2EMHA

Solution structure of the c2h2 type zinc finger (region 491-523) of human zinc finger protein 484
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
46
structure length
46
Chain Sequence
b'GSSGSSGTGERPYICTVCGKAFTDRSNLIKHQKIHTGEKPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 484
publication title Solution structure of the C2H2 type zinc finger (region 491-523) of human Zinc finger protein 484
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 8
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emhA01
2YTJA 4R2DA 2ELYA 2EM2A 1X6FA 2YRHA 5KL5A 2EQ1A 1NCSA 2EM0A 1WJPA 5KL3A 2YTGA 2ENAA 2EM9A 4R2CA 5KL6A 4R2QA 2LO3A 2E72A 2LV2A 2EMIA 2EMGA 1X6HA 2NABA 1LLMC 2EN2A 1BB8A 2EOZA 2EN1A 4F6MA 2EQ0A 1ZU1A 2EN7A 2EMFA 2YRMA 4IJDA 2GHFA 4GZNC 2EMCA 1A1FA 2ELZA 2DMIA 2ENCA 2DLQA 2YTNA 4WSGA 2PRTA 2EOIA 1Z1BA 1P47A 5KL2A 2EOQA 2EOXA 1RMDA 2EPAA 4F6NA 1JK2A 2EE8A 2EMZA 2EMXA 2HGHA 2MDGA 2YTFA 4R2EA 2RPCA 2YSOA 3M99B 2YU8A 1YSAC 2LT7A 2DLKA 1YUJA 2YTQA 2EMBA 2LCEA 1DGCA 1JK1A 1AAYA 2JPAA 2LVHA 2EN3A 1B69A 2GLIA 2EN4A 1UN6B 2EOFA 2EPCA 2EM4A 2EP3A 2EM6A 1A1GA 2CT1A 4R2PA 2DRPA 2MKNA 2M9AA 2D9HA 2EJ4A 2YU5A 2CSHA 2WBTA 1G2FC 2EOMA 4R2RA 1MEYC 2JP9A 2YTPA 2CTDA 4FK5C 2EPXA 1G2DC 1X3CA 1F2IG 5KL7A 2I13A 1X6EA 2WBUA 4R2AA 2R1FA 2J7JA 4X9JA 4IS1C 3VHTB 2MKDA 2EM5A 1ZAAC 4R2SA 2EL6A 2EOEA 1A1LA 4M9VC 2WCC3 2EMLA 2EN8A 1A1HA 2YTIA 3MHSC 2EOJA 2ENHA 3EPJA 3EPKA 2YTEA 1TN9A 2EMHA 2VRDA 3EPLA 2EMKA 5KL4A 2YSPA 2EPUA 2EN6A 3UK3C 2EL5A 1A1IA 2WBSA 2DGCA 1YUIA 2EOYA 4F2JC 1A1JA 1X5WA 2EOSA 1A1KA 2EOHA 3EPHA 1KJKA 2RSIA 2YRKA 1TF3A 1ZR9A 1TF6A 2EL4A 2EMWA 2A25A 2YTOA 2EPPA 2YTDA 2EQ3A 3MHHC 2EM8A 1BBOA 2BB8A 2EM7A 2EMYA 2EOOA 2EORA 2EM3A 1UBDC 2EMAA 2EPZA 2ADRA 2EPRA
chains in the Genus database with same CATH superfamily
