2EMHA

Solution structure of the c2h2 type zinc finger (region 491-523) of human zinc finger protein 484
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGERPYICTVCGKAFTDRSNLIKHQKIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 484
publication title Solution structure of the C2H2 type zinc finger (region 491-523) of human Zinc finger protein 484
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 8
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emhA01
2EOQA 3EPHA 3MHSC 2BB8A 2EOYA 2EQ0A 5KL3A 2YU8A 3VHTB 2R1FA 2EOFA 2ENAA 4R2DA 2YTIA 1BB8A 2EPPA 4R2PA 2EMKA 3EPLA 2EL5A 2EM4A 2EPUA 1JK1A 2MDGA 1YUJA 2LCEA 2WBTA 1A1FA 2EOOA 1A1KA 1DGCA 4F6NA 2EQ3A 1ZU1A 2LV2A 1G2FC 2RPCA 2EOMA 2WBSA 2PRTA 2VRDA 2EOXA 4R2QA 1YSAC 2EPZA 4F2JC 2JPAA 1X6FA 2EN3A 1ZAAC 2E72A 3M99B 4F6MA 2WBUA 1TF3A 4R2EA 1UBDC 2YTQA 2EN2A 2EL6A 1WJPA 2EN4A 2YRMA 2EMWA 1RMDA 2EOHA 2ELZA 1A1LA 2EOIA 4M9VC 4FK5C 2EMAA 5KL4A 2LVHA 4X9JA 1BBOA 1ZR9A 2I13A 3EPJA 2EMXA 1X5WA 2DGCA 2EOZA 1G2DC 2YTNA 2YRKA 2EMHA 2EPAA 2EN6A 2YTPA 2NABA 2EMZA 2EM2A 5KL2A 1B69A 2CSHA 2EORA 2DLQA 2YTGA 3EPKA 1X6HA 2EOJA 1Z1BA 1AAYA 2DLKA 2YTDA 5KL6A 2YTJA 2LO3A 2ELYA 2EOSA 2YTOA 1X6EA 2RSIA 2DMIA 2A25A 2EMGA 2YU5A 2HGHA 4IS1C 2YTFA 2J7JA 2EN1A 1F2IG 5KL5A 2EL4A 2EM3A 2EMFA 2YSPA 2YSOA 4GZNC 2CT1A 2YTEA 2D9HA 2EM7A 1YUIA 2EOEA 2EJ4A 1MEYC 1UN6B 2MKDA 2EP3A 2EMIA 2YRHA 2EN8A 2EPXA 2ENHA 2EM8A 1LLMC 2CTDA 1TF6A 4R2SA 3UK3C 2EPCA 4R2RA 2EMYA 2ENCA 1TN9A 2JP9A 2EQ1A 1KJKA 2M9AA 2EMBA 2EN7A 3MHHC 1A1JA 2EM6A 2EM9A 4IJDA 2MKNA 2EM5A 4R2CA 2EM0A 2EPRA 2GLIA 2DRPA 2EMCA 2LT7A 1A1GA 2WCC3 4R2AA 2ADRA 1A1IA 2EE8A 1NCSA 1X3CA 1P47A 1A1HA 2GHFA 1JK2A 2EMLA 5KL7A 4WSGA
chains in the Genus database with same CATH superfamily
