2HJJA

Solution nmr structure of protein ykff from escherichia coli. northeast structural genomics target er397.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
66
structure length
66
Chain Sequence
GPFTRRQAQAVTTTYSNITLEDDQGSHFRLVVRDTEGRMVWRAWNFEPDAGEGLNRYIRTSGIRTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein ykfF
publication title Solution NMR structure of protein ykfF from Escherichia coli. Northeast Structural Genomics target ER397.
rcsb
source organism Escherichia coli
total genus 17
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06006 DUF905 Bacterial protein of unknown function (DUF905)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.130 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain ykff protein like domains 2hjjA00
2HJJA
chains in the Genus database with same CATH superfamily
4JI2E 1IQSA 4GKJE 3VYXA 3J7AG 2YPNA 3MHHC 5LMUE 2EPMX 3UK3C 4ZYEA 2EM7A 4KZSA 2EWLA 4TUIA 4NXNE 2EN8A 1A1IA 4KHPE 2RSMA 4MLQA 1N33E 4F9BB 2DB2A 4YY3E 4KWYA 5KL7A 1EKZA 1J5EE 2JYAA 2MDRA 2MC6A 2MC5A 1YSAC 4M2ZA 1O0WA 4F6NA 5A6AA 2N8XA 2NUFA 2EL4A 2UXCE 2EMWA 1HNZE 1X48A 2EL5A 2EPNA 2FV4B 2JVAA 5FLXC 2EMBA 2EPOA 2V83A 1PJQA 2KONA 5TSEA 2I13A 1X6EA 2EMYA 4F9CB 1P47A 2JPAA 2YTOA 2JY9A 5A69A 4J8ZA 1KYQA 2YT4A 4M9VC 4LU9A 4NZVA 4R03A 2LT7A 1HNWE 1YYKA 2ELZA 2V89A 5KL3A 5LMNE 2EMKA 4GKKE 2YTEA 1MGTA 2YTDA 4R2CA 3L00A 2EZ6A 4F2JC 1UHZA 1XMQE 3ADGA 4DR7E 3MSWA 2EPPA 5DNYA 2EPLX 1JK2A 2VRDA 2EMGA 4WPYA 3BBGA 5KL5A 4X64E 2M9AA 2FGGA 1N36E 1TF3A 1UBDC 2HHHE 4R2RA 1HR0E 2YTGA 1B69A 1G2DC 2UU9E 4IS1C 1WJPA 2L6MA 4R2DA 3LMLA 2RSIA 4LF9E 2CPNA 2CTDA 5KL6A 1LLMC 1X6FA 2ODRC 4I8OA 1XNRE 2EP3A 4ZYGA 5AC4A 1X47A 2EN2A 1TN9A 2BBGA 3ADIA 2UXDE 4WFTA 4P7DA 3EQ1A 2EOFA 5LL6R 3EPJA 4M30A 2E5LE 2GPIA 3IWCA 4X66E 4X65E 5AC5A 4LF6E 3ADLA 1KJKA 4B3SE 2WBTA 4O4KA 1BBOA 2JOBA 1X49A 1JK1A 2EMLA 3OMLA 2YSPA 1YUIA 2KOUA 2EM8A 2M7QA 4LFCE 3BIDA 4DR6E 3HPZA 3IWDA 3KZYA 3J7Yp 3DJWA 2V8QB 3HXLA 2YSOA 1T4LB 2EOZA 1SR9A 4R2AA 2A25A 2B3TB 3RMPA 2L8TA 1EH6A 