4GEQB 4DR7E 2YRHA 1X6FA 2EM0A 4DR3E 5KL3A 2ENAA 2FGGA 4R2QA 4NHRA 4NZVA 4LF6E 2EMIA 3BBGA 3T1HE 1BB8A 2EN2A 4F54A 4YY3E 5LLQA 2VF1A 4IJDA 2EMFA 2GHFA 3BF2A 4BC7A 2YTNA 4DR2E 2JXPA 5LL6R 2EPAA 4F6NA 2LBSB 2EE8A 2UXDE 3C4TA 2H36X 2RPCA 4R2EA 2YSOA 3M99B 3ZOQB 2YU8A 4OX9E 1IBME 3K6QA 1YUJA 2EMBA 2V89A 2LCEA 4M0VA 4JI8E 5IXMB 2JPAA 1RC7A 1B69A 4X64E 4DV7E 1PKPA 2EN4A 2GLIA 2UUCE 2JVAA 1QU6A 2EPCA 4N4RB 2VQEE 2HJJA 1A1GA 2CT1A 2D9HA 2EJ4A 2M4IA 2JP9A 5CFFE 2YTPA 2EPXA 5IT9C 2DMYA 1T38A 2B7VA 5AE2A 2L8TA 1X6EA 4WFTA 4TUIA 3IWCA 4R2AA 2WBUA 4LF8E 1T4LB 1T39A 2EZ6A 2EM5A 4YHHE 2EL6A 2EOEA 5A6BA 3J7Yp 3VYYA 4M9VC 1ZBTA 2L2NA 3MHSC 2ENHA 1IBLE 2LTRA 2M1SA 3EPKA 2YTEA 2EMHA 2GPIA 3H09A 2EL5A 4F2JC 1A1JA 1I94E 4WYQB 4JI7E 1X5WA 4Q35B 4BMJA 1EH7A 3LLHA 5F3WA 4DR1E 3VYXA 2RSIA 4F9CB 1X47A 4JI4E 1HNXE 2UXBE 2UU9E 2YTOA 5T6JA 1T4OA 2MDRA 4JI1E 2EMAA 5A6JA 4R2DA 2EM2A 3HXLA 5FLXC 1J26A 2EQ1A 1NCSA 4F9AB 1WJPA 2KHXA 4LF7E 5LMUE 2LO3A 4K0KE 1UHZA 2LV2A 1LLMC 1N33E 2EN1A 4F6MA 3F6GA 2LE2A 1L4SA 2V86A 2EN7A 4GZNC 3IWDA 2EMCA 2EPKX 2DMIA 5AE1A 2DLQA 3BIDA 3F6HA 4WSGA 1UILA 2MC5A 2RQLA 1Z1BA 3EQ1A 2EOXA 4L8NA 2KONA 3ADJA 1GZ6A 1QNTA 2G7HA 1DI2A 2L2KB 1N3GA 3LMLA 2R76A 1HNWE 1JK1A 1FJGE 5IV8B 3TQMA 4JI0E 4JI3E 1WHNA 2EM4A 2EP3A 1EH8A 3THOB 4JI2E 3HPSA 4DV6E 2MKNA 2DRPA 1YYKA 4KWYA 2I9IA 2V87A 2ZM6E 4ZYHA 4FK5C 5A6BD 3BGHA 1F2IG 2I13A 2ODRC 4WXCA 5AC5A 2J7JA 2YT4A 3L00A 4WX9A 5IWAE 2DSYA 4M2ZA 4DUYE 2LRSA 2N8XA 4DUZE 5A6KA 2N3HA 2WCC3 3HTXA 2EOJA 3KWRA 4AQYE 4P7DA 3AUZA 2EMKA 4MLQA 5KL4A 1YPNA 2EPUA 2EN6A 3KZZA 2WBSA 2DGCA 2E5LE 2EPLX 4JV5E 5ADZA 1A1KA 4KHPE 1PJTA 4DV0E 3J7AG 5AASA 4DR6E 2YTDA 2EM8A 2JY9A 1YYOA 2EMYA 4M30A 2EM3A 4RH8A 1IMUA 2EPRA 5AE3A 2VQFE 2CPNA 4KZSA 5KL5A 2EM9A 4R2CA 2L3JA 2EPNA 3QG5C 5KL6A 5LMNE 2E72A 1X6HA 2NABA 2BBGA 2YPNA 2ODRD 3JAMC 2RS6A 2EPOA 3RMPA 1A1FA 1PJSA 2ELZA 2ENCA 5A6AA 4X66E 4LF9E 2EOIA 2LJUA 1XMOE 1STUA 3AV0A 5KL2A 4NXNE 2EOQA 1RMDA 1JK2A 2L33A 5DNYA 4X8WA 4LFAE 1N32E 2B7TA 1X48A 4I8OA 2EMZA 2HGHA 2MDGA 2YTFA 1N36E 4R03A 2DLKA 2FTXB 1DGCA 2VE7C 2LVHA 5A69A 3OMLA 2EOFA 4DR5E 1UN6B 1EKZA 4J8ZA 1YYWA 4R2PA 4DV4E 2M9AA 4LF4E 4TUGA 2WBTA 4R2RA 3MSWA 