2EMHA

Solution structure of the c2h2 type zinc finger (region 491-523) of human zinc finger protein 484
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGERPYICTVCGKAFTDRSNLIKHQKIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 484
publication title Solution structure of the C2H2 type zinc finger (region 491-523) of human Zinc finger protein 484
rcsb
source organism Homo sapiens
total genus 8
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emhA01
2VRDA 2EM2A 2EMXA 1NCSA 2EMWA 1UBDC 2DLKA 2EOQA 4F6MA 2LO3A 2DRPA 2EOMA 2EMYA 2EPUA 2EN6A 2M9AA 2DMIA 2YRMA 3VHTB 2EN3A 2EM5A 4R2SA 2EL6A 1A1GA 2YTQA 2EJ4A 3EPLA 2EOYA 2EOEA 1JK1A 2CTDA 1G2DC 2EL4A 2EN7A 1X6FA 2EN8A 2YTDA 2RSIA 1UN6B 4FK5C 1A1FA 1A1LA 3UK3C 2J7JA 4R2DA 2ELZA 2EOHA 1A1JA 2ENAA 3M99B 2EP3A 2EOFA 2E72A 1DGCA 2CT1A 2YTOA 5KL4A 2EM3A 2EPXA 1YUJA 4M9VC 2R1FA 3EPHA 4GZNC 1ZAAC 1BB8A 2EOOA 1P47A 1YUIA 1F2IG 2DLQA 2YTPA 2JP9A 2EMHA 1ZU1A 2YRHA 2EM0A 2EPZA 4WSGA 4R2AA 1TF6A 2WBUA 2GHFA 4R2PA 2EOJA 1X6HA 2YTNA 1Z1BA 1ZR9A 2EPPA 3EPJA 4F6NA 2EL5A 2DGCA 2EMIA 2EMGA 2YU5A 2YTJA 2EMAA 3MHSC 2NABA 2WBSA 5KL2A 2EPRA 2WBTA 2EOZA 1LLMC 2EN2A 2YRKA 2EMZA 2MKNA 1X6EA 2EQ1A 1WJPA 4R2EA 2EM6A 5KL5A 2EOIA 2LCEA 2EN4A 2EMFA 4IJDA 2EORA 1YSAC 4R2RA 2EOXA 1MEYC 4R2QA 2WCC3 2ELYA 5KL7A 5KL3A 2ADRA 2MKDA 4R2CA 2MDGA 1JK2A 1TN9A 2EOSA 1X3CA 2YTEA 4F2JC 2LVHA 2ENHA 2YSPA 2CSHA 2EM8A 2LV2A 1A1IA 1G2FC 2EMLA 2EM9A 2EN1A 4IS1C 1A1HA 2D9HA 5KL6A 1BBOA 2A25A 2EE8A 2I13A 4X9JA 2YU8A 3MHHC 2EPCA 2EM7A 2EM4A 2PRTA 2YTFA 2RPCA 2YSOA 1KJKA 2EQ0A 2EMBA 1RMDA 1X5WA 1B69A 2ENCA 2YTGA 2HGHA 3EPKA 1AAYA 1TF3A 2GLIA 2YTIA 2JPAA 2EMKA 2EQ3A 2BB8A 2LT7A 1A1KA 2EPAA 2EMCA
chains in the Genus database with same CATH superfamily
