;  1QU6 A;  2CSH A;  2EMX A;  1X49 A;  3THN A;  2HC5 A;  4R2Q A;  4X64 E;  4L5N C;  2L3C A;  1DI2 A;  2EOI A;  2MKD A;  4ZYD A;  2DRP A;  1ZAA C;  2EM8 A;  2LT7 A;  1YYW A;  3JU0 A;  1SFE A;  4JV5 E;  5A6K A;  2JPA A;  2EN8 A;  4NHR A;  2YSO A;  4WFT A;  1PJT A;  1A1G A;  1IQS A;  1NEI A;  3ECR A;  4F2J C;  2V89 A;  3C4B A;  4YY3 E;  2PRT A;  1QNT A;  1AAY A;  1A1J A;  2YTN A;  3VYX A;  5AE3 A;  3IWB A;  4HTG A;  2YT4 A;  4LFB E;  1GQE A;  2L92 A;  4JYA E;  2EM6 A;  2B7T A;  4GZN C;  1N34 E;  1ZU1 A;  2EP3 A;  2VF1 A;  5ADZ A;  1I94 E;  3LML A;  1SR9 A;  3BID A;  4K0K E;  2RPC A;  4OX9 E;  2FTX B;  2YTE A;  2M9A A;  2R1F A;  1FJG E;  4DR4 E;  2DMY A;  1UHZ A;  2EMZ A;  2YTO A;  2UUA E;  4BMJ A;  4X66 E;  3RMP A;  3HTX A;  4F6N A;  3J7Y p;  3KZZ A;  1FKA E;  4LFA E;  4R2E A;  2MDR A;  3VK6 A;  4BBY A;  4LF6 E;  4DR1 E;  3EPJ A;  2KON A;  2MKN A;  2EOZ A;  4DUZ E;  1BBO A;  1IBM E;  2RS7 A;  3DF6 A;  4F9B B;  5AC5 A;  2EE8 A;  4DR6 E;  3AUZ A;  4M0V A;  2EMC A;  2IHR 1;  1BB8 A;  4R2C A;  3KZY A;  2ELZ A;  3QG5 C;  2D9H A;  1X6H A;  1T4L B;  4X65 E;  2JWO A;  4N4R B;  2DMI A;  4X9J A;  3TQM A;  1Z1B A;  1TF3 A;  4HEI A;  2DLQ A;  3HXL A;  2JOB A;  1O0W A;  2DSY A;  1RC7 A;  2H36 X;  2N8X A;  5KL2 A;  2JVA A;  2B3T B;  2MDG A;  2MC6 A;  3HQ1 A;  4RHB B;  4TUI A;  2I13 A;  3MSW A;  4M2Z A;  4F54 A;  1GTK A;  2EPN A;  1EKZ A;  1TN9 A;  4B3T E;  1X6E A;  2JY9 A;  2RSI A;  1DQ3 A;  2CPN A;  2LV2 A;  4DKK A;  2LUP B;  1P47 A;  4WXD A;  2BBG A;  2ENC A;  4L8N A;  2ADR A;  3EPL A;  2EL6 A;  5LLQ A;  4LFC E;  4R2S A;  1RMD A;  3BGH A;  2EPA A;  1EH8 A;  1WJP A;  2YTF A;  1MEY C;  3J80 C;  4KWY A;  1A1K A;  4WSP A;  2KOU A;  3P1X A;  5DNY A;  1WXR A;  1YFH A;  1PJS A;  4LF9 E;  4X8W A;  1YYK A;  4LF8 E;  2UXC E;  2EM5 A;  3DJW A;  4ZYH A;  3JAM C;  2WCC 3;  5LL6 R;  1WHN A;  2MC5 A;  3EPH A;  4DV0 E;  3VHT B;  3K6Q A;  2L6M A;  4JI1 E;  1JK1 A;  2HJJ A;  1B69 A;  2N3H A;  2YWQ A;  1T38 A;  1PDA A;  2EMH A;  2N3G A;  1MGT A;  4IJD A;  2UXB E;  5A6J A;  1X3C