2EMHA

Solution structure of the c2h2 type zinc finger (region 491-523) of human zinc finger protein 484
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGERPYICTVCGKAFTDRSNLIKHQKIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 491-523) of human Zinc finger protein 484
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 484
total genus 8
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emhA01
4R2RA 1A1IA 2EPCA 3UK3C 2DLQA 2YU8A 1UBDC 4GZNC 2EP3A 4IS1C 1B69A 2I13A 2EQ3A 4R2EA 2YRHA 1KJKA 1A1GA 2J7JA 2EPXA 2EOEA 5KL2A 1X5WA 2EMYA 2ELZA 1G2DC 2EN4A 2GLIA 2CTDA 2LCEA 4F6MA 3EPKA 2DRPA 2ELYA 1ZR9A 2WBSA 5KL4A 2EN3A 1YSAC 1A1KA 4WSGA 2LV2A 4IJDA 1MEYC 2EMGA 2EM2A 4F2JC 2EM9A 1Z1BA 2M9AA 2DMIA 3EPJA 2YTPA 2MKNA 2EN6A 2EL5A 2EN1A 5KL7A 2YTEA 4X9JA 2ADRA 2HGHA 2YRMA 2ENHA 1YUIA 1YUJA 1BB8A 2LT7A 2JP9A 2WCC3 1A1LA 2EORA 1JK1A 2EOYA 1A1HA 1F2IG 4R2DA 2ENAA 2EOFA 1TN9A 2EMCA 2EQ0A 2EPZA 4M9VC 4F6NA 2EOXA 2YTIA 2EMAA 2EM8A 2EMHA 1TF3A 2YRKA 2EE8A 2YSOA 2YTQA 1JK2A 2BB8A 2A25A 2GHFA 2YTJA 2R1FA 2EJ4A 2EL4A 2EMBA 2EPRA 1UN6B 2MKDA 2EL6A 2EMKA 2E72A 2EN2A 2EN8A 2DLKA 1X6EA 1X3CA 1WJPA 2EOIA 2EPPA 1X6HA 2RSIA 2EMWA 2EOMA 4R2PA 1RMDA 3EPHA 3EPLA 2EM0A 3MHHC 5KL6A 2WBTA 2EOJA 2D9HA 2RPCA 2EMLA 2CT1A 2MDGA 2YTNA 1BBOA 2YTFA 2LVHA 2NABA 2EPAA 4R2CA 2YTGA 4R2QA 2YTOA 1NCSA 2EM6A 2EPUA 2EMZA 2WBUA 2EMXA 3VHTB 1LLMC 1P47A 2VRDA 2EOHA 2EOZA 2ENCA 3M99B 2EN7A 2EOQA 1A1JA 2DGCA 2EM3A 3MHSC 5KL3A 5KL5A 2LO3A 1G2FC 2JPAA 1TF6A 1A1FA 2EMIA 2YU5A 1X6FA 2EQ1A 4R2SA 1ZAAC 2PRTA 4FK5C 4R2AA 2CSHA 1DGCA 1ZU1A 2EM4A 2YTDA 2EM5A 2EOOA 1AAYA 2EMFA 2YSPA 2EOSA 2EM7A
chains in the Genus database with same CATH superfamily