5A6KA 1GQEA 4X66E 4DR1E 2G7HA 4F54A 2GPIA 3TQMA 1DQ3A 2EPPA 2EMKA 2K4VA 2EM4A 3VK6A 1YYOA 4JI3E 4DR5E 1YZ9A 1JK1A 1YUJA 2LCEA 1IQSA 3HPZA 1WXRA 2FTXB 2EOOA 1A1KA 4GEQB 2I9IA 4JI4E 5A2QC 2PRTA 4LFAE 4BHBA 4DR2E 5AE2A 2R76A 3ZOQB 2EPNA 2E72A 3M99B 4F6MA 4JI0E 3ADIA 4R2EA 2YTQA 2EN2A 1O0WA 5AE1A 4BC9A 2YRMA 2EMWA 4ZYDA 4LF7E 1RMDA 5A69A 4FK5C 4GKKE 5ADZA 2B9DA 4M2ZA 2EMAA 3K6QA 3ADGA 3THNA 2EMXA 4AQYE 2DGCA 2EOZA 2EPMX 2YTNA 4K0KE 4DV5E 4JI5E 2YRKA 5DNYA 1X48A 2JVAA 1FKAE 4JV5E 3EQ1A 2HC5A 4DKKA 3AV0A 2YPNA 2YTDA 5F3WA 4OOGC 2YTJA 2EOSA 1BBGA 2YTOA 4J8ZA 4P78A 1WRJA 2LBSB 2YU5A 2LUQA 3DJWA 3BBGA 5T6JA 1F2IG 2YSPA 4DR4E 2YTEA 3HQ1A 1YUIA 2EOEA 2EJ4A 4JI2E 2MKDA 1X49A 5A6AA 2CTDA 1J5EE 2FGGA 3UK3C 4ZYHA 3ECRA 4RH8A 2EPKX 2EQ1A 2L6MA 4DUYE 2EMBA 2EN7A 2EM6A 1FJGE 4JYAE 4NZVA 4R2CA 4RHBB 2EPRA 2DRPA 2EMCA 1A1GA 2WCC3 3C4BA 2HHHE 1NCSA 4LF6E 4KHPE 1A1HA 2M7QA 3F6HA 4ZYEA 3EPHA 5KL3A 2DB2A 1SFEA 1I94E 2L2NA 2EOFA 4YHHE 4R2DA 1BB8A 3JTZA 1WHNA 5IWAE 4TUGA 3KWRA 1DGCA 2EQ3A 2RSMA 1SR9A 2LV2A 2VE7C 1G2FC 4B3TE 1HNWE 1PKPA 2L3JA 1T4LB 2EOXA 1YYKA 4LF5E 2UXCE 1YPNA 4BCAA 2RS6A 2WBUA 3ADLA 1EKZA 3IWCA 2DSYA 4NXNE 2BBGA 4Q28A 1UBDC 3KZYA 4F9CB 2EL6A 1IBME 5IXMB 1WJPA 4LFBE 1RC7A 4F9AB 4M9VC 2UUCE 3THOB 5KL4A 4WXCA 1BBOA 3LLHA 3EPJA 1MGTA 4BS9A 4O4KA 2EPAA 2L3CA 2NABA 4X62E 1B69A 4MLQA 1QU6A 2YTGA 2UU9E 4DR3E 2NUGA 2DLKA 5KL6A 2K7IA 2FV4B 3JAMC 3VYXA 3LMLA 3F6GA 1IMUA 1GTKA 3ADJA 2RQLA 5KL5A 1RQ0A 2MC5A 4GZNC 1AH5A 2EM7A 4JI6E 3J7Yp 1T4OA 2N3GA 2EP3A 2MC6A 3OMLA 4O5GA 3J7AG 2EM8A 2B3TB 1NEIA 1TF6A 1J26A 3H09A 1ZBTA 2ENCA 1N3GA 1TN9A 2V88A 1A1JA 1GZ6A 4LFCE 2UUAE 4WSPA 4DV4E 1XNQE 5IV8B 4JI8E 4M0VA 4MLVA 4N4RB 1N36E 1A1IA 1UHZA 4R2AA 4BC7A 1EH8A 3HXLA 2M4IA 4WYQB 2E5LE 3QG5C 2LMZA 3HTXA 2DIXA 2NA2A 5IT9C 1N32E 2EMLA 3FIGA 1PDAA 2BB8A 1X47A 5FLXC 2EQ0A 2L33A 2R1FA 5AC5A 2ENAA 4R03A 1XMOE 3DF6A 3P1XA 4B3RE 2V89A 2EL5A 3EPLA 3T1YE 2HJJA 1T4NA 2V86A 2YWQA 3VYYA 4DV6E 4JI1E 4WX9A 2WBSA 2JR1A 4R2QA 2VQFE 4DV2E 1YSAC 2WZOA 2JPAA 1X6FA 2EN3A 4BHCA 1DI2A 4BMJA 1TF3A 1PJSA 4LTYA 2JY9A 3KZZA 4ZYGA 1A1LA 2EOIA 2LE2A 4I8OA 3JU0A 5AASA 2EZ6A 4X9JA 2NUFA 4X8WA 1YYWA 5TSEA 2EN6A 1EH6A 5A6BD 2EM2A 3BF2A 4WFTA 1UILA 3BGHA 4WPYA 