1MEYC 1O0WA 2YZTA 2UUAE 2CTDA 1BBGA 1G2DC 2JOBA 1X3CA 2FV4B 2JOXA 5KL7A 4WSPA 1WHQA 1MGTA 2R1FA 3ADLA 3VHTB 1HR0E 4LU9A 1ZAAC 4WPYA 1EH6A 2RSMA 4P78A 2LMZA 2RTXA 2L6MA 2YTIA 2LJHA 4MLVA 3EPJA 4O43A 1WRJA 1TN9A 1XNQE 2VRDA 3EPLA 2YSPA 3UK3C 4GKKE 2K4VA 1DQ3A 1IQSA 1XNRE 4DV1E 3EPHA 2RS7A 4BS9A 2YRKA 4O5GA 1TF3A 2EWLA 2EMWA 1KYQA 2A25A 2EPMX 4OOGC 2EPPA 4LFCE 4R8OA 4JYAE 4X65E 1BBOA 2EM7A 4DKKA 3HPZA 2EPZA 2E1MA 4DMIA 2IHR1 2NUEA 4JI6E 1HNZE 2JR1A 4DR4E 2DIXA 2Q8UA 4X62E 3J81C 4DV3E 2YTJA 4WXDA 2ELYA 2HC5A 4L5NC 4NXME 2JWOA 3C6MA 2YTGA 2B9DA 2NA2A 3DJWA 1XMQE 2EMGA 3ECRA 1GTKA 2EOZA 4JI5E 5AC4A 2EQ0A 1AH5A 1ZU1A 2YRMA 4O24A 4ZYEA 4DV5E 2KOUA 2PRTA 2N3GA 4F9BB 1P47A 1NEIA 3JTZA 4LFBE 2DB2A 2EMXA 2L2MA 3ADIA 3DF6A 1GQEA 3OTOE 1YSAC 2F4VE 2LT7A 3T1YE 2YTQA 1IBKE 4BBYA 3J80C 4B3ME 1AAYA 2EN3A 2UUBE 1ZBQA 2LUPB 4BCAA 2V88A 4DV2E 3P1XA 4GKJE 2EM6A 3FIGA 2YU5A 2M7QA 2CSHA 1G2FC 2EOMA 3KZYA 3THNA 3HQ1A 4Q28A 1PJQA 4ZYGA 3JU0A 2WZOA 5TSEA 1SR9A 4HTGA 3ADGA 3C4BA 2V8QB 4X9JA 4IS1C 1YZ9A 1PDAA 2MKDA 4R2SA 4HEIA 2UXCE 4BHBA 1A1LA 2NUGA 1YFHA 2F8BA 5BR8E 2B3TB 2EMLA 2EN8A 3C6KA 1J5EE 1A1HA 4ZYDA 4O4KA 1X49A 2K7IA 1T4NA 2HHHE 4LF5E 5A2QC 3IWBA 4B3TE 1A1IA 2V85A 1RQ0A 2YWQA 2JYAA 1YUIA 2EOYA 1N34E 2EOSA 2EOHA 1KJKA 4B3RE 1IQOA 1ZR9A 1TF6A 2EL4A 4BHCA 2L92A 1SFEA 1FKAE 2LUQA 4RHBB 4BC9A 2EQ3A 3MHHC 2BB8A 4LTYA 2EOOA 2MC6A 2EORA 1UBDC 2NUFA 2LTSA 1WXRA 2ADRA 2L3CA 3VK6A 4B3SE 2V83A
chains in the Genus database with same CATH topology
2YTJA 4R2DA 2ELYA 2EM2A 1X6FA 2YRHA 5KL5A 2EQ1A 1NCSA 2EM0A 1WJPA 5KL3A 2YTGA 2ENAA 2EM9A 4R2CA 5KL6A 4R2QA 2LO3A 2E72A 2LV2A 2EMIA 2EMGA 1X6HA 2NABA 1LLMC 2EN2A 1BB8A 2EOZA 2EN1A 4F6MA 2EQ0A 1ZU1A 2EN7A 2EMFA 2YRMA 4IJDA 2GHFA 4GZNC 2EMCA 1A1FA 2ELZA 2DMIA 2ENCA 2DLQA 2YTNA 4WSGA 2PRTA 2EOIA 1Z1BA 1P47A 5KL2A 2EOQA 2EOXA 1RMDA 2EPAA 4F6NA 1JK2A 2EE8A 2EMZA 2EMXA 2HGHA 2MDGA 2YTFA 4R2EA 2RPCA 2YSOA 3M99B 2YU8A 1YSAC 2LT7A 2DLKA 1YUJA 2YTQA 2EMBA 2LCEA 1DGCA 1JK1A 1AAYA 