2EPCA 1T4LB 5A6JA 1XMOE 5T6JA 1MGTA 1PJSA 2LBSB 4L8NA 1KJKA 2L33A 4WSPA 2LJHA 2EMYA 1G2DC 4GEQB 3LLHA 4DV4E 1IBLE 4O43A 5FLXC 4F6MA 1YZ9A 2WBSA 4IJDA 4WX9A 1L4SA 2EM2A 3F6HA 2EM9A 4X8WA 2M9AA 2EL5A 4B3ME 4X9JA 2YRMA 3H09A 1N3GA 4DR3E 1A1HA 2VQFE 2LJUA 5IWAE 4R2DA 1STUA 2ENAA 2WZOA 2JY9A 4F6NA 2V88A 1PJTA 2GHFA 3KZZA 4O5GA 3QG5C 1RC7A 4NXME 1T38A 4P78A 4M30A 2EL6A 2IHR1 1YPNA 2EOIA 1WJPA 2EPPA 2V8QB 2EMWA 2EOMA 1WRJA 1N33E 3EPLA 3MHHC 2V83A 2EOJA 3HPSA 4BHBA 4DR1E 2EMLA 2UXBE 1BBOA 4O24A 2YTFA 2JR1A 2NABA 4R2CA 3J7Yp 2YTGA 3HQ1A 4RH8A 2EM6A 2N8XA 2EPUA 5F3WA 2EMXA 2MC5A 4DR7E 2JWOA 2LE2A 4LTYA 5BR8E 1RQ0A 2F4VE 4O4KA 4JI1E 2ENCA 2LMZA 3M99B 2L3JA 2EN7A 1GZ6A 4F9BB 4TUIA 2DGCA 5ADZA 4JYAE 2LO3A 2CPNA 2YU5A 4JI8E 2M7QA 2PRTA 1IBME 4F9AB 4JI4E 2EPLX 2MC6A 1N36E 1XNRE 5A6BD 4LF5E 2YTDA 1XNQE 2EM7A 4R2RA 4NZVA 2UXCE 4DV5E 2L2MA 2M4IA 2I9IA 1I94E 3C4TA 2EP3A 4LFBE 5AC4A 1X48A 1EH8A 1A1GA 2J7JA 5KL2A 2EOEA 4LFAE 4ZYDA 2ELZA 5TSEA 2GLIA 3P1XA 2NUGA 3AV0A 1YYKA 2CTDA 3EPKA 2DRPA 2YWQA 2LUQA 2B3TB 2EN3A 2KOUA 4BS9A 2KONA 2EMGA 1MEYC 5A69A 4F2JC 4JI2E 4JI6E 3EPJA 4LF6E 1PKPA 4I8OA 4RHBB 2ENHA 3DF6A 4L5NC 1T39A 2NUFA 2WCC3 3RMPA 4ZYHA 3TQMA 4WXCA 1F2IG 4LU9A 5AE3A 3K6QA 2K4VA 1HR0E 2EMCA 1IQOA 1HNWE 2EQ0A 1IMUA 2V86A 2EOXA 2EZ6A 4WXDA 2HC5A 2EM8A 2EE8A 1JK2A 2A25A 3ADLA 2YT4A 3C6MA 2JXPA 3T1HE 2EL4A 4OOGC 1UN6B 2MKDA 2M1SA 2E72A 2DSYA 4JI3E 4DUZE 4KZSA 1X49A 2UU9E 3ADJA 1RMDA 2F8BA 3EPHA 5KL6A 1WHNA 2D9HA 2EPKX 4LF4E 1XMQE 3OTOE 4OX9E 1DI2A 4DV2E 4HEIA 4ZYGA 1FJGE 4B3SE 4BCAA 3DJWA 3VHTB 5IV8B 2UUAE 5A2QC 1WXRA 2K7IA 2DIXA 5A6KA 2RQLA 4LF8E 2E1MA 2N3GA 3J7AG 5KL3A 4Q28A 5LMNE 2FTXB 1GTKA 2B9DA 2L2NA 2EQ1A 3OMLA 4R03A 1SFEA 4F54A 4X64E 4FK5C 4R2AA 2CSHA 3J80C 1ZU1A 3ADIA 4B3TE 2DB2A 2EOOA 2YSPA 1A1LA 2EWLA 3LMLA 4LF9E 3UK3C 2DLQA 2B7VA 3BGHA 4GZNC 2VQEE 3C6KA 3THOB 1N34E 2I13A 2EQ3A 4R2EA 2B7TA 1X5WA 4JI5E 2JVAA 2EN4A 1IQSA 1HNXE 5A6AA 1O0WA 2DMYA 5LL6R 2L8TA 5LLQA 1ZR9A 4LFCE 2NA2A 4WSGA 2LV2A 3ADGA 3EQ1A 5IT9C 2RTXA 2VE7C 3VK6A 2E5LE 2ODRD 2YTPA 2MKNA 2EN1A 2G7HA 4DKKA 1X47A 4P7DA 4DV7E 1YUJA 3HPZA 2LT7A 4NHRA 4X65E 2EPOA 4ZYEA 2FGGA 2EORA 1JK1A 4WYQB 3JTZA 2L6MA 4N4RB 2UXDE 1TN9A 2EPZA 4M9VC 4DUYE 2HJJA 1NEIA 2EMAA 5AE1A 2EMHA 1TF3A 2YRKA 2YSOA 2RS6A 