5A6BD 1PKPA 2M1SA 2EM2A 4F9AB 3HQ1A 3OMLA 4JI4E 2DRPA 2G7HA 3BF2A 1T39A 4X62E 2YRMA 4BC7A 2EPMX 5A6KA 1PJTA 3KWRA 1A1GA 3HXLA 4NXME 2LE2A 1X47A 3VK6A 2EOYA 1JK1A 3C6KA 3IWBA 3THOB 1X6FA 2N8XA 1N33E 2F4VE 4FK5C 4DV0E 4X8WA 2LJHA 2ENAA 5LMUE 4L5NC 2E72A 1DGCA 1X49A 2LRSA 1YUJA 2LTRA 2JWOA 1ZAAC 1ZBQA 3IWCA 1WHNA 2JOXA 4BMJA 4ZYEA 2UU9E 4TUGA 2YTPA 1HNZE 5FLXC 2B7TA 2EPZA 2WZOA 3LMLA 4WSGA 1X48A 1IMUA 2EOJA 2EPPA 4P7DA 3EPJA 4OOGC 4X65E 2JVAA 2EMIA 3VYYA 2YTJA 3MHSC 1GQEA 4DV2E 1GTKA 1LLMC 4O43A 2EMZA 4LFCE 4JYAE 4L8NA 2MKNA 1X6EA 1RQ0A 1PDAA 4K0KE 4R2EA 4NZVA 5LMNE 4IJDA 2EORA 4R2RA 4DR7E 2WCC3 1IBLE 5A6BA 1JK2A 4TUIA 5IWAE 2EPKX 4DR3E 2CSHA 2EPLX 2Q8UA 3BBGA 3DJWA 4Q28A 4DV4E 4IS1C 4NXNE 5KL6A 1BBOA 2V86A 4BS9A 3F6GA 2HC5A 2EPCA 4BHCA 4OX9E 2YTFA 1DQ3A 2LUQA 1KJKA 2I9IA 2EWLA 4O24A 2EMBA 1RMDA 2V88A 2ENCA 3T1HE 2HGHA 1YZ9A 1AAYA 1TF3A 2KHXA 2RS6A 3LLHA 3C4BA 5KL2A 5AASA 4DV6E 1NCSA 2V85A 5F3WA 2JXPA 2ODRC 2R76A 2EN6A 1QNTA 2YWQA 4YY3E 2DMIA 2V8QB 5TSEA 2EM5A 1O0WA 2YTQA 2RS7A 3EPLA 1FKAE 2L2NA 2UUCE 2CTDA 4DR2E 3H09A 2B3TB 2DSYA 2VE7C 4RH8A 1SR9A 2YTDA 3P1XA 2FV4B 2NUGA 3L00A 2FTXB 2KOUA 1A1LA 3J81C 4BBYA 2J7JA 4R2DA 1HR0E 5AE1A 4F54A 3M99B 2EP3A 2EOFA 2YTOA 2GPIA 3ZOQB 2L8TA 1XNQE 3J7Yp 1N34E 2YT4A 5BR8E 2LUPB 4MLVA 2JP9A 2EMHA 4B3RE 1ZU1A 2EPNA 4JV5E 3HTXA 2LJUA 5A69A 1ZR9A 4YHHE 2EL5A 2L6MA 2DIXA 2EMAA 3JAMC 4DR6E 4O5GA 2V87A 4DR5E 4F9CB 4LF4E 1IQOA 2HHHE 1WJPA 5KL5A 4JI6E 1BBGA 3IWDA 2N3HA 4JI3E 2EOXA 4WXCA 2LBSB 1MEYC 2ADRA 3QG5C 4KWYA 2EOSA 5AE2A 4F2JC 2LVHA 1YFHA 2E5LE 1L4SA 1HNXE 4Q35B 2HJJA 3AV0A 2ENHA 2LTSA 1A1IA 1A1HA 2EN1A 3HPZA 2A25A 3T1YE 4LTYA 2I13A 4LF9E 4X9JA 2UXDE 4RHBB 3J80C 1YYKA 2YSOA 5LLQA 1N3GA 2K4VA 1I94E 3EPKA 2YTIA 2EQ3A 5CFFE 4GKKE 4F9BB 2LT7A 1RC7A 2EPAA 1N36E 1YYOA 1YYWA 1FJGE 2EMWA 2FGGA 1UBDC 1IQSA 2VF1A 3JU0A 4DUZE 2LO3A 2EOMA 1EH6A 1SFEA 2H36X 3JTZA 3ADLA 2IHR1 3VHTB 4M30A 2L92A 2EN3A 4WYQB 3FIGA 4WXDA 5IXMB 3K6QA 2NUFA 5ADZA 4ZYGA 4DKKA 1EKZA 4KHPE 1G2DC 4JI8E 3EQ1A 2EN7A 2EN8A 2YZTA 5IV8B 2RSIA 2JY9A 1A1FA 3UK3C 3VYXA 4DV5E 2ELZA 5T6JA 4JI2E 1A1JA 1HNWE 5KL4A 2MDRA 4M9VC 2EPXA 4DV1E 2R1FA 3EPHA 4KZSA 4DUYE 1YUIA 1WXRA 4GKJE 3F6HA 2DLQA 1PJSA 2YRHA 2GHFA 1X6HA 4GEQB 