2JPAA 2LVHA 2EN3A 1B69A 2GLIA 2EN4A 1UN6B 2EOFA 2EPCA 2EM4A 2EP3A 2EM6A 1A1GA 2CT1A 4R2PA 2DRPA 2MKNA 2M9AA 2D9HA 2EJ4A 2YU5A 2CSHA 2WBTA 1G2FC 2EOMA 4R2RA 1MEYC 2JP9A 2YTPA 2CTDA 4FK5C 2EPXA 1G2DC 1X3CA 1F2IG 5KL7A 2I13A 1X6EA 2WBUA 4R2AA 2R1FA 2J7JA 4X9JA 4IS1C 3VHTB 2MKDA 2EM5A 1ZAAC 4R2SA 2EL6A 2EOEA 1A1LA 4M9VC 2WCC3 2EMLA 2EN8A 1A1HA 2YTIA 3MHSC 2EOJA 2ENHA 3EPJA 3EPKA 2YTEA 1TN9A 2EMHA 2VRDA 3EPLA 2EMKA 5KL4A 2YSPA 2EPUA 2EN6A 3UK3C 2EL5A 1A1IA 2WBSA 2DGCA 1YUIA 2EOYA 4F2JC 1A1JA 1X5WA 2EOSA 1A1KA 2EOHA 3EPHA 1KJKA 2RSIA 2YRKA 1TF3A 1ZR9A 1TF6A 2EL4A 2EMWA 2A25A 2YTOA 2EPPA 2YTDA 2EQ3A 3MHHC 2EM8A 1BBOA 2BB8A 2EM7A 2EMYA 2EOOA 2EORA 2EM3A 1UBDC 2EMAA 2EPZA 2ADRA 2EPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YTJ A;  4R2D A;  2ELY A;  2EM2 A;  1X6F A;  2YRH A;  5KL5 A;  2EQ1 A;  1NCS A;  2EM0 A;  1WJP A;  5KL3 A;  2YTG A;  2ENA A;  2EM9 A;  4R2C A;  5KL6 A;  4R2Q A;  2LO3 A;  2E72 A;  2LV2 A;  2EMI A;  2EMG A;  1X6H A;  2NAB A;  1LLM C;  2EN2 A;  1BB8 A;  2EOZ A;  2EN1 A;  4F6M A;  2EQ0 A;  1ZU1 A;  2EN7 A;  2EMF A;  2YRM A;  4IJD A;  2GHF A;  4GZN C;  2EMC A;  1A1F A;  2ELZ A;  2DMI A;  2ENC A;  2DLQ A;  2YTN A;  4WSG A;  2PRT A;  2EOI A;  1Z1B A;  1P47 A;  5KL2 A;  2EOQ A;  2EOX A;  1RMD A;  2EPA A;  4F6N A;  1JK2 A;  2EE8 A;  2EMZ A;  2EMX A;  2HGH A;  2MDG A;  2YTF A;  4R2E A;  2RPC A;  2YSO A;  3M99 B;  2YU8 A;  1YSA C;  2LT7 A;  2DLK A;  1YUJ A;  2YTQ A;  2EMB A;  2LCE A;  1DGC A;  1JK1 A;  1AAY A;  2JPA A;  2LVH A;  2EN3 A;  1B69 A;  2GLI A;  2EN4 A;  1UN6 B;  2EOF A;  2EPC A;  2EM4 A;  2EP3 A;  2EM6 A;  1A1G A;  2CT1 A;  4R2P A;  2DRP A;  2MKN A;  2M9A A;  2D9H A;  2EJ4 A;  2YU5 A;  2CSH A;  2WBT A;  1G2F C;  2EOM A;  4R2R A;  1MEY C;  2JP9 A;  2YTP A;  2CTD A;  4FK5 C;  2EPX A;  1G2D C;  1X3C A;  1F2I G;  5KL7 A;  2I13 A;  1X6E A;  2WBU A;  4R2A A;  2R1F A;  2J7J A;  4X9J A;  4IS1 C;  3VHT B;  2MKD A;  2EM5 A;  1ZAA C;  4R2S A;  2EL6 A;  2EOE A;  1A1L A;  4M9V