1EH6A 4NXNE 4BC7A 1YFHA 2R1FA 3VYXA 4BBYA 2EMBA 2HHHE 2EPRA 1ZBTA 3IWDA 3HTXA 4BMJA 2LRSA 2DLKA 1X6EA 5CFFE 3IWCA 3AUZA 4M2ZA 2EM0A 2BBGA 4K0KE 2JYAA 1SR9A 4JI0E 2MDGA 2YTNA 4DV3E 1UHZA 2LVHA 1QU6A 5DNYA 2EPAA 4DR4E 2L92A 4R2QA 2UUBE 4YY3E 2RS7A 1NCSA 3IWBA 2EMZA 2WBUA 1LLMC 1QNTA 4DV0E 2VRDA 3C4BA 2EOZA 5AC5A 1J26A 3KZYA 2VF1A 4MLVA 2EM3A 3MHSC 5A6BA 1A1FA 2EMIA 1X6FA 4R2SA 4X62E 1ZAAC 1DGCA 1T4NA 4BHCA 2ODRC 3BBGA 2V85A 4TUGA 2EM5A 1YYOA 2MDRA 1A1IA 3J81C 2YU8A 1UBDC 2H36X 4IS1C 1B69A 2YRHA 4KWYA 1DQ3A 2EPXA 1J5EE 2JOXA 1PDAA 2LCEA 2YZTA 1WHQA 4AQYE 2ELYA 4YHHE 2JOBA 1PJQA 5KL4A 3ECRA 1YSAC 1A1KA 4JV5E 1T4OA 4F9CB 4DR2E 2RSMA 1Z1BA 2DMIA 2ZM6E 2EN6A 5KL7A 3ZOQB 4DR5E 2YTEA 2N3HA 3KWRA 2ADRA 4M0VA 2R76A 3MSWA 2HGHA 3BF2A 1YUIA 4JI7E 1BB8A 3L00A 2JP9A 2NUEA 5IXMB 4J8ZA 2EOYA 2EOFA 2LTSA 1N32E 2Q8UA 4MLQA 2YTIA 5LMUE 1EKZA 2YTQA 1EH7A 2BB8A 1GQEA 4GKKE 3JU0A 1FKAE 2YTJA 4R8OA 5AASA 1UILA 4WFTA 2EJ4A 1IBKE 4HTGA 4Q35B 2EPNA 2EPMX 2EMKA 4DV1E 2EN2A 2EN8A 4LF7E 1X3CA 1X6HA 4DV6E 2RSIA 4R2PA 2WBTA 1ZBQA 2RPCA 2LUPB 2CT1A 3VYYA 2LTRA 1YYWA 4B3RE 2UUCE 2FV4B 1KYQA 2V87A 2YTOA 2YPNA 2L3CA 1AH5A 1P47A 2L2KB 2V89A 2EOHA 3FIGA 3F6GA 4KHPE 2EOQA 1A1JA 3HXLA 4GKJE 4BC9A 2JPAA 5KL5A 1G2FC 1HNZE 1TF6A 2GPIA 3JAMC 4WPYA 3THNA 3T1YE 4DR6E 5AE2A 3BIDA 4X66E 2KHXA 2EM4A 1AAYA 4DMIA 2EMFA 2EOSA 1BBGA
chains in the Genus database with same CATH topology
4R2RA 1A1IA 2EPCA 3UK3C 2DLQA 2YU8A 1UBDC 4GZNC 2EP3A 4IS1C 1B69A 2I13A 2EQ3A 4R2EA 2YRHA 1KJKA 1A1GA 2J7JA 2EPXA 2EOEA 5KL2A 1X5WA 2EMYA 2ELZA 1G2DC 2EN4A 2GLIA 2CTDA 2LCEA 4F6MA 3EPKA 2DRPA 2ELYA 1ZR9A 2WBSA 5KL4A 2EN3A 1YSAC 1A1KA 4WSGA 2LV2A 4IJDA 1MEYC 2EMGA 2EM2A 4F2JC 2EM9A 1Z1BA 2M9AA 2DMIA 3EPJA 2YTPA 2MKNA 2EN6A 2EL5A 2EN1A 5KL7A 2YTEA 4X9JA 2ADRA 2HGHA 2YRMA 2ENHA 1YUIA 1YUJA 1BB8A 2LT7A 2JP9A 2WCC3 1A1LA 2EORA 1JK1A 2EOYA 1A1HA 1F2IG 4R2DA 2ENAA 2EOFA 1TN9A 2EMCA 2EQ0A 2EPZA 4M9VC 4F6NA 2EOXA 2YTIA 2EMAA 2EM8A 2EMHA 1TF3A 2YRKA 