2EOMA 1YYWA 2EMIA 2EM2A 1QNTA 2EQ3A 2H36X 2VE7C 5F3WA 1T38A 4K0KE 2EJ4A 2EN1A 1PJTA 3AUZA 2BB8A 2LVHA 3C4TA 2V86A 5IV8B 4IJDA 2L2MA 1FJGE 2GLIA 1RQ0A 4BHCA 5A6BD 1TF6A 4DV6E 5T6JA 2HJJA 3EPKA 4MLVA 2EM9A 3JTZA 1J26A 1T39A 2G7HA 2YRMA 4M0VA 4DMIA 2NA2A 1GZ6A 3AV0A 5A6BA 4JI4E 2EPKX 2LRSA 4B3RE 4AQYE 2ENAA 2HGHA 2GHFA 2YU5A 2ZM6E 2EOOA 4X9JA 2EPRA 4LF7E 4BHBA 5BR8E 2DLQA 4JI6E 2EMXA 1L4SA 2DSYA 1A1JA 1ZU1A 2ENCA 4R2SA 4WSGA 1IBME 2MKDA 2EMFA 3EPHA 3JU0A 2CSHA 1FKAE 4B3TE 2V88A 2V85A 1GQEA 2YRHA 4DR5E 3J81C 1DI2A 2J7JA 4ZYDA 2DRPA 2LE2A 3BF2A 4FK5C 1DGCA 2UUCE 4HTGA 3J80C 1A1HA 2EOHA 4WX9A 2YTQA 2L33A 2LUPB 2YTJA 1IBLE 2EL6A 5LLQA 4JI5E 1YPNA 3K6QA 5KL2A 4GZNC 3C6KA 2R76A 4JI8E 4DV0E 1N3GA 2IHR1 5AE1A 1WXRA 4WXCA 2L2KB 2JP9A 3KWRA 2L3JA 2EQ0A 2I9IA 3THOB 4DV1E 1YZ9A 4RH8A 2ENHA 1NEIA 4WSPA 1A1GA 1PKPA 1BBGA 2N3GA 1RC7A 5A6JA 4JI3E 4DR2E 5AE2A 4DR4E 2LJUA 1UILA 1SFEA 2LBSB 5A2QC 2B7VA 2EM6A 4JI0E 4BC7A 1ZBQA 1A1LA 2M1SA 3FIGA 2EPXA 4DV7E 4BS9A 4R8OA 2MKNA 3KZZA 2JXPA 1GTKA 3T1HE 2YTFA 2DMIA 4F54A 4ZYHA 4N4RB 2EN3A 1X5WA 1YFHA 1G2FC 2UXBE 1N32E 5IT9C 3ADJA 2ADRA 2L2NA 2WCC3 1PDAA 2CT1A 4WYQB 2EE8A 2N3HA 2EPZA 2YTNA 2K4VA 4R2EA 4DR1E 4LF4E 1T4NA 4JYAE 2EPUA 2ELYA 2EPCA 4YHHE 1AAYA 2RQLA 1X6HA 1WHQA 2YZTA 2NABA 4JI1E 2LMZA 1F2IG 2EMZA 2EMCA 4L8NA 2V87A 1I94E 4Q35B 3VYYA 2EOXA 4LTYA 4DV5E 4LFAE 1HNXE 4LF8E 1EH7A 4O5GA 1Z1BA 4BMJA 1DQ3A 4OOGC 4JV5E 2EN7A 1ZAAC 4RHBB 3TQMA 4BCAA 1A1KA 3DF6A 2EM0A 1RMDA 2F8BA 3HQ1A 2EOEA 3C6MA 5IXMB 1EH8A 2KHXA 5KL4A 2DLKA 2YTIA 2EN6A 2EOSA 4OX9E 2YRKA 2VF1A 4DUZE 4F6MA 2L92A 2K7IA 2B9DA 5IWAE 2WBUA 3THNA 2RS6A 2LUQA 3ECRA 4R2PA 2JOXA 2R1FA 2WZOA 4F9AB 2NUGA 5A6KA 3H09A 2LCEA 2LTSA 4DV4E 1T4OA 4Q28A 3VHTB 4LFBE 2EOYA 4BC9A 2EM5A 4X62E 2EQ1A 1AH5A 3HPSA 4DR3E 1IQOA 2LJHA 2JWOA 2MDGA 2RS7A 2RPCA 1STUA 2RTXA 4O24A 3VK6A 2DGCA 2PRTA 4L5NC 2DMYA 2E72A 3F6HA 2WBSA 1WRJA 1IBKE 3P1XA 5AASA 2LO3A 2F4VE 2B7TA 2LTRA 2E1MA 4TUGA 1BB8A 1UN6B 3BGHA 2L3CA 2EOQA 3ZOQB 2D9HA 2ODRD 1IMUA 2UUBE 4R2QA 2DIXA 1PJSA 1XNQE 4DV2E 