4X65E 2EORA 2DLQA 3EPKA 4KZSA 4X64E 1X6HA 2EOJA 1Z1BA 2RS7A 1AAYA 3BIDA 3J80C 4WXDA 2LO3A 2ELYA 2UXBE 5A6JA 1N34E 2RSIA 2RTXA 2IHR1 1EH7A 4DV0E 1QNTA 2DMYA 2ZM6E 2JXPA 4IS1C 2YTFA 2L2KB 2V8QB 4DR6E 4DR7E 2EM3A 2YSOA 2CT1A 1XMQE 1XNRE 2D9HA 2VF1A 1STUA 1UN6B 2YRHA 2EPXA 1LLMC 2F4VE 3AUZA 4HEIA 1WHQA 2EMYA 2LJHA 4O43A 5LLQA 2JP9A 2M9AA 3MHHC 2EM9A 4IJDA 4TUIA 3J81C 2EM0A 2GLIA 1IBLE 4O24A 3L00A 2VQEE 1L4SA 1PJQA 5A6BA 2GHFA 2JYAA 3C4TA 4NHRA 1JK2A 2WBTA 4DV1E 3IWBA 2YZTA 5AC4A 2EOQA 3MHSC 2EOYA 2YU8A 4M30A 3VHTB 4LF4E 3T1HE 2L8TA 2YTIA 2EPLX 4R2PA 2EPOA 2EPUA 1ZBQA 2MDGA 1HNZE 1A1FA 4F6NA 3MSWA 1ZU1A 2LUPB 2RPCA 2EOMA 4B3ME 2YT4A 4B3SE 2VRDA 2EPZA 4F2JC 5LMUE 2LTRA 4HTGA 2B7VA 2F8BA 3C6MA 1ZAAC 2H36X 4L5NC 2MDRA 4OX9E 4DUZE 1HNXE 2Q8UA 5LMNE 2EN4A 1KYQA 4KWYA 4BBYA 2EOHA 2ELZA 2V83A 2L2MA 2LVHA 2NUEA 1ZR9A 2I13A 2ODRC 1X5WA 5LL6R 4LF9E 5BR8E 1G2DC 3HPSA 4R8OA 2KHXA 2EMHA 2YTPA 2EMZA 5KL2A 2LTSA 2CSHA 5AE3A 2KONA 4NXME 4GKJE 4LU9A 5CFFE 2LJUA 2JOXA 4DMIA 2EWLA 1T38A 2UUBE 1X6EA 1IQOA 2DMIA 2A25A 2KOUA 2EMGA 4YY3E 1IBKE 2HGHA 4LF8E 1T39A 2J7JA 2EN1A 1HR0E 2LRSA 2EL4A 2EMFA 2ODRD 2E1MA 1MEYC 2V85A 4DV7E 2EMIA 2UXDE 2V87A 2EN8A 2ENHA 4R2SA 2JWOA 2EPCA 2N3HA 2M1SA 4R2RA 4P7DA 2L92A 3IWDA 1KJKA 4F9BB 2MKNA 2EM5A 2JOBA 2N8XA 4JI7E 4Q35B 4DV3E 1YFHA 2LT7A 2ADRA 2EE8A 3OTOE 1X3CA 1P47A 3RMPA 3C6KA 2B7TA 4L8NA 2CPNA 5KL7A 1N33E 4WSGA 1PJTA
chains in the Genus database with same CATH topology
2EOQA 3EPHA 3MHSC 2BB8A 2EOYA 2EQ0A 5KL3A 2YU8A 3VHTB 2R1FA 2EOFA 2ENAA 4R2DA 2YTIA 1BB8A 2EPPA 4R2PA 2EMKA 3EPLA 2EL5A 2EM4A 2EPUA 1JK1A 2MDGA 1YUJA 2LCEA 2WBTA 1A1FA 2EOOA 1A1KA 1DGCA 4F6NA 2EQ3A 1ZU1A 2LV2A 1G2FC 2RPCA 2EOMA 2WBSA 2PRTA 2VRDA 2EOXA 4R2QA 1YSAC 2EPZA 4F2JC 2JPAA 1X6FA 2EN3A 1ZAAC 2E72A 3M99B 4F6MA 2WBUA 1TF3A 4R2EA 1UBDC 2YTQA 2EN2A 2EL6A 1WJPA 2EN4A 2YRMA 2EMWA 1RMDA 2EOHA 2ELZA 1A1LA 2EOIA 4M9VC 4FK5C 2EMAA 5KL4A 2LVHA 4X9JA 1BBOA 1ZR9A 2I13A 3EPJA 2EMXA 1X5WA 2DGCA 2EOZA 1G2DC 2YTNA 