2EE8A 2YSOA 2YTQA 1JK2A 2BB8A 2A25A 2GHFA 2YTJA 2R1FA 2EJ4A 2EL4A 2EMBA 2EPRA 1UN6B 2MKDA 2EL6A 2EMKA 2E72A 2EN2A 2EN8A 2DLKA 1X6EA 1X3CA 1WJPA 2EOIA 2EPPA 1X6HA 2RSIA 2EMWA 2EOMA 4R2PA 1RMDA 3EPHA 3EPLA 2EM0A 3MHHC 5KL6A 2WBTA 2EOJA 2D9HA 2RPCA 2EMLA 2CT1A 2MDGA 2YTNA 1BBOA 2YTFA 2LVHA 2NABA 2EPAA 4R2CA 2YTGA 4R2QA 2YTOA 1NCSA 2EM6A 2EPUA 2EMZA 2WBUA 2EMXA 3VHTB 1LLMC 1P47A 2VRDA 2EOHA 2EOZA 2ENCA 3M99B 2EN7A 2EOQA 1A1JA 2DGCA 2EM3A 3MHSC 5KL3A 5KL5A 2LO3A 1G2FC 2JPAA 1TF6A 1A1FA 2EMIA 2YU5A 1X6FA 2EQ1A 4R2SA 1ZAAC 2PRTA 4FK5C 4R2AA 2CSHA 1DGCA 1ZU1A 2EM4A 2YTDA 2EM5A 2EOOA 1AAYA 2EMFA 2YSPA 2EOSA 2EM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R2R A;  1A1I A;  2EPC A;  3UK3 C;  2DLQ A;  2YU8 A;  1UBD C;  4GZN C;  2EP3 A;  4IS1 C;  1B69 A;  2I13 A;  2EQ3 A;  4R2E A;  2YRH A;  1KJK A;  1A1G A;  2J7J A;  2EPX A;  2EOE A;  5KL2 A;  1X5W A;  2EMY A;  2ELZ A;  1G2D C;  2EN4 A;  2GLI A;  2CTD A;  2LCE A;  4F6M A;  3EPK A;  2DRP A;  2ELY A;  1ZR9 A;  2WBS A;  5KL4 A;  2EN3 A;  1YSA C;  1A1K A;  4WSG A;  2LV2 A;  4IJD A;  1MEY C;  2EMG A;  2EM2 A;  4F2J C;  2EM9 A;  1Z1B A;  2M9A A;  2DMI A;  3EPJ A;  2YTP A;  2MKN A;  2EN6 A;  2EL5 A;  2EN1 A;  5KL7 A;  2YTE A;  4X9J A;  2ADR A;  2HGH A;  2YRM A;  2ENH A;  1YUI A;  1YUJ A;  1BB8 A;  2LT7 A;  2JP9 A;  2WCC 3;  1A1L A;  2EOR A;  1JK1 A;  2EOY A;  1A1H A;  1F2I G;  4R2D A;  2ENA A;  2EOF A;  1TN9 A;  2EMC A;  2EQ0 A;  2EPZ A;  4M9V C;  4F6N A;  2EOX A;  2YTI A;  2EMA A;  2EM8 A;  2EMH A;  1TF3 A;  2YRK A;  2EE8 A;  2YSO A;  2YTQ A;  1JK2 A;  2BB8 A;  2A25 A;  2GHF A;  2YTJ A;  2R1F A;  2EJ4 A;  2EL4 A;  2EMB A;  2EPR A;  1UN6 B;  2MKD A;  2EL6 A;  2EMK A;  2E72 A;  2EN2 A;  2EN8 A;  2DLK A;  1X6E A;  1X3C A;  1WJP A;  2EOI A;  2EPP A;  1X6H A;  2RSI A;  2EMW A;  2EOM A;  4R2P A;  1RMD A;  3EPH A;  3EPL A;  2EM0 A;  3MHH C;  5KL6 A;  2WBT A;  2EOJ A;  2D9H A;  2RPC A;  2EML A;  2CT1 A;  2MDG A;  2YTN A;  1BBO A;  2YTF A;  