2DB2A 1XMOE 4HTGA 2EMGA 2YU5A 2L2KB 2NABA 1XNRE 3KZYA 4LF5E 5A6AA 2WBTA 4DR1E 2UXCE 2EN2A 4WFTA 1UHZA 2L3CA 4O4KA 2EQ1A 4LF8E 1J26A 3KZZA 1MGTA 5IT9C 2EM6A 2EOIA 2LCEA 2EN4A 2LMZA 2EMFA 3HPSA 4R2QA 3RMPA 5KL7A 5KL3A 2MKDA 2RQLA 4R2CA 1IBKE 4WX9A 1TN9A 1YPNA 4DR4E 1XMQE 1IBME 2YSPA 2EM8A 1EH8A 2LV2A 1G2FC 2EMLA 2EM9A 4JI0E 2RSMA 1EH7A 2UUAE 1GZ6A 2L3JA 3MHHC 2BBGA 1ZBTA 2EM4A 4LU9A 1N32E 2EQ0A 2ODRD 1B69A 4R8OA 1T4OA 5A6JA 3BIDA 2EMCA 4B3ME 2V83A 2VRDA 2EMXA 3OTOE 5AC4A 2M4IA 2L33A 2DLKA 2EOQA 4NHRA 4F6MA 5AE3A 4J8ZA 2EMYA 2EPUA 4ZYDA 1T4NA 3THNA 1PJQA 2KONA 2M9AA 4R2SA 2F8BA 2EL6A 4WSPA 4M2ZA 2UXBE 2EJ4A 2CPNA 2EOEA 4HEIA 2B7VA 4DMIA 2V89A 4P78A 1STUA 1KYQA 2EL4A 4JI5E 4B3TE 4BC9A 1UN6B 1DI2A 3C4TA 1QU6A 4LF6E 3AUZA 2EOHA 3J7AG 5DNYA 2CT1A 1J5EE 5A2QC 3BGHA 4M0VA 2EM3A 3TQMA 4GZNC 4B3SE 2L2MA 1BB8A 2EOOA 1P47A 4LFBE 2VQEE 1F2IG 4ZYHA 2MC6A 2NA2A 5AC5A 2VQFE 4LFAE 4JI1E 2EM0A 3DF6A 4R2AA 1TF6A 2N3GA 2WBUA 4R2PA 4AQYE 2YTNA 3ECRA 1Z1BA 4F6NA 1WRJA 2DGCA 3C6MA 4X64E 2WBSA 2EPRA 2EOZA 3ADJA 2EZ6A 2YRKA 3ADGA 1NEIA 4JI7E 4DV3E 1T38A 4DV7E 4MLQA 1YSAC 2B9DA 1WHQA 1T4LB 2ELYA 2NUEA 2M7QA 2MDGA 1X3CA 2YTEA 3MSWA 2RTXA 4R03A 2UUBE 2JR1A 2ZM6E 2JOBA 4BHBA 4N4RB 2D9HA 1UILA 1AH5A 2K7IA 2EE8A 4LF7E 2YU8A 4X66E 4BCAA 2MC5A 2EM7A 2PRTA 2RPCA 4I8OA 1X5WA 2YPNA 2YTGA 2JYAA 2GLIA 2JPAA 2EMKA 4WPYA 2BB8A 2E1MA 3ADIA 5LL6R 1A1KA 2DMYA 2EPOA
chains in the Genus database with same CATH topology
2VRDA 2EM2A 2EMXA 1NCSA 2EMWA 1UBDC 2DLKA 2EOQA 4F6MA 2LO3A 2DRPA 2EOMA 2EMYA 2EPUA 2EN6A 2M9AA 2DMIA 2YRMA 3VHTB 2EN3A 2EM5A 4R2SA 2EL6A 1A1GA 2YTQA 2EJ4A 3EPLA 2EOYA 2EOEA 1JK1A 2CTDA 1G2DC 2EL4A 2EN7A 1X6FA 2EN8A 2YTDA 2RSIA 1UN6B 4FK5C 1A1FA 1A1LA 3UK3C 2J7JA 4R2DA 2ELZA 2EOHA 1A1JA 2ENAA 3M99B 2EP3A 2EOFA 2E72A 1DGCA 2CT1A 2YTOA 5KL4A 2EM3A 2EPXA 1YUJA 4M9VC 2R1FA 3EPHA 4GZNC 1ZAAC 1BB8A 2EOOA 1P47A 1YUIA 1F2IG 2DLQA 2YTPA 2JP9A 2EMHA 1ZU1A 2YRHA 2EM0A 2EPZA 4WSGA 4R2AA 1TF6A 2WBUA 2GHFA 4R2PA 2EOJA 1X6HA 