3OTOE 4P78A 2EORA 2HC5A 2YTPA 5ADZA 4DUYE 1X3CA 3C4BA 1WHNA 2VQFE 2EMAA 1ZBTA 4HEIA 4B3ME 2JR1A 2NUEA 2EOIA 3MHSC 4O43A 2FTXB 4NHRA 4NXME 3IWBA 1XMOE 2EMHA 3LLHA 2EN4A 4GEQB 4LF5E 3T1YE 4WXDA 1NCSA 4JI7E 1N34E 2EOJA 5AE3A 2EM4A 2VQEE 3QG5C 2Q8UA 3HTXA 1QU6A 2M4IA 3F6GA 3JAMC 1YYOA 3M99B 1ZR9A 2EM3A 2UUAE 4BBYA 1A1FA 2YU8A 4DKKA 5CFFE 4X8WA 2EPAA 2YWQA 3EPLA 1MEYC 2LV2A 4DV3E 1YUJA
chains in the Genus database with same CATH topology
2HJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJJ A; 
#chains in the Genus database with same CATH topology
 4JI2 E;  1IQS A;  4GKJ E;  3VYX A;  3J7A G;  2YPN A;  3MHH C;  5LMU E;  2EPM X;  3UK3 C;  4ZYE A;  2EM7 A;  4KZS A;  2EWL A;  4TUI A;  4NXN E;  2EN8 A;  1A1I A;  4KHP E;  2RSM A;  4MLQ A;  1N33 E;  4F9B B;  2DB2 A;  4YY3 E;  4KWY A;  5KL7 A;  1EKZ A;  1J5E E;  2JYA A;  2MDR A;  2MC6 A;  2MC5 A;  1YSA C;  4M2Z A;  1O0W A;  4F6N A;  5A6A A;  2N8X A;  2NUF A;  2EL4 A;  2UXC E;  2EMW A;  1HNZ E;  1X48 A;  2EL5 A;  2EPN A;  2FV4 B;  2JVA A;  5FLX C;  2EMB A;  2EPO A;  2V83 A;  1PJQ A;  2KON A;  5TSE A;  2I13 A;  1X6E A;  2EMY A;  4F9C B;  1P47 A;  2JPA A;  2YTO A;  2JY9 A;  5A69 A;  4J8Z A;  1KYQ A;  2YT4 A;  4M9V C;  4LU9 A;  4NZV A;  4R03 A;  2LT7 A;  1HNW E;  1YYK A;  2ELZ A;  2V89 A;  5KL3 A;  5LMN E;  2EMK A;  4GKK E;  2YTE A;  1MGT A;  2YTD A;  4R2C A;  3L00 A;  2EZ6 A;  4F2J C;  1UHZ A;  1XMQ E;  3ADG A;  4DR7 E;  3MSW A;  2EPP A;  5DNY A;  2EPL X;  1JK2 A;  2VRD A;  2EMG A;  4WPY A;  3BBG A;  5KL5 A;  4X64 E;  2M9A A;  2FGG A;  1N36 E;  1TF3 A;  1UBD C;  2HHH E;  4R2R A;  1HR0 E;  2YTG A;  1B69 A;  1G2D C;  2UU9 E;  4IS1 C;  1WJP A;  2L6M A;  4R2D A;  3LML A;  2RSI A;  4LF9 E;  2CPN A;  2CTD A;  5KL6 A;  1LLM C;  1X6F A;  2ODR C;  4I8O A;  1XNR E;  2EP3 A;  4ZYG A;  5AC4 A;  1X47 A;  2EN2 A;  1TN9 A;  2BBG A;  3ADI A;  2UXD E;  4WFT A;  4P7D A;  3EQ1 A;  2EOF A;  5LL6 R;  3EPJ A;  4M30 A;  2E5L E;  2GPI A;  3IWC A;  4X66 E;  4X65 E;  5AC5 A;  4LF6 E;  3ADL A;  1KJK A;  4B3S E;  2WBT