C;  2WCC 3;  2EML A;  2EN8 A;  1A1H A;  2YTI A;  3MHS C;  2EOJ A;  2ENH A;  3EPJ A;  3EPK A;  2YTE A;  1TN9 A;  2EMH A;  2VRD A;  3EPL A;  2EMK A;  5KL4 A;  2YSP A;  2EPU A;  2EN6 A;  3UK3 C;  2EL5 A;  1A1I A;  2WBS A;  2DGC A;  1YUI A;  2EOY A;  4F2J C;  1A1J A;  1X5W A;  2EOS A;  1A1K A;  2EOH A;  3EPH A;  1KJK A;  2RSI A;  2YRK A;  1TF3 A;  1ZR9 A;  1TF6 A;  2EL4 A;  2EMW A;  2A25 A;  2YTO A;  2EPP A;  2YTD A;  2EQ3 A;  3MHH C;  2EM8 A;  1BBO A;  2BB8 A;  2EM7 A;  2EMY A;  2EOO A;  2EOR A;  2EM3 A;  1UBD C;  2EMA A;  2EPZ A;  2ADR A;  2EPR A; 
#chains in the Genus database with same CATH topology
 4GEQ B;  4DR7 E;  2YRH A;  1X6F A;  2EM0 A;  4DR3 E;  5KL3 A;  2ENA A;  2FGG A;  4R2Q A;  4NHR A;  4NZV A;  4LF6 E;  2EMI A;  3BBG A;  3T1H E;  1BB8 A;  2EN2 A;  4F54 A;  4YY3 E;  5LLQ A;  2VF1 A;  4IJD A;  2EMF A;  2GHF A;  3BF2 A;  4BC7 A;  2YTN A;  4DR2 E;  2JXP A;  5LL6 R;  2EPA A;  4F6N A;  2LBS B;  2EE8 A;  2UXD E;  3C4T A;  2H36 X;  2RPC A;  4R2E A;  2YSO A;  3M99 B;  3ZOQ B;  2YU8 A;  4OX9 E;  1IBM E;  3K6Q A;  1YUJ A;  2EMB A;  2V89 A;  2LCE A;  4M0V A;  4JI8 E;  5IXM B;  2JPA A;  1RC7 A;  1B69 A;  4X64 E;  4DV7 E;  1PKP A;  2EN4 A;  2GLI A;  2UUC E;  2JVA A;  1QU6 A;  2EPC A;  4N4R B;  2VQE E;  2HJJ A;  1A1G A;  2CT1 A;  2D9H A;  2EJ4 A;  2M4I A;  2JP9 A;  5CFF E;  2YTP A;  2EPX A;  5IT9 C;  2DMY A;  1T38 A;  2B7V A;  5AE2 A;  2L8T A;  1X6E A;  4WFT A;  4TUI A;  3IWC A;  4R2A A;  2WBU A;  4LF8 E;  1T4L B;  1T39 A;  2EZ6 A;  2EM5 A;  4YHH E;  2EL6 A;  2EOE A;  5A6B A;  3J7Y p;  3VYY A;  4M9V C;  1ZBT A;  2L2N A;  3MHS C;  2ENH A;  1IBL E;  2LTR A;  2M1S A;  3EPK A;  2YTE A;  2EMH A;  2GPI A;  3H09 A;  2EL5 A;  4F2J C;  1A1J A;  1I94 E;  4WYQ B;  4JI7 E;  1X5W A;  4Q35 B;  4BMJ A;  1EH7 A;  3LLH A;  5F3W A;  4DR1 E;  3VYX A;  2RSI A;  4F9C B;  1X47 A;  4JI4 E;  1HNX E;  2UXB E;  2UU9 E;  2YTO A;  5T6J A;  1T4O A;  2MDR A;  4JI1 E;  2EMA A;  5A6J A;  4R2D A;  2EM2 A;  3HXL A;  5FLX