2YTNA 1Z1BA 1ZR9A 2EPPA 3EPJA 4F6NA 2EL5A 2DGCA 2EMIA 2EMGA 2YU5A 2YTJA 2EMAA 3MHSC 2NABA 2WBSA 5KL2A 2EPRA 2WBTA 2EOZA 1LLMC 2EN2A 2YRKA 2EMZA 2MKNA 1X6EA 2EQ1A 1WJPA 4R2EA 2EM6A 5KL5A 2EOIA 2LCEA 2EN4A 2EMFA 4IJDA 2EORA 1YSAC 4R2RA 2EOXA 1MEYC 4R2QA 2WCC3 2ELYA 5KL7A 5KL3A 2ADRA 2MKDA 4R2CA 2MDGA 1JK2A 1TN9A 2EOSA 1X3CA 2YTEA 4F2JC 2LVHA 2ENHA 2YSPA 2CSHA 2EM8A 2LV2A 1A1IA 1G2FC 2EMLA 2EM9A 2EN1A 4IS1C 1A1HA 2D9HA 5KL6A 1BBOA 2A25A 2EE8A 2I13A 4X9JA 2YU8A 3MHHC 2EPCA 2EM7A 2EM4A 2PRTA 2YTFA 2RPCA 2YSOA 1KJKA 2EQ0A 2EMBA 1RMDA 1X5WA 1B69A 2ENCA 2YTGA 2HGHA 3EPKA 1AAYA 1TF3A 2GLIA 2YTIA 2JPAA 2EMKA 2EQ3A 2BB8A 2LT7A 1A1KA 2EPAA 2EMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VRD A;  2EM2 A;  2EMX A;  1NCS A;  2EMW A;  1UBD C;  2DLK A;  2EOQ A;  4F6M A;  2LO3 A;  2DRP A;  2EOM A;  2EMY A;  2EPU A;  2EN6 A;  2M9A A;  2DMI A;  2YRM A;  3VHT B;  2EN3 A;  2EM5 A;  4R2S A;  2EL6 A;  1A1G A;  2YTQ A;  2EJ4 A;  3EPL A;  2EOY A;  2EOE A;  1JK1 A;  2CTD A;  1G2D C;  2EL4 A;  2EN7 A;  1X6F A;  2EN8 A;  2YTD A;  2RSI A;  1UN6 B;  4FK5 C;  1A1F A;  1A1L A;  3UK3 C;  2J7J A;  4R2D A;  2ELZ A;  2EOH A;  1A1J A;  2ENA A;  3M99 B;  2EP3 A;  2EOF A;  2E72 A;  1DGC A;  2CT1 A;  2YTO A;  5KL4 A;  2EM3 A;  2EPX A;  1YUJ A;  4M9V C;  2R1F A;  3EPH A;  4GZN C;  1ZAA C;  1BB8 A;  2EOO A;  1P47 A;  1YUI A;  1F2I G;  2DLQ A;  2YTP A;  2JP9 A;  2EMH A;  1ZU1 A;  2YRH A;  2EM0 A;  2EPZ A;  4WSG A;  4R2A A;  1TF6 A;  2WBU A;  2GHF A;  4R2P A;  2EOJ A;  1X6H A;  2YTN A;  1Z1B A;  1ZR9 A;  2EPP A;  3EPJ A;  4F6N A;  2EL5 A;  2DGC A;  2EMI A;  2EMG A;  2YU5 A;  2YTJ A;  2EMA A;  3MHS C;  2NAB A;  2WBS A;  5KL2 A;  2EPR A;  2WBT A;  2EOZ A;  1LLM C;  2EN2 A;  2YRK A;  2EMZ A;  2MKN A;  1X6E A;  2EQ1 A;  1WJP A;  4R2E A;  2EM6 A;  5KL5 A;  2EOI A;  2LCE A;  2EN4 A;  2EMF A;  4IJD A;  2EOR A;  1YSA C;  4R2R A;  2EOX A;  1MEY C;  4R2Q A;  2WCC 3;  2ELY A;  5KL7 A;  5KL3 A;  2ADR A;  2MKD A;  4R2C A;  