A;  3HPZ A;  1YUJ A;  1N33 E;  1JK2 A;  5A6B A;  4JI2 E;  4M9V C;  3OTO E;  2EPL X;  3ADG A;  5FLX C;  4JI4 E;  2LVH A;  2CT1 A;  3C4T A;  4WYQ B;  4M30 A;  1LLM C;  4Q35 B;  2EQ1 A;  1KJK A;  2HGH A;  1ZBQ A;  2V8Q B;  1X6F A;  2EOS A;  4LF5 E;  2J7J A;  2GLI A;  3J7A G;  1X5W A;  4KHP E;  2DIX A;  4BC7 A;  1YSA C;  4TUG A;  4P78 A;  5KL4 A;  3OML A;  2DGC A;  2L3J A;  1TF6 A;  5KL6 A;  4NXN E;  1X48 A;  2E72 A;  4O24 A;  1IQO A;  4RH8 A;  2NUF A;  2RQL A;  2YRM A;  2EPP A;  2EMI A;  2KHX A;  5A6B D;  5LMN E;  2ODR C;  2EPC A;  4DV6 E;  3JTZ A;  1YZ9 A;  1G2F C;  2EN2 A;  4YHH E;  4BCA A;  4DMI A;  2EM4 A;  4BS9 A;  5IXM B;  4DR2 E;  4DV5 E;  4KZS A;  4DV4 E;  2L8T A;  2YRH A;  2EN1 A;  1HNW E;  2M4I A;  4JI3 E;  2CTD A;  3EPK A;  3BF2 A;  2EOH A;  2EN6 A;  1F2I G;  4P7D A;  5F3W A;  4R2A A;  4O43 A;  2HHH E;  2LO3 A;  2EL5 A;  2LCE A;  2V83 A;  2I9I A;  2YTJ A;  3MHH C;  1J26 A;  2F8B A;  2EM2 A;  4DV1 E;  4MLQ A;  1IMU A;  2YTP A;  3KWR A;  4Q28 A;  4JI8 E;  2EM3 A;  1YUI A;  1X47 A;  4GEQ B;  2L33 A;  4AQY E;  1N36 E;  2B9D A;  2YTD A;  2YTI A;  2EOX A;  2EPR A;  2LTR A;  2Q8U A;  4ZYE A;  4BC9 A;  4DUY E;  4F6M A;  4O4K A;  3J81 C;  1ZR9 A;  1HNX E;  2LMZ A;  2ODR D;  5A6A A;  4JI7 E;  1A1I A;  2K7I A;  3ADJ A;  2F4V E;  4O5G A;  5KL3 A;  5CFF E;  4LF4 E;  4DR7 E;  2WZO A;  2EMG A;  1PKP A;  2DB2 A;  2EN7 A;  2L2M A;  2V88 A;  5KL7 A;  4DV3 E;  2JYA A;  3ZOQ B;  4OOG C;  2EMB A;  2EN3 A;  4MLV A;  2EOE A;  4DV7 E;  1UIL A;  2EOM A;  2YZT A;  5AE1 A;  2FV4 B;  2LBS B;  2M7Q A;  2LUQ A;  1XNQ E;  3MHS C;  3AV0 A;  2FGG A;  5IT9 C;  2V86 A;  1WRJ A;  5AC4 A;  4F9C B;  2EM7 A;  2YRK A;  2EPK X;  4JI5 E;  5A2Q C;  2EQ3 A;  2LTS A;  4R2D A;  4GKK E;  5IWA E;  2EMF A;  2NAB A;  2V85 A;  2EPU A;  1ZBT A;  2L2N A;  4IS1 C;  2DLK A;  1N3G A;  2GHF A;  2M1S A;  3EQ1 A;  1XMO E;  1A1H A;  3HPS A;  1J5E E;  2EOY A;  4R03 A;  2EOF A;  2EM9 A;  1RQ0 A;  1YYO A;  2EOO A;  2YPN A;  4R2R A;  2EWL A;  2RSM A;  4LTY A;  2EQ0 A;  1UBD C;  3ADL A;  2LJH A;  5TSE A;  2WBU A;  4JI0 E;  2EZ6 A;  2VE7 C;  2EMY A;  1G2D C;  1DGC A;  4ZYG A;  1EH7 A;  4J8Z A;  3IWC A;  2VQE E;  2LJU A;  4R8O A; 