C;  1J26 A;  2EQ1 A;  1NCS A;  4F9A B;  1WJP A;  2KHX A;  4LF7 E;  5LMU E;  2LO3 A;  4K0K E;  1UHZ A;  2LV2 A;  1LLM C;  1N33 E;  2EN1 A;  4F6M A;  3F6G A;  2LE2 A;  1L4S A;  2V86 A;  2EN7 A;  4GZN C;  3IWD A;  2EMC A;  2EPK X;  2DMI A;  5AE1 A;  2DLQ A;  3BID A;  3F6H A;  4WSG A;  1UIL A;  2MC5 A;  2RQL A;  1Z1B A;  3EQ1 A;  2EOX A;  4L8N A;  2KON A;  3ADJ A;  1GZ6 A;  1QNT A;  2G7H A;  1DI2 A;  2L2K B;  1N3G A;  3LML A;  2R76 A;  1HNW E;  1JK1 A;  1FJG E;  5IV8 B;  3TQM A;  4JI0 E;  4JI3 E;  1WHN A;  2EM4 A;  2EP3 A;  1EH8 A;  3THO B;  4JI2 E;  3HPS A;  4DV6 E;  2MKN A;  2DRP A;  1YYK A;  4KWY A;  2I9I A;  2V87 A;  2ZM6 E;  4ZYH A;  4FK5 C;  5A6B D;  3BGH A;  1F2I G;  2I13 A;  2ODR C;  4WXC A;  5AC5 A;  2J7J A;  2YT4 A;  3L00 A;  4WX9 A;  5IWA E;  2DSY A;  4M2Z A;  4DUY E;  2LRS A;  2N8X A;  4DUZ E;  5A6K A;  2N3H A;  2WCC 3;  3HTX A;  2EOJ A;  3KWR A;  4AQY E;  4P7D A;  3AUZ A;  2EMK A;  4MLQ A;  5KL4 A;  1YPN A;  2EPU A;  2EN6 A;  3KZZ A;  2WBS A;  2DGC A;  2E5L E;  2EPL X;  4JV5 E;  5ADZ A;  1A1K A;  4KHP E;  1PJT A;  4DV0 E;  3J7A G;  5AAS A;  4DR6 E;  2YTD A;  2EM8 A;  2JY9 A;  1YYO A;  2EMY A;  4M30 A;  2EM3 A;  4RH8 A;  1IMU A;  2EPR A;  5AE3 A;  2VQF E;  2CPN A;  4KZS A;  5KL5 A;  2EM9 A;  4R2C A;  2L3J A;  2EPN A;  3QG5 C;  5KL6 A;  5LMN E;  2E72 A;  1X6H A;  2NAB A;  2BBG A;  2YPN A;  2ODR D;  3JAM C;  2RS6 A;  2EPO A;  3RMP A;  1A1F A;  1PJS A;  2ELZ A;  2ENC A;  5A6A A;  4X66 E;  4LF9 E;  2EOI A;  2LJU A;  1XMO E;  1STU A;  3AV0 A;  5KL2 A;  4NXN E;  2EOQ A;  1RMD A;  1JK2 A;  2L33 A;  5DNY A;  4X8W A;  4LFA E;  1N32 E;  2B7T A;  1X48 A;  4I8O A;  2EMZ A;  2HGH A;  2MDG A;  2YTF A;  1N36 E;  4R03 A;  2DLK A;  2FTX B;  1DGC A;  2VE7 C;  2LVH A;  5A69 A;  3OML A;  2EOF A;  4DR5 E;  1UN6 B;  1EKZ A;  4J8Z A;  1YYW A;  4R2P A;  4DV4 E;  2M9A A;  4LF4 E;  4TUG A;  2WBT A;  4R2R A;  3MSW A;  1MEY C;  1O0W A;  2YZT A;  2UUA E;  2CTD A;  1BBG A;  1G2D C;  2JOB A;  1X3C A;  2FV4 