A;  4O4K A;  1BBO A;  2JOB A;  1X49 A;  1JK1 A;  2EML A;  3OML A;  2YSP A;  1YUI A;  2KOU A;  2EM8 A;  2M7Q A;  4LFC E;  3BID A;  4DR6 E;  3HPZ A;  3IWD A;  3KZY A;  3J7Y p;  3DJW A;  2V8Q B;  3HXL A;  2YSO A;  1T4L B;  2EOZ A;  1SR9 A;  4R2A A;  2A25 A;  2B3T B;  3RMP A;  2L8T A;  1EH6 A;  2EOM A;  1YYW A;  2EMI A;  2EM2 A;  1QNT A;  2EQ3 A;  2H36 X;  2VE7 C;  5F3W A;  1T38 A;  4K0K E;  2EJ4 A;  2EN1 A;  1PJT A;  3AUZ A;  2BB8 A;  2LVH A;  3C4T A;  2V86 A;  5IV8 B;  4IJD A;  2L2M A;  1FJG E;  2GLI A;  1RQ0 A;  4BHC A;  5A6B D;  1TF6 A;  4DV6 E;  5T6J A;  2HJJ A;  3EPK A;  4MLV A;  2EM9 A;  3JTZ A;  1J26 A;  1T39 A;  2G7H A;  2YRM A;  4M0V A;  4DMI A;  2NA2 A;  1GZ6 A;  3AV0 A;  5A6B A;  4JI4 E;  2EPK X;  2LRS A;  4B3R E;  4AQY E;  2ENA A;  2HGH A;  2GHF A;  2YU5 A;  2ZM6 E;  2EOO A;  4X9J A;  2EPR A;  4LF7 E;  4BHB A;  5BR8 E;  2DLQ A;  4JI6 E;  2EMX A;  1L4S A;  2DSY A;  1A1J A;  1ZU1 A;  2ENC A;  4R2S A;  4WSG A;  1IBM E;  2MKD A;  2EMF A;  3EPH A;  3JU0 A;  2CSH A;  1FKA E;  4B3T E;  2V88 A;  2V85 A;  1GQE A;  2YRH A;  4DR5 E;  3J81 C;  1DI2 A;  2J7J A;  4ZYD A;  2DRP A;  2LE2 A;  3BF2 A;  4FK5 C;  1DGC A;  2UUC E;  4HTG A;  3J80 C;  1A1H A;  2EOH A;  4WX9 A;  2YTQ A;  2L33 A;  2LUP B;  2YTJ A;  1IBL E;  2EL6 A;  5LLQ A;  4JI5 E;  1YPN A;  3K6Q A;  5KL2 A;  4GZN C;  3C6K A;  2R76 A;  4JI8 E;  4DV0 E;  1N3G A;  2IHR 1;  5AE1 A;  1WXR A;  4WXC A;  2L2K B;  2JP9 A;  3KWR A;  2L3J A;  2EQ0 A;  2I9I A;  3THO B;  4DV1 E;  1YZ9 A;  4RH8 A;  2ENH A;  1NEI A;  4WSP A;  1A1G A;  1PKP A;  1BBG A;  2N3G A;  1RC7 A;  5A6J A;  4JI3 E;  4DR2 E;  5AE2 A;  4DR4 E;  2LJU A;  1UIL A;  1SFE A;  2LBS B;  5A2Q C;  2B7V A;  2EM6 A;  4JI0 E;  4BC7 A;  1ZBQ A;  1A1L A;  2M1S A;  3FIG A;  2EPX A;  4DV7 E;  4BS9 A;  4R8O A;  2MKN A;  3KZZ A;  2JXP A;  1GTK A;  3T1H E;  2YTF A;  2DMI A;  4F54 A;  4ZYH A;  4N4R B;  2EN3 A;  1X5W A;  1YFH A;  1G2F C;  2UXB E;  1N32 E;  5IT9 C;  3ADJ A;  2ADR A;  2L2N A;  2WCC 3;  1PDA A;  2CT1 A;  4WYQ B;  2EE8 A;  2N3H