#chains in the Genus database with same CATH homology
 2LT7 A;  4R2S A;  1RMD A;  1A1F A;  2EPA A;  1WJP A;  2YTF A;  2EN4 A;  1MEY C;  4R2P A;  1A1K A;  2JPA A;  2EN8 A;  2YTP A;  2YSO A;  3M99 B;  1A1G A;  4F2J C;  2EM3 A;  2YTG A;  2PRT A;  1YUI A;  1AAY A;  2JP9 A;  2YSP A;  2YTN A;  1A1J A;  2EOQ A;  2EM5 A;  2YTD A;  2YTI A;  2EOX A;  2EML A;  2EM6 A;  2EOJ A;  2EPR A;  4F6M A;  4GZN C;  1ZU1 A;  2EP3 A;  2WCC 3;  1ZR9 A;  2EMK A;  2EPX A;  3EPH A;  2EJ4 A;  1A1I A;  3VHT B;  2RPC A;  5KL3 A;  1JK1 A;  2YTE A;  2M9A A;  2R1F A;  2EMG A;  1B69 A;  2EN7 A;  5KL7 A;  2EMZ A;  2YTO A;  2EMH A;  2EMB A;  2EN3 A;  4IJD A;  4F6N A;  2EOE A;  1X3C A;  1YUJ A;  2EOM A;  1JK2 A;  2WBT A;  1NCS A;  4R2E A;  4M9V C;  2ENA A;  2EPZ A;  2LVH A;  3MHS C;  2CT1 A;  2BB8 A;  2EOR A;  3EPJ A;  1LLM C;  2MKN A;  2EOZ A;  1BBO A;  2EQ1 A;  1KJK A;  2HGH A;  2YU8 A;  2EMW A;  1X6F A;  2EMA A;  2EL4 A;  2EOS A;  2EE8 A;  4WSG A;  2EM0 A;  2ENH A;  2J7J A;  2GLI A;  1X5W A;  2EM7 A;  2YRK A;  1YSA C;  2EMC A;  5KL4 A;  2DGC A;  1BB8 A;  4R2C A;  1TF6 A;  5KL6 A;  2ELZ A;  2YTQ A;  2EQ3 A;  2E72 A;  3UK3 C;  4R2D A;  2D9H A;  1X6H A;  2WBS A;  2DMI A;  4X9J A;  1Z1B A;  1TF3 A;  2YRM A;  2A25 A;  2EPP A;  2EMF A;  2DLQ A;  2NAB A;  2EMI A;  2EPU A;  4IS1 C;  2DLK A;  5KL5 A;  2EPC A;  2GHF A;  1A1H A;  1A1L A;  1UN6 B;  4FK5 C;  1G2F C;  2EN2 A;  2EOY A;  2EOF A;  5KL2 A;  2EM9 A;  2EM2 A;  2EM4 A;  2EOO A;  2MDG A;  2YRH A;  4R2R A;  2EN1 A;  2ELY A;  2I13 A;  2YU5 A;  2CTD A;  2VRD A;  2EQ0 A;  1UBD C;  3EPK A;  2EOH A;  2EN6 A;  2CSH A;  2EMX A;  1F2I G;  4R2A A;  2WBU A;  1TN9 A;  1X6E A;  4R2Q A;  2EMY A;  2LO3 A;  1G2D C;  2RSI A;  2EL5 A;  1DGC A;  2LCE A;  2LV2 A;  1P47 A;  2EOI A;  2MKD A;  2DRP A;  1ZAA C;  2YTJ A;  3MHH C;  2ENC A;  2EM8 A;  2ADR A;  3EPL A;  2EL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...