2YRKA 2EMHA 2EPAA 2EN6A 2YTPA 2NABA 2EMZA 2EM2A 5KL2A 1B69A 2CSHA 2EORA 2DLQA 2YTGA 3EPKA 1X6HA 2EOJA 1Z1BA 1AAYA 2DLKA 2YTDA 5KL6A 2YTJA 2LO3A 2ELYA 2EOSA 2YTOA 1X6EA 2RSIA 2DMIA 2A25A 2EMGA 2YU5A 2HGHA 4IS1C 2YTFA 2J7JA 2EN1A 1F2IG 5KL5A 2EL4A 2EM3A 2EMFA 2YSPA 2YSOA 4GZNC 2CT1A 2YTEA 2D9HA 2EM7A 1YUIA 2EOEA 2EJ4A 1MEYC 1UN6B 2MKDA 2EP3A 2EMIA 2YRHA 2EN8A 2EPXA 2ENHA 2EM8A 1LLMC 2CTDA 1TF6A 4R2SA 3UK3C 2EPCA 4R2RA 2EMYA 2ENCA 1TN9A 2JP9A 2EQ1A 1KJKA 2M9AA 2EMBA 2EN7A 3MHHC 1A1JA 2EM6A 2EM9A 4IJDA 2MKNA 2EM5A 4R2CA 2EM0A 2EPRA 2GLIA 2DRPA 2EMCA 2LT7A 1A1GA 2WCC3 4R2AA 2ADRA 1A1IA 2EE8A 1NCSA 1X3CA 1P47A 1A1HA 2GHFA 1JK2A 2EMLA 5KL7A 4WSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOQ A;  3EPH A;  3MHS C;  2BB8 A;  2EOY A;  2EQ0 A;  5KL3 A;  2YU8 A;  3VHT B;  2R1F A;  2EOF A;  2ENA A;  4R2D A;  2YTI A;  1BB8 A;  2EPP A;  4R2P A;  2EMK A;  3EPL A;  2EL5 A;  2EM4 A;  2EPU A;  1JK1 A;  2MDG A;  1YUJ A;  2LCE A;  2WBT A;  1A1F A;  2EOO A;  1A1K A;  1DGC A;  4F6N A;  2EQ3 A;  1ZU1 A;  2LV2 A;  1G2F C;  2RPC A;  2EOM A;  2WBS A;  2PRT A;  2VRD A;  2EOX A;  4R2Q A;  1YSA C;  2EPZ A;  4F2J C;  2JPA A;  1X6F A;  2EN3 A;  1ZAA C;  2E72 A;  3M99 B;  4F6M A;  2WBU A;  1TF3 A;  4R2E A;  1UBD C;  2YTQ A;  2EN2 A;  2EL6 A;  1WJP A;  2EN4 A;  2YRM A;  2EMW A;  1RMD A;  2EOH A;  2ELZ A;  1A1L A;  2EOI A;  4M9V C;  4FK5 C;  2EMA A;  5KL4 A;  2LVH A;  4X9J A;  1BBO A;  1ZR9 A;  2I13 A;  3EPJ A;  2EMX A;  1X5W A;  2DGC A;  2EOZ A;  1G2D C;  2YTN A;  2YRK A;  2EMH A;  2EPA A;  2EN6 A;  2YTP A;  2NAB A;  2EMZ A;  2EM2 A;  5KL2 A;  1B69 A;  2CSH A;  2EOR A;  2DLQ A;  2YTG A;  3EPK A;  1X6H A;  2EOJ A;  1Z1B A;  1AAY A;  2DLK A;  2YTD A;  5KL6 A;  2YTJ A;  2LO3 A;  2ELY A;  2EOS A;  2YTO A;  1X6E A;  2RSI A;  2DMI A;  2A25 A;  2EMG A;  2YU5 A;  2HGH A;  4IS1 C;  2YTF A;  2J7J A;  2EN1 A;  1F2I G;  5KL5 A;  2EL4 A;  2EM3 A;  2EMF A;  2YSP A;  2YSO A;  4GZN C;  2CT1 A;  2YTE A;  2D9H A;  2EM7 A;  