2MDG A;  1JK2 A;  1TN9 A;  2EOS A;  1X3C A;  2YTE A;  4F2J C;  2LVH A;  2ENH A;  2YSP A;  2CSH A;  2EM8 A;  2LV2 A;  1A1I A;  1G2F C;  2EML A;  2EM9 A;  2EN1 A;  4IS1 C;  1A1H A;  2D9H A;  5KL6 A;  1BBO A;  2A25 A;  2EE8 A;  2I13 A;  4X9J A;  2YU8 A;  3MHH C;  2EPC A;  2EM7 A;  2EM4 A;  2PRT A;  2YTF A;  2RPC A;  2YSO A;  1KJK A;  2EQ0 A;  2EMB A;  1RMD A;  1X5W A;  1B69 A;  2ENC A;  2YTG A;  2HGH A;  3EPK A;  1AAY A;  1TF3 A;  2GLI A;  2YTI A;  2JPA A;  2EMK A;  2EQ3 A;  2BB8 A;  2LT7 A;  1A1K A;  2EPA A;  2EMC A; 
#chains in the Genus database with same CATH topology
 5A6B D;  1PKP A;  2M1S A;  2EM2 A;  4F9A B;  3HQ1 A;  3OML A;  4JI4 E;  2DRP A;  2G7H A;  3BF2 A;  1T39 A;  4X62 E;  2YRM A;  4BC7 A;  2EPM X;  5A6K A;  1PJT A;  3KWR A;  1A1G A;  3HXL A;  4NXM E;  2LE2 A;  1X47 A;  3VK6 A;  2EOY A;  1JK1 A;  3C6K A;  3IWB A;  3THO B;  1X6F A;  2N8X A;  1N33 E;  2F4V E;  4FK5 C;  4DV0 E;  4X8W A;  2LJH A;  2ENA A;  5LMU E;  4L5N C;  2E72 A;  1DGC A;  1X49 A;  2LRS A;  1YUJ A;  2LTR A;  2JWO A;  1ZAA C;  1ZBQ A;  3IWC A;  1WHN A;  2JOX A;  4BMJ A;  4ZYE A;  2UU9 E;  4TUG A;  2YTP A;  1HNZ E;  5FLX C;  2B7T A;  2EPZ A;  2WZO A;  3LML A;  4WSG A;  1X48 A;  1IMU A;  2EOJ A;  2EPP A;  4P7D A;  3EPJ A;  4OOG C;  4X65 E;  2JVA A;  2EMI A;  3VYY A;  2YTJ A;  3MHS C;  1GQE A;  4DV2 E;  1GTK A;  1LLM C;  4O43 A;  2EMZ A;  4LFC E;  4JYA E;  4L8N A;  2MKN A;  1X6E A;  1RQ0 A;  1PDA A;  4K0K E;  4R2E A;  4NZV A;  5LMN E;  4IJD A;  2EOR A;  4R2R A;  4DR7 E;  2WCC 3;  1IBL E;  5A6B A;  1JK2 A;  4TUI A;  5IWA E;  2EPK X;  4DR3 E;  2CSH A;  2EPL X;  2Q8U A;  3BBG A;  3DJW A;  4Q28 A;  4DV4 E;  4IS1 C;  4NXN E;  5KL6 A;  1BBO A;  2V86 A;  4BS9 A;  3F6G A;  2HC5 A;  2EPC A;  4BHC A;  4OX9 E;  2YTF A;  1DQ3 A;  2LUQ A;  1KJK A;  2I9I A;  2EWL A;  4O24 A;  2EMB A;  1RMD A;  2V88 A;  2ENC A;  3T1H E;  2HGH A;  1YZ9 A;  1AAY A;  1TF3 A;  2KHX A;  2RS6 A;  3LLH A;  3C4B A;  5KL2 A;  5AAS A;  4DV6 E;  