B;  2JOX A;  5KL7 A;  4WSP A;  1WHQ A;  1MGT A;  2R1F A;  3ADL A;  3VHT B;  1HR0 E;  4LU9 A;  1ZAA C;  4WPY A;  1EH6 A;  2RSM A;  4P78 A;  2LMZ A;  2RTX A;  2L6M A;  2YTI A;  2LJH A;  4MLV A;  3EPJ A;  4O43 A;  1WRJ A;  1TN9 A;  1XNQ E;  2VRD A;  3EPL A;  2YSP A;  3UK3 C;  4GKK E;  2K4V A;  1DQ3 A;  1IQS A;  1XNR E;  4DV1 E;  3EPH A;  2RS7 A;  4BS9 A;  2YRK A;  4O5G A;  1TF3 A;  2EWL A;  2EMW A;  1KYQ A;  2A25 A;  2EPM X;  4OOG C;  2EPP A;  4LFC E;  4R8O A;  4JYA E;  4X65 E;  1BBO A;  2EM7 A;  4DKK A;  3HPZ A;  2EPZ A;  2E1M A;  4DMI A;  2IHR 1;  2NUE A;  4JI6 E;  1HNZ E;  2JR1 A;  4DR4 E;  2DIX A;  2Q8U A;  4X62 E;  3J81 C;  4DV3 E;  2YTJ A;  4WXD A;  2ELY A;  2HC5 A;  4L5N C;  4NXM E;  2JWO A;  3C6M A;  2YTG A;  2B9D A;  2NA2 A;  3DJW A;  1XMQ E;  2EMG A;  3ECR A;  1GTK A;  2EOZ A;  4JI5 E;  5AC4 A;  2EQ0 A;  1AH5 A;  1ZU1 A;  2YRM A;  4O24 A;  4ZYE A;  4DV5 E;  2KOU A;  2PRT A;  2N3G A;  4F9B B;  1P47 A;  1NEI A;  3JTZ A;  4LFB E;  2DB2 A;  2EMX A;  2L2M A;  3ADI A;  3DF6 A;  1GQE A;  3OTO E;  1YSA C;  2F4V E;  2LT7 A;  3T1Y E;  2YTQ A;  1IBK E;  4BBY A;  3J80 C;  4B3M E;  1AAY A;  2EN3 A;  2UUB E;  1ZBQ A;  2LUP B;  4BCA A;  2V88 A;  4DV2 E;  3P1X A;  4GKJ E;  2EM6 A;  3FIG A;  2YU5 A;  2M7Q A;  2CSH A;  1G2F C;  2EOM A;  3KZY A;  3THN A;  3HQ1 A;  4Q28 A;  1PJQ A;  4ZYG A;  3JU0 A;  2WZO A;  5TSE A;  1SR9 A;  4HTG A;  3ADG A;  3C4B A;  2V8Q B;  4X9J A;  4IS1 C;  1YZ9 A;  1PDA A;  2MKD A;  4R2S A;  4HEI A;  2UXC E;  4BHB A;  1A1L A;  2NUG A;  1YFH A;  2F8B A;  5BR8 E;  2B3T B;  2EML A;  2EN8 A;  3C6K A;  1J5E E;  1A1H A;  4ZYD A;  4O4K A;  1X49 A;  2K7I A;  1T4N A;  2HHH E;  4LF5 E;  5A2Q C;  3IWB A;  4B3T E;  1A1I A;  2V85 A;  1RQ0 A;  2YWQ A;  2JYA A;  1YUI A;  2EOY A;  1N34 E;  2EOS A;  2EOH A;  1KJK A;  4B3R E;  1IQO A;  1ZR9 A;  1TF6 A;  2EL4 A;  4BHC A;  2L92 A;  1SFE A;  1FKA E;  2LUQ A;  4RHB B;  4BC9 A;  2EQ3 A;  3MHH C;  2BB8 A;  4LTY A;  2EOO A;  2MC6 A;  2EOR A;  1UBD C;  2NUF A;  2LTS A;  1WXR A;  2ADR A;  2L3C A;  3VK6 A;  4B3S E;  2V83 A; 