1YUI A;  2EOE A;  2EJ4 A;  1MEY C;  1UN6 B;  2MKD A;  2EP3 A;  2EMI A;  2YRH A;  2EN8 A;  2EPX A;  2ENH A;  2EM8 A;  1LLM C;  2CTD A;  1TF6 A;  4R2S A;  3UK3 C;  2EPC A;  4R2R A;  2EMY A;  2ENC A;  1TN9 A;  2JP9 A;  2EQ1 A;  1KJK A;  2M9A A;  2EMB A;  2EN7 A;  3MHH C;  1A1J A;  2EM6 A;  2EM9 A;  4IJD A;  2MKN A;  2EM5 A;  4R2C A;  2EM0 A;  2EPR A;  2GLI A;  2DRP A;  2EMC A;  2LT7 A;  1A1G A;  2WCC 3;  4R2A A;  2ADR A;  1A1I A;  2EE8 A;  1NCS A;  1X3C A;  1P47 A;  1A1H A;  2GHF A;  1JK2 A;  2EML A;  5KL7 A;  4WSG A; 
#chains in the Genus database with same CATH topology
 5A6K A;  1GQE A;  4X66 E;  4DR1 E;  2G7H A;  4F54 A;  2GPI A;  3TQM A;  1DQ3 A;  2EPP A;  2EMK A;  2K4V A;  2EM4 A;  3VK6 A;  1YYO A;  4JI3 E;  4DR5 E;  1YZ9 A;  1JK1 A;  1YUJ A;  2LCE A;  1IQS A;  3HPZ A;  1WXR A;  2FTX B;  2EOO A;  1A1K A;  4GEQ B;  2I9I A;  4JI4 E;  5A2Q C;  2PRT A;  4LFA E;  4BHB A;  4DR2 E;  5AE2 A;  2R76 A;  3ZOQ B;  2EPN A;  2E72 A;  3M99 B;  4F6M A;  4JI0 E;  3ADI A;  4R2E A;  2YTQ A;  2EN2 A;  1O0W A;  5AE1 A;  4BC9 A;  2YRM A;  2EMW A;  4ZYD A;  4LF7 E;  1RMD A;  5A69 A;  4FK5 C;  4GKK E;  5ADZ A;  2B9D A;  4M2Z A;  2EMA A;  3K6Q A;  3ADG A;  3THN A;  2EMX A;  4AQY E;  2DGC A;  2EOZ A;  2EPM X;  2YTN A;  4K0K E;  4DV5 E;  4JI5 E;  2YRK A;  5DNY A;  1X48 A;  2JVA A;  1FKA E;  4JV5 E;  3EQ1 A;  2HC5 A;  4DKK A;  3AV0 A;  2YPN A;  2YTD A;  5F3W A;  4OOG C;  2YTJ A;  2EOS A;  1BBG A;  2YTO A;  4J8Z A;  4P78 A;  1WRJ A;  2LBS B;  2YU5 A;  2LUQ A;  3DJW A;  3BBG A;  5T6J A;  1F2I G;  2YSP A;  4DR4 E;  2YTE A;  3HQ1 A;  1YUI A;  2EOE A;  2EJ4 A;  4JI2 E;  2MKD A;  1X49 A;  5A6A A;  2CTD A;  1J5E E;  2FGG A;  3UK3 C;  4ZYH A;  3ECR A;  4RH8 A;  2EPK X;  2EQ1 A;  2L6M A;  4DUY E;  2EMB A;  2EN7 A;  2EM6 A;  1FJG E;  4JYA E;  4NZV A;  4R2C A;  4RHB B;  2EPR A;  2DRP A;  2EMC A;  1A1G A;  2WCC 3;  3C4B A;  2HHH E;  1NCS A;  4LF6 E;  4KHP E;  1A1H A;  2M7Q A;  3F6H A;  4ZYE A;  3EPH A;  5KL3 A;  