A;  2EPZ A;  2YTN A;  2K4V A;  4R2E A;  4DR1 E;  4LF4 E;  1T4N A;  4JYA E;  2EPU A;  2ELY A;  2EPC A;  4YHH E;  1AAY A;  2RQL A;  1X6H A;  1WHQ A;  2YZT A;  2NAB A;  4JI1 E;  2LMZ A;  1F2I G;  2EMZ A;  2EMC A;  4L8N A;  2V87 A;  1I94 E;  4Q35 B;  3VYY A;  2EOX A;  4LTY A;  4DV5 E;  4LFA E;  1HNX E;  4LF8 E;  1EH7 A;  4O5G A;  1Z1B A;  4BMJ A;  1DQ3 A;  4OOG C;  4JV5 E;  2EN7 A;  1ZAA C;  4RHB B;  3TQM A;  4BCA A;  1A1K A;  3DF6 A;  2EM0 A;  1RMD A;  2F8B A;  3HQ1 A;  2EOE A;  3C6M A;  5IXM B;  1EH8 A;  2KHX A;  5KL4 A;  2DLK A;  2YTI A;  2EN6 A;  2EOS A;  4OX9 E;  2YRK A;  2VF1 A;  4DUZ E;  4F6M A;  2L92 A;  2K7I A;  2B9D A;  5IWA E;  2WBU A;  3THN A;  2RS6 A;  2LUQ A;  3ECR A;  4R2P A;  2JOX A;  2R1F A;  2WZO A;  4F9A B;  2NUG A;  5A6K A;  3H09 A;  2LCE A;  2LTS A;  4DV4 E;  1T4O A;  4Q28 A;  3VHT B;  4LFB E;  2EOY A;  4BC9 A;  2EM5 A;  4X62 E;  2EQ1 A;  1AH5 A;  3HPS A;  4DR3 E;  1IQO A;  2LJH A;  2JWO A;  2MDG A;  2RS7 A;  2RPC A;  1STU A;  2RTX A;  4O24 A;  3VK6 A;  2DGC A;  2PRT A;  4L5N C;  2DMY A;  2E72 A;  3F6H A;  2WBS A;  1WRJ A;  1IBK E;  3P1X A;  5AAS A;  2LO3 A;  2F4V E;  2B7T A;  2LTR A;  2E1M A;  4TUG A;  1BB8 A;  1UN6 B;  3BGH A;  2L3C A;  2EOQ A;  3ZOQ B;  2D9H A;  2ODR D;  1IMU A;  2UUB E;  4R2Q A;  2DIX A;  1PJS A;  1XNQ E;  4DV2 E;  3OTO E;  4P78 A;  2EOR A;  2HC5 A;  2YTP A;  5ADZ A;  4DUY E;  1X3C A;  3C4B A;  1WHN A;  2VQF E;  2EMA A;  1ZBT A;  4HEI A;  4B3M E;  2JR1 A;  2NUE A;  2EOI A;  3MHS C;  4O43 A;  2FTX B;  4NHR A;  4NXM E;  3IWB A;  1XMO E;  2EMH A;  3LLH A;  2EN4 A;  4GEQ B;  4LF5 E;  3T1Y E;  4WXD A;  1NCS A;  4JI7 E;  1N34 E;  2EOJ A;  5AE3 A;  2EM4 A;  2VQE E;  3QG5 C;  2Q8U A;  3HTX A;  1QU6 A;  2M4I A;  3F6G A;  3JAM C;  1YYO A;  3M99 B;  1ZR9 A;  2EM3 A;  2UUA E;  4BBY A;  1A1F A;  2YU8 A;  4DKK A;  5CFF E;  4X8W A;  2EPA A;  2YWQ A;  3EPL A;  1MEY C;  2LV2 A;  4DV3 E;  1YUJ A; 
#chains in the Genus database with same CATH homology
 2HJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...