2LVH A;  2NAB A;  2EPA A;  4R2C A;  2YTG A;  4R2Q A;  2YTO A;  1NCS A;  2EM6 A;  2EPU A;  2EMZ A;  2WBU A;  2EMX A;  3VHT B;  1LLM C;  1P47 A;  2VRD A;  2EOH A;  2EOZ A;  2ENC A;  3M99 B;  2EN7 A;  2EOQ A;  1A1J A;  2DGC A;  2EM3 A;  3MHS C;  5KL3 A;  5KL5 A;  2LO3 A;  1G2F C;  2JPA A;  1TF6 A;  1A1F A;  2EMI A;  2YU5 A;  1X6F A;  2EQ1 A;  4R2S A;  1ZAA C;  2PRT A;  4FK5 C;  4R2A A;  2CSH A;  1DGC A;  1ZU1 A;  2EM4 A;  2YTD A;  2EM5 A;  2EOO A;  1AAY A;  2EMF A;  2YSP A;  2EOS A;  2EM7 A; 
#chains in the Genus database with same CATH topology
 2EPC A;  1T4L B;  5A6J A;  1XMO E;  5T6J A;  1MGT A;  1PJS A;  2LBS B;  4L8N A;  1KJK A;  2L33 A;  4WSP A;  2LJH A;  2EMY A;  1G2D C;  4GEQ B;  3LLH A;  4DV4 E;  1IBL E;  4O43 A;  5FLX C;  4F6M A;  1YZ9 A;  2WBS A;  4IJD A;  4WX9 A;  1L4S A;  2EM2 A;  3F6H A;  2EM9 A;  4X8W A;  2M9A A;  2EL5 A;  4B3M E;  4X9J A;  2YRM A;  3H09 A;  1N3G A;  4DR3 E;  1A1H A;  2VQF E;  2LJU A;  5IWA E;  4R2D A;  1STU A;  2ENA A;  2WZO A;  2JY9 A;  4F6N A;  2V88 A;  1PJT A;  2GHF A;  3KZZ A;  4O5G A;  3QG5 C;  1RC7 A;  4NXM E;  1T38 A;  4P78 A;  4M30 A;  2EL6 A;  2IHR 1;  1YPN A;  2EOI A;  1WJP A;  2EPP A;  2V8Q B;  2EMW A;  2EOM A;  1WRJ A;  1N33 E;  3EPL A;  3MHH C;  2V83 A;  2EOJ A;  3HPS A;  4BHB A;  4DR1 E;  2EML A;  2UXB E;  1BBO A;  4O24 A;  2YTF A;  2JR1 A;  2NAB A;  4R2C A;  3J7Y p;  2YTG A;  3HQ1 A;  4RH8 A;  2EM6 A;  2N8X A;  2EPU A;  5F3W A;  2EMX A;  2MC5 A;  4DR7 E;  2JWO A;  2LE2 A;  4LTY A;  5BR8 E;  1RQ0 A;  2F4V E;  4O4K A;  4JI1 E;  2ENC A;  2LMZ A;  3M99 B;  2L3J A;  2EN7 A;  1GZ6 A;  4F9B B;  4TUI A;  2DGC A;  5ADZ A;  4JYA E;  2LO3 A;  2CPN A;  2YU5 A;  4JI8 E;  2M7Q A;  2PRT A;  1IBM E;  4F9A B;  4JI4 E;  2EPL X;  2MC6 A;  1N36 E;  1XNR E;  5A6B D;  4LF5 E;  2YTD A;  1XNQ E;  2EM7 A;  4R2R A;  4NZV A;  2UXC E;  4DV5 E;  2L2M A;  2M4I A;  2I9I A;  1I94 E;  3C4T A;  2EP3 A;  4LFB E;  5AC4 A;  1X48 A;  1EH8 A;  1A1G A;  2J7J A;  5KL2 