1NCS A;  2V85 A;  5F3W A;  2JXP A;  2ODR C;  2R76 A;  2EN6 A;  1QNT A;  2YWQ A;  4YY3 E;  2DMI A;  2V8Q B;  5TSE A;  2EM5 A;  1O0W A;  2YTQ A;  2RS7 A;  3EPL A;  1FKA E;  2L2N A;  2UUC E;  2CTD A;  4DR2 E;  3H09 A;  2B3T B;  2DSY A;  2VE7 C;  4RH8 A;  1SR9 A;  2YTD A;  3P1X A;  2FV4 B;  2NUG A;  3L00 A;  2FTX B;  2KOU A;  1A1L A;  3J81 C;  4BBY A;  2J7J A;  4R2D A;  1HR0 E;  5AE1 A;  4F54 A;  3M99 B;  2EP3 A;  2EOF A;  2YTO A;  2GPI A;  3ZOQ B;  2L8T A;  1XNQ E;  3J7Y p;  1N34 E;  2YT4 A;  5BR8 E;  2LUP B;  4MLV A;  2JP9 A;  2EMH A;  4B3R E;  1ZU1 A;  2EPN A;  4JV5 E;  3HTX A;  2LJU A;  5A69 A;  1ZR9 A;  4YHH E;  2EL5 A;  2L6M A;  2DIX A;  2EMA A;  3JAM C;  4DR6 E;  4O5G A;  2V87 A;  4DR5 E;  4F9C B;  4LF4 E;  1IQO A;  2HHH E;  1WJP A;  5KL5 A;  4JI6 E;  1BBG A;  3IWD A;  2N3H A;  4JI3 E;  2EOX A;  4WXC A;  2LBS B;  1MEY C;  2ADR A;  3QG5 C;  4KWY A;  2EOS A;  5AE2 A;  4F2J C;  2LVH A;  1YFH A;  2E5L E;  1L4S A;  1HNX E;  4Q35 B;  2HJJ A;  3AV0 A;  2ENH A;  2LTS A;  1A1I A;  1A1H A;  2EN1 A;  3HPZ A;  2A25 A;  3T1Y E;  4LTY A;  2I13 A;  4LF9 E;  4X9J A;  2UXD E;  4RHB B;  3J80 C;  1YYK A;  2YSO A;  5LLQ A;  1N3G A;  2K4V A;  1I94 E;  3EPK A;  2YTI A;  2EQ3 A;  5CFF E;  4GKK E;  4F9B B;  2LT7 A;  1RC7 A;  2EPA A;  1N36 E;  1YYO A;  1YYW A;  1FJG E;  2EMW A;  2FGG A;  1UBD C;  1IQS A;  2VF1 A;  3JU0 A;  4DUZ E;  2LO3 A;  2EOM A;  1EH6 A;  1SFE A;  2H36 X;  3JTZ A;  3ADL A;  2IHR 1;  3VHT B;  4M30 A;  2L92 A;  2EN3 A;  4WYQ B;  3FIG A;  4WXD A;  5IXM B;  3K6Q A;  2NUF A;  5ADZ A;  4ZYG A;  4DKK A;  1EKZ A;  4KHP E;  1G2D C;  4JI8 E;  3EQ1 A;  2EN7 A;  2EN8 A;  2YZT A;  5IV8 B;  2RSI A;  2JY9 A;  1A1F A;  3UK3 C;  3VYX A;  4DV5 E;  2ELZ A;  5T6J A;  4JI2 E;  1A1J A;  1HNW E;  5KL4 A;  2MDR A;  4M9V C;  2EPX A;  4DV1 E;  2R1F A;  3EPH A;  4KZS A;  4DUY E;  1YUI A;  1WXR A;  4GKJ E;  3F6H A;  2DLQ A;  1PJS A;  2YRH A;  2GHF A;  1X6H A;  4GEQ B;  2DB2 A;  1XMO E;  4HTG A;  2EMG A;  2YU5 