2DB2 A;  1SFE A;  1I94 E;  2L2N A;  2EOF A;  4YHH E;  4R2D A;  1BB8 A;  3JTZ A;  1WHN A;  5IWA E;  4TUG A;  3KWR A;  1DGC A;  2EQ3 A;  2RSM A;  1SR9 A;  2LV2 A;  2VE7 C;  1G2F C;  4B3T E;  1HNW E;  1PKP A;  2L3J A;  1T4L B;  2EOX A;  1YYK A;  4LF5 E;  2UXC E;  1YPN A;  4BCA A;  2RS6 A;  2WBU A;  3ADL A;  1EKZ A;  3IWC A;  2DSY A;  4NXN E;  2BBG A;  4Q28 A;  1UBD C;  3KZY A;  4F9C B;  2EL6 A;  1IBM E;  5IXM B;  1WJP A;  4LFB E;  1RC7 A;  4F9A B;  4M9V C;  2UUC E;  3THO B;  5KL4 A;  4WXC A;  1BBO A;  3LLH A;  3EPJ A;  1MGT A;  4BS9 A;  4O4K A;  2EPA A;  2L3C A;  2NAB A;  4X62 E;  1B69 A;  4MLQ A;  1QU6 A;  2YTG A;  2UU9 E;  4DR3 E;  2NUG A;  2DLK A;  5KL6 A;  2K7I A;  2FV4 B;  3JAM C;  3VYX A;  3LML A;  3F6G A;  1IMU A;  1GTK A;  3ADJ A;  2RQL A;  5KL5 A;  1RQ0 A;  2MC5 A;  4GZN C;  1AH5 A;  2EM7 A;  4JI6 E;  3J7Y p;  1T4O A;  2N3G A;  2EP3 A;  2MC6 A;  3OML A;  4O5G A;  3J7A G;  2EM8 A;  2B3T B;  1NEI A;  1TF6 A;  1J26 A;  3H09 A;  1ZBT A;  2ENC A;  1N3G A;  1TN9 A;  2V88 A;  1A1J A;  1GZ6 A;  4LFC E;  2UUA E;  4WSP A;  4DV4 E;  1XNQ E;  5IV8 B;  4JI8 E;  4M0V A;  4MLV A;  4N4R B;  1N36 E;  1A1I A;  1UHZ A;  4R2A A;  4BC7 A;  1EH8 A;  3HXL A;  2M4I A;  4WYQ B;  2E5L E;  3QG5 C;  2LMZ A;  3HTX A;  2DIX A;  2NA2 A;  5IT9 C;  1N32 E;  2EML A;  3FIG A;  1PDA A;  2BB8 A;  1X47 A;  5FLX C;  2EQ0 A;  2L33 A;  2R1F A;  5AC5 A;  2ENA A;  4R03 A;  1XMO E;  3DF6 A;  3P1X A;  4B3R E;  2V89 A;  2EL5 A;  3EPL A;  3T1Y E;  2HJJ A;  1T4N A;  2V86 A;  2YWQ A;  3VYY A;  4DV6 E;  4JI1 E;  4WX9 A;  2WBS A;  2JR1 A;  4R2Q A;  2VQF E;  4DV2 E;  1YSA C;  2WZO A;  2JPA A;  1X6F A;  2EN3 A;  4BHC A;  1DI2 A;  4BMJ A;  1TF3 A;  1PJS A;  4LTY A;  2JY9 A;  3KZZ A;  4ZYG A;  1A1L A;  2EOI A;  2LE2 A;  4I8O A;  3JU0 A;  5AAS A;  2EZ6 A;  4X9J A;  2NUF A;  4X8W A;  1YYW A;  5TSE A;  2EN6 A;  1EH6 A;  5A6B D;  2EM2 A;  3BF2 A;  4WFT A;  1UIL A;  3BGH A;  4WPY A;  4X65 E;  2EOR A;  2DLQ A;  3EPK A;  4KZS A;  