A;  2EOE A;  4LFA E;  4ZYD A;  2ELZ A;  5TSE A;  2GLI A;  3P1X A;  2NUG A;  3AV0 A;  1YYK A;  2CTD A;  3EPK A;  2DRP A;  2YWQ A;  2LUQ A;  2B3T B;  2EN3 A;  2KOU A;  4BS9 A;  2KON A;  2EMG A;  1MEY C;  5A69 A;  4F2J C;  4JI2 E;  4JI6 E;  3EPJ A;  4LF6 E;  1PKP A;  4I8O A;  4RHB B;  2ENH A;  3DF6 A;  4L5N C;  1T39 A;  2NUF A;  2WCC 3;  3RMP A;  4ZYH A;  3TQM A;  4WXC A;  1F2I G;  4LU9 A;  5AE3 A;  3K6Q A;  2K4V A;  1HR0 E;  2EMC A;  1IQO A;  1HNW E;  2EQ0 A;  1IMU A;  2V86 A;  2EOX A;  2EZ6 A;  4WXD A;  2HC5 A;  2EM8 A;  2EE8 A;  1JK2 A;  2A25 A;  3ADL A;  2YT4 A;  3C6M A;  2JXP A;  3T1H E;  2EL4 A;  4OOG C;  1UN6 B;  2MKD A;  2M1S A;  2E72 A;  2DSY A;  4JI3 E;  4DUZ E;  4KZS A;  1X49 A;  2UU9 E;  3ADJ A;  1RMD A;  2F8B A;  3EPH A;  5KL6 A;  1WHN A;  2D9H A;  2EPK X;  4LF4 E;  1XMQ E;  3OTO E;  4OX9 E;  1DI2 A;  4DV2 E;  4HEI A;  4ZYG A;  1FJG E;  4B3S E;  4BCA A;  3DJW A;  3VHT B;  5IV8 B;  2UUA E;  5A2Q C;  1WXR A;  2K7I A;  2DIX A;  5A6K A;  2RQL A;  4LF8 E;  2E1M A;  2N3G A;  3J7A G;  5KL3 A;  4Q28 A;  5LMN E;  2FTX B;  1GTK A;  2B9D A;  2L2N A;  2EQ1 A;  3OML A;  4R03 A;  1SFE A;  4F54 A;  4X64 E;  4FK5 C;  4R2A A;  2CSH A;  3J80 C;  1ZU1 A;  3ADI A;  4B3T E;  2DB2 A;  2EOO A;  2YSP A;  1A1L A;  2EWL A;  3LML A;  4LF9 E;  3UK3 C;  2DLQ A;  2B7V A;  3BGH A;  4GZN C;  2VQE E;  3C6K A;  3THO B;  1N34 E;  2I13 A;  2EQ3 A;  4R2E A;  2B7T A;  1X5W A;  4JI5 E;  2JVA A;  2EN4 A;  1IQS A;  1HNX E;  5A6A A;  1O0W A;  2DMY A;  5LL6 R;  2L8T A;  5LLQ A;  1ZR9 A;  4LFC E;  2NA2 A;  4WSG A;  2LV2 A;  3ADG A;  3EQ1 A;  5IT9 C;  2RTX A;  2VE7 C;  3VK6 A;  2E5L E;  2ODR D;  2YTP A;  2MKN A;  2EN1 A;  2G7H A;  4DKK A;  1X47 A;  4P7D A;  4DV7 E;  1YUJ A;  3HPZ A;  2LT7 A;  4NHR A;  4X65 E;  2EPO A;  4ZYE A;  2FGG A;  2EOR A;  1JK1 A;  4WYQ B;  3JTZ A;  2L6M A;  4N4R B;  2UXD E;  1TN9 A;  2EPZ A;  4M9V C;  4DUY E;  2HJJ A;  1NEI A;  2EMA A;  5AE1 A;  2EMH A;  1TF3 A;  2YRK A;  2YSO A;  