#chains in the Genus database with same CATH homology
 2YTJ A;  4R2D A;  2ELY A;  2EM2 A;  1X6F A;  2YRH A;  5KL5 A;  2EQ1 A;  1NCS A;  2EM0 A;  1WJP A;  5KL3 A;  2YTG A;  2ENA A;  2EM9 A;  4R2C A;  5KL6 A;  4R2Q A;  2LO3 A;  2E72 A;  2LV2 A;  2EMI A;  2EMG A;  1X6H A;  2NAB A;  1LLM C;  2EN2 A;  1BB8 A;  2EOZ A;  2EN1 A;  4F6M A;  2EQ0 A;  1ZU1 A;  2EN7 A;  2EMF A;  2YRM A;  4IJD A;  2GHF A;  4GZN C;  2EMC A;  1A1F A;  2ELZ A;  2DMI A;  2ENC A;  2DLQ A;  2YTN A;  4WSG A;  2PRT A;  2EOI A;  1Z1B A;  1P47 A;  5KL2 A;  2EOQ A;  2EOX A;  1RMD A;  2EPA A;  4F6N A;  1JK2 A;  2EE8 A;  2EMZ A;  2EMX A;  2HGH A;  2MDG A;  2YTF A;  4R2E A;  2RPC A;  2YSO A;  3M99 B;  2YU8 A;  1YSA C;  2LT7 A;  2DLK A;  1YUJ A;  2YTQ A;  2EMB A;  2LCE A;  1DGC A;  1JK1 A;  1AAY A;  2JPA A;  2LVH A;  2EN3 A;  1B69 A;  2GLI A;  2EN4 A;  1UN6 B;  2EOF A;  2EPC A;  2EM4 A;  2EP3 A;  2EM6 A;  1A1G A;  2CT1 A;  4R2P A;  2DRP A;  2MKN A;  2M9A A;  2D9H A;  2EJ4 A;  2YU5 A;  2CSH A;  2WBT A;  1G2F C;  2EOM A;  4R2R A;  1MEY C;  2JP9 A;  2YTP A;  2CTD A;  4FK5 C;  2EPX A;  1G2D C;  1X3C A;  1F2I G;  5KL7 A;  2I13 A;  1X6E A;  2WBU A;  4R2A A;  2R1F A;  2J7J A;  4X9J A;  4IS1 C;  3VHT B;  2MKD A;  2EM5 A;  1ZAA C;  4R2S A;  2EL6 A;  2EOE A;  1A1L A;  4M9V C;  2WCC 3;  2EML A;  2EN8 A;  1A1H A;  2YTI A;  3MHS C;  2EOJ A;  2ENH A;  3EPJ A;  3EPK A;  2YTE A;  1TN9 A;  2EMH A;  2VRD A;  3EPL A;  2EMK A;  5KL4 A;  2YSP A;  2EPU A;  2EN6 A;  3UK3 C;  2EL5 A;  1A1I A;  2WBS A;  2DGC A;  1YUI A;  2EOY A;  4F2J C;  1A1J A;  1X5W A;  2EOS A;  1A1K A;  2EOH A;  3EPH A;  1KJK A;  2RSI A;  2YRK A;  1TF3 A;  1ZR9 A;  1TF6 A;  2EL4 A;  2EMW A;  2A25 A;  2YTO A;  2EPP A;  2YTD A;  2EQ3 A;  3MHH C;  2EM8 A;  1BBO A;  2BB8 A;  2EM7 A;  2EMY A;  2EOO A;  2EOR A;  2EM3 A;  1UBD C;  2EMA A;  2EPZ A;  2ADR A;  2EPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...