A;  2L2K B;  2NAB A;  1XNR E;  3KZY A;  4LF5 E;  5A6A A;  2WBT A;  4DR1 E;  2UXC E;  2EN2 A;  4WFT A;  1UHZ A;  2L3C A;  4O4K A;  2EQ1 A;  4LF8 E;  1J26 A;  3KZZ A;  1MGT A;  5IT9 C;  2EM6 A;  2EOI A;  2LCE A;  2EN4 A;  2LMZ A;  2EMF A;  3HPS A;  4R2Q A;  3RMP A;  5KL7 A;  5KL3 A;  2MKD A;  2RQL A;  4R2C A;  1IBK E;  4WX9 A;  1TN9 A;  1YPN A;  4DR4 E;  1XMQ E;  1IBM E;  2YSP A;  2EM8 A;  1EH8 A;  2LV2 A;  1G2F C;  2EML A;  2EM9 A;  4JI0 E;  2RSM A;  1EH7 A;  2UUA E;  1GZ6 A;  2L3J A;  3MHH C;  2BBG A;  1ZBT A;  2EM4 A;  4LU9 A;  1N32 E;  2EQ0 A;  2ODR D;  1B69 A;  4R8O A;  1T4O A;  5A6J A;  3BID A;  2EMC A;  4B3M E;  2V83 A;  2VRD A;  2EMX A;  3OTO E;  5AC4 A;  2M4I A;  2L33 A;  2DLK A;  2EOQ A;  4NHR A;  4F6M A;  5AE3 A;  4J8Z A;  2EMY A;  2EPU A;  4ZYD A;  1T4N A;  3THN A;  1PJQ A;  2KON A;  2M9A A;  4R2S A;  2F8B A;  2EL6 A;  4WSP A;  4M2Z A;  2UXB E;  2EJ4 A;  2CPN A;  2EOE A;  4HEI A;  2B7V A;  4DMI A;  2V89 A;  4P78 A;  1STU A;  1KYQ A;  2EL4 A;  4JI5 E;  4B3T E;  4BC9 A;  1UN6 B;  1DI2 A;  3C4T A;  1QU6 A;  4LF6 E;  3AUZ A;  2EOH A;  3J7A G;  5DNY A;  2CT1 A;  1J5E E;  5A2Q C;  3BGH A;  4M0V A;  2EM3 A;  3TQM A;  4GZN C;  4B3S E;  2L2M A;  1BB8 A;  2EOO A;  1P47 A;  4LFB E;  2VQE E;  1F2I G;  4ZYH A;  2MC6 A;  2NA2 A;  5AC5 A;  2VQF E;  4LFA E;  4JI1 E;  2EM0 A;  3DF6 A;  4R2A A;  1TF6 A;  2N3G A;  2WBU A;  4R2P A;  4AQY E;  2YTN A;  3ECR A;  1Z1B A;  4F6N A;  1WRJ A;  2DGC A;  3C6M A;  4X64 E;  2WBS A;  2EPR A;  2EOZ A;  3ADJ A;  2EZ6 A;  2YRK A;  3ADG A;  1NEI A;  4JI7 E;  4DV3 E;  1T38 A;  4DV7 E;  4MLQ A;  1YSA C;  2B9D A;  1WHQ A;  1T4L B;  2ELY A;  2NUE A;  2M7Q A;  2MDG A;  1X3C A;  2YTE A;  3MSW A;  2RTX A;  4R03 A;  2UUB E;  2JR1 A;  2ZM6 E;  2JOB A;  4BHB A;  4N4R B;  2D9H A;  1UIL A;  1AH5 A;  2K7I A;  2EE8 A;  4LF7 E;  2YU8 A;  4X66 E;  4BCA A;  2MC5 A;  2EM7 A;  2PRT A;  2RPC A;  4I8O A;  1X5W A;  2YPN A;  2YTG A;  2JYA A;  2GLI A;  2JPA A;  2EMK A;  4WPY A;  2BB8 A;  2E1M A;  3ADI A;  5LL6 R;  1A1K A;  2DMY A;  2EPO A; 