2RS6 A;  1EH6 A;  4NXN E;  4BC7 A;  1YFH A;  2R1F A;  3VYX A;  4BBY A;  2EMB A;  2HHH E;  2EPR A;  1ZBT A;  3IWD A;  3HTX A;  4BMJ A;  2LRS A;  2DLK A;  1X6E A;  5CFF E;  3IWC A;  3AUZ A;  4M2Z A;  2EM0 A;  2BBG A;  4K0K E;  2JYA A;  1SR9 A;  4JI0 E;  2MDG A;  2YTN A;  4DV3 E;  1UHZ A;  2LVH A;  1QU6 A;  5DNY A;  2EPA A;  4DR4 E;  2L92 A;  4R2Q A;  2UUB E;  4YY3 E;  2RS7 A;  1NCS A;  3IWB A;  2EMZ A;  2WBU A;  1LLM C;  1QNT A;  4DV0 E;  2VRD A;  3C4B A;  2EOZ A;  5AC5 A;  1J26 A;  3KZY A;  2VF1 A;  4MLV A;  2EM3 A;  3MHS C;  5A6B A;  1A1F A;  2EMI A;  1X6F A;  4R2S A;  4X62 E;  1ZAA C;  1DGC A;  1T4N A;  4BHC A;  2ODR C;  3BBG A;  2V85 A;  4TUG A;  2EM5 A;  1YYO A;  2MDR A;  1A1I A;  3J81 C;  2YU8 A;  1UBD C;  2H36 X;  4IS1 C;  1B69 A;  2YRH A;  4KWY A;  1DQ3 A;  2EPX A;  1J5E E;  2JOX A;  1PDA A;  2LCE A;  2YZT A;  1WHQ A;  4AQY E;  2ELY A;  4YHH E;  2JOB A;  1PJQ A;  5KL4 A;  3ECR A;  1YSA C;  1A1K A;  4JV5 E;  1T4O A;  4F9C B;  4DR2 E;  2RSM A;  1Z1B A;  2DMI A;  2ZM6 E;  2EN6 A;  5KL7 A;  3ZOQ B;  4DR5 E;  2YTE A;  2N3H A;  3KWR A;  2ADR A;  4M0V A;  2R76 A;  3MSW A;  2HGH A;  3BF2 A;  1YUI A;  4JI7 E;  1BB8 A;  3L00 A;  2JP9 A;  2NUE A;  5IXM B;  4J8Z A;  2EOY A;  2EOF A;  2LTS A;  1N32 E;  2Q8U A;  4MLQ A;  2YTI A;  5LMU E;  1EKZ A;  2YTQ A;  1EH7 A;  2BB8 A;  1GQE A;  4GKK E;  3JU0 A;  1FKA E;  2YTJ A;  4R8O A;  5AAS A;  1UIL A;  4WFT A;  2EJ4 A;  1IBK E;  4HTG A;  4Q35 B;  2EPN A;  2EPM X;  2EMK A;  4DV1 E;  2EN2 A;  2EN8 A;  4LF7 E;  1X3C A;  1X6H A;  4DV6 E;  2RSI A;  4R2P A;  2WBT A;  1ZBQ A;  2RPC A;  2LUP B;  2CT1 A;  3VYY A;  2LTR A;  1YYW A;  4B3R E;  2UUC E;  2FV4 B;  1KYQ A;  2V87 A;  2YTO A;  2YPN A;  2L3C A;  1AH5 A;  1P47 A;  2L2K B;  2V89 A;  2EOH A;  3FIG A;  3F6G A;  4KHP E;  2EOQ A;  1A1J A;  3HXL A;  4GKJ E;  4BC9 A;  2JPA A;  5KL5 A;  1G2F C;  1HNZ E;  1TF6 A;  2GPI A;  3JAM C;  4WPY A;  3THN A;  3T1Y E;  4DR6 E;  5AE2 A;  3BID A;  4X66 E;  2KHX A;  2EM4 A;  1AAY A;  4DMI A;  2EMF A;  2EOS A;  1BBG A; 