4X64 E;  1X6H A;  2EOJ A;  1Z1B A;  2RS7 A;  1AAY A;  3BID A;  3J80 C;  4WXD A;  2LO3 A;  2ELY A;  2UXB E;  5A6J A;  1N34 E;  2RSI A;  2RTX A;  2IHR 1;  1EH7 A;  4DV0 E;  1QNT A;  2DMY A;  2ZM6 E;  2JXP A;  4IS1 C;  2YTF A;  2L2K B;  2V8Q B;  4DR6 E;  4DR7 E;  2EM3 A;  2YSO A;  2CT1 A;  1XMQ E;  1XNR E;  2D9H A;  2VF1 A;  1STU A;  1UN6 B;  2YRH A;  2EPX A;  1LLM C;  2F4V E;  3AUZ A;  4HEI A;  1WHQ A;  2EMY A;  2LJH A;  4O43 A;  5LLQ A;  2JP9 A;  2M9A A;  3MHH C;  2EM9 A;  4IJD A;  4TUI A;  3J81 C;  2EM0 A;  2GLI A;  1IBL E;  4O24 A;  3L00 A;  2VQE E;  1L4S A;  1PJQ A;  5A6B A;  2GHF A;  2JYA A;  3C4T A;  4NHR A;  1JK2 A;  2WBT A;  4DV1 E;  3IWB A;  2YZT A;  5AC4 A;  2EOQ A;  3MHS C;  2EOY A;  2YU8 A;  4M30 A;  3VHT B;  4LF4 E;  3T1H E;  2L8T A;  2YTI A;  2EPL X;  4R2P A;  2EPO A;  2EPU A;  1ZBQ A;  2MDG A;  1HNZ E;  1A1F A;  4F6N A;  3MSW A;  1ZU1 A;  2LUP B;  2RPC A;  2EOM A;  4B3M E;  2YT4 A;  4B3S E;  2VRD A;  2EPZ A;  4F2J C;  5LMU E;  2LTR A;  4HTG A;  2B7V A;  2F8B A;  3C6M A;  1ZAA C;  2H36 X;  4L5N C;  2MDR A;  4OX9 E;  4DUZ E;  1HNX E;  2Q8U A;  5LMN E;  2EN4 A;  1KYQ A;  4KWY A;  4BBY A;  2EOH A;  2ELZ A;  2V83 A;  2L2M A;  2LVH A;  2NUE A;  1ZR9 A;  2I13 A;  2ODR C;  1X5W A;  5LL6 R;  4LF9 E;  5BR8 E;  1G2D C;  3HPS A;  4R8O A;  2KHX A;  2EMH A;  2YTP A;  2EMZ A;  5KL2 A;  2LTS A;  2CSH A;  5AE3 A;  2KON A;  4NXM E;  4GKJ E;  4LU9 A;  5CFF E;  2LJU A;  2JOX A;  4DMI A;  2EWL A;  1T38 A;  2UUB E;  1X6E A;  1IQO A;  2DMI A;  2A25 A;  2KOU A;  2EMG A;  4YY3 E;  1IBK E;  2HGH A;  4LF8 E;  1T39 A;  2J7J A;  2EN1 A;  1HR0 E;  2LRS A;  2EL4 A;  2EMF A;  2ODR D;  2E1M A;  1MEY C;  2V85 A;  4DV7 E;  2EMI A;  2UXD E;  2V87 A;  2EN8 A;  2ENH A;  4R2S A;  2JWO A;  2EPC A;  2N3H A;  2M1S A;  4R2R A;  4P7D A;  2L92 A;  3IWD A;  1KJK A;  4F9B B;  2MKN A;  2EM5 A;  2JOB A;  2N8X A;  4JI7 E;  4Q35 B;  4DV3 E;  1YFH A;  2LT7 A;  2ADR A;  2EE8 A;  3OTO E;  1X3C A;  1P47 A;  3RMP A;  3C6K A;  2B7T A;  4L8N A;  2CPN A;  5KL7 A;  1N33 E;  4WSG A;  1PJT A; 