#chains in the Genus database with same CATH homology
 2VRD A;  2EM2 A;  2EMX A;  1NCS A;  2EMW A;  1UBD C;  2DLK A;  2EOQ A;  4F6M A;  2LO3 A;  2DRP A;  2EOM A;  2EMY A;  2EPU A;  2EN6 A;  2M9A A;  2DMI A;  2YRM A;  3VHT B;  2EN3 A;  2EM5 A;  4R2S A;  2EL6 A;  1A1G A;  2YTQ A;  2EJ4 A;  3EPL A;  2EOY A;  2EOE A;  1JK1 A;  2CTD A;  1G2D C;  2EL4 A;  2EN7 A;  1X6F A;  2EN8 A;  2YTD A;  2RSI A;  1UN6 B;  4FK5 C;  1A1F A;  1A1L A;  3UK3 C;  2J7J A;  4R2D A;  2ELZ A;  2EOH A;  1A1J A;  2ENA A;  3M99 B;  2EP3 A;  2EOF A;  2E72 A;  1DGC A;  2CT1 A;  2YTO A;  5KL4 A;  2EM3 A;  2EPX A;  1YUJ A;  4M9V C;  2R1F A;  3EPH A;  4GZN C;  1ZAA C;  1BB8 A;  2EOO A;  1P47 A;  1YUI A;  1F2I G;  2DLQ A;  2YTP A;  2JP9 A;  2EMH A;  1ZU1 A;  2YRH A;  2EM0 A;  2EPZ A;  4WSG A;  4R2A A;  1TF6 A;  2WBU A;  2GHF A;  4R2P A;  2EOJ A;  1X6H A;  2YTN A;  1Z1B A;  1ZR9 A;  2EPP A;  3EPJ A;  4F6N A;  2EL5 A;  2DGC A;  2EMI A;  2EMG A;  2YU5 A;  2YTJ A;  2EMA A;  3MHS C;  2NAB A;  2WBS A;  5KL2 A;  2EPR A;  2WBT A;  2EOZ A;  1LLM C;  2EN2 A;  2YRK A;  2EMZ A;  2MKN A;  1X6E A;  2EQ1 A;  1WJP A;  4R2E A;  2EM6 A;  5KL5 A;  2EOI A;  2LCE A;  2EN4 A;  2EMF A;  4IJD A;  2EOR A;  1YSA C;  4R2R A;  2EOX A;  1MEY C;  4R2Q A;  2WCC 3;  2ELY A;  5KL7 A;  5KL3 A;  2ADR A;  2MKD A;  4R2C A;  2MDG A;  1JK2 A;  1TN9 A;  2EOS A;  1X3C A;  2YTE A;  4F2J C;  2LVH A;  2ENH A;  2YSP A;  2CSH A;  2EM8 A;  2LV2 A;  1A1I A;  1G2F C;  2EML A;  2EM9 A;  2EN1 A;  4IS1 C;  1A1H A;  2D9H A;  5KL6 A;  1BBO A;  2A25 A;  2EE8 A;  2I13 A;  4X9J A;  2YU8 A;  3MHH C;  2EPC A;  2EM7 A;  2EM4 A;  2PRT A;  2YTF A;  2RPC A;  2YSO A;  1KJK A;  2EQ0 A;  2EMB A;  1RMD A;  1X5W A;  1B69 A;  2ENC A;  2YTG A;  2HGH A;  3EPK A;  1AAY A;  1TF3 A;  2GLI A;  2YTI A;  2JPA A;  2EMK A;  2EQ3 A;  2BB8 A;  2LT7 A;  1A1K A;  2EPA A;  2EMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...