#chains in the Genus database with same CATH homology
 4R2R A;  1A1I A;  2EPC A;  3UK3 C;  2DLQ A;  2YU8 A;  1UBD C;  4GZN C;  2EP3 A;  4IS1 C;  1B69 A;  2I13 A;  2EQ3 A;  4R2E A;  2YRH A;  1KJK A;  1A1G A;  2J7J A;  2EPX A;  2EOE A;  5KL2 A;  1X5W A;  2EMY A;  2ELZ A;  1G2D C;  2EN4 A;  2GLI A;  2CTD A;  2LCE A;  4F6M A;  3EPK A;  2DRP A;  2ELY A;  1ZR9 A;  2WBS A;  5KL4 A;  2EN3 A;  1YSA C;  1A1K A;  4WSG A;  2LV2 A;  4IJD A;  1MEY C;  2EMG A;  2EM2 A;  4F2J C;  2EM9 A;  1Z1B A;  2M9A A;  2DMI A;  3EPJ A;  2YTP A;  2MKN A;  2EN6 A;  2EL5 A;  2EN1 A;  5KL7 A;  2YTE A;  4X9J A;  2ADR A;  2HGH A;  2YRM A;  2ENH A;  1YUI A;  1YUJ A;  1BB8 A;  2LT7 A;  2JP9 A;  2WCC 3;  1A1L A;  2EOR A;  1JK1 A;  2EOY A;  1A1H A;  1F2I G;  4R2D A;  2ENA A;  2EOF A;  1TN9 A;  2EMC A;  2EQ0 A;  2EPZ A;  4M9V C;  4F6N A;  2EOX A;  2YTI A;  2EMA A;  2EM8 A;  2EMH A;  1TF3 A;  2YRK A;  2EE8 A;  2YSO A;  2YTQ A;  1JK2 A;  2BB8 A;  2A25 A;  2GHF A;  2YTJ A;  2R1F A;  2EJ4 A;  2EL4 A;  2EMB A;  2EPR A;  1UN6 B;  2MKD A;  2EL6 A;  2EMK A;  2E72 A;  2EN2 A;  2EN8 A;  2DLK A;  1X6E A;  1X3C A;  1WJP A;  2EOI A;  2EPP A;  1X6H A;  2RSI A;  2EMW A;  2EOM A;  4R2P A;  1RMD A;  3EPH A;  3EPL A;  2EM0 A;  3MHH C;  5KL6 A;  2WBT A;  2EOJ A;  2D9H A;  2RPC A;  2EML A;  2CT1 A;  2MDG A;  2YTN A;  1BBO A;  2YTF A;  2LVH A;  2NAB A;  2EPA A;  4R2C A;  2YTG A;  4R2Q A;  2YTO A;  1NCS A;  2EM6 A;  2EPU A;  2EMZ A;  2WBU A;  2EMX A;  3VHT B;  1LLM C;  1P47 A;  2VRD A;  2EOH A;  2EOZ A;  2ENC A;  3M99 B;  2EN7 A;  2EOQ A;  1A1J A;  2DGC A;  2EM3 A;  3MHS C;  5KL3 A;  5KL5 A;  2LO3 A;  1G2F C;  2JPA A;  1TF6 A;  1A1F A;  2EMI A;  2YU5 A;  1X6F A;  2EQ1 A;  4R2S A;  1ZAA C;  2PRT A;  4FK5 C;  4R2A A;  2CSH A;  1DGC A;  1ZU1 A;  2EM4 A;  2YTD A;  2EM5 A;  2EOO A;  1AAY A;  2EMF A;  2YSP A;  2EOS A;  2EM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...