#chains in the Genus database with same CATH homology
 2EOQ A;  3EPH A;  3MHS C;  2BB8 A;  2EOY A;  2EQ0 A;  5KL3 A;  2YU8 A;  3VHT B;  2R1F A;  2EOF A;  2ENA A;  4R2D A;  2YTI A;  1BB8 A;  2EPP A;  4R2P A;  2EMK A;  3EPL A;  2EL5 A;  2EM4 A;  2EPU A;  1JK1 A;  2MDG A;  1YUJ A;  2LCE A;  2WBT A;  1A1F A;  2EOO A;  1A1K A;  1DGC A;  4F6N A;  2EQ3 A;  1ZU1 A;  2LV2 A;  1G2F C;  2RPC A;  2EOM A;  2WBS A;  2PRT A;  2VRD A;  2EOX A;  4R2Q A;  1YSA C;  2EPZ A;  4F2J C;  2JPA A;  1X6F A;  2EN3 A;  1ZAA C;  2E72 A;  3M99 B;  4F6M A;  2WBU A;  1TF3 A;  4R2E A;  1UBD C;  2YTQ A;  2EN2 A;  2EL6 A;  1WJP A;  2EN4 A;  2YRM A;  2EMW A;  1RMD A;  2EOH A;  2ELZ A;  1A1L A;  2EOI A;  4M9V C;  4FK5 C;  2EMA A;  5KL4 A;  2LVH A;  4X9J A;  1BBO A;  1ZR9 A;  2I13 A;  3EPJ A;  2EMX A;  1X5W A;  2DGC A;  2EOZ A;  1G2D C;  2YTN A;  2YRK A;  2EMH A;  2EPA A;  2EN6 A;  2YTP A;  2NAB A;  2EMZ A;  2EM2 A;  5KL2 A;  1B69 A;  2CSH A;  2EOR A;  2DLQ A;  2YTG A;  3EPK A;  1X6H A;  2EOJ A;  1Z1B A;  1AAY A;  2DLK A;  2YTD A;  5KL6 A;  2YTJ A;  2LO3 A;  2ELY A;  2EOS A;  2YTO A;  1X6E A;  2RSI A;  2DMI A;  2A25 A;  2EMG A;  2YU5 A;  2HGH A;  4IS1 C;  2YTF A;  2J7J A;  2EN1 A;  1F2I G;  5KL5 A;  2EL4 A;  2EM3 A;  2EMF A;  2YSP A;  2YSO A;  4GZN C;  2CT1 A;  2YTE A;  2D9H A;  2EM7 A;  1YUI A;  2EOE A;  2EJ4 A;  1MEY C;  1UN6 B;  2MKD A;  2EP3 A;  2EMI A;  2YRH A;  2EN8 A;  2EPX A;  2ENH A;  2EM8 A;  1LLM C;  2CTD A;  1TF6 A;  4R2S A;  3UK3 C;  2EPC A;  4R2R A;  2EMY A;  2ENC A;  1TN9 A;  2JP9 A;  2EQ1 A;  1KJK A;  2M9A A;  2EMB A;  2EN7 A;  3MHH C;  1A1J A;  2EM6 A;  2EM9 A;  4IJD A;  2MKN A;  2EM5 A;  4R2C A;  2EM0 A;  2EPR A;  2GLI A;  2DRP A;  2EMC A;  2LT7 A;  1A1G A;  2WCC 3;  4R2A A;  2ADR A;  1A1I A;  2EE8 A;  1NCS A;  1X3C A;  1P47 A;  1A1H A;  2GHF A;  1JK2 A;  2EML A;  5KL7 A;  4WSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...