2HJJA

Solution nmr structure of protein ykff from escherichia coli. northeast structural genomics target er397.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
66
structure length
66
Chain Sequence
GPFTRRQAQAVTTTYSNITLEDDQGSHFRLVVRDTEGRMVWRAWNFEPDAGEGLNRYIRTSGIRTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein ykfF
publication title Solution NMR structure of protein ykfF from Escherichia coli. Northeast Structural Genomics target ER397.
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 17
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06006 DUF905 Bacterial protein of unknown function (DUF905)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.130 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain ykff protein like domains 2hjjA00
2HJJA
chains in the Genus database with same CATH superfamily
1MGTA 2YSPA 1XMQE 2PRTA 2CPNA 2RPCA 2YPNA 4R2AA 1MEYC 1EKZA 2EL4A 3C4TA 4JI6E 2EN2A 1ZU1A 3ECRA 4X65E 2Q8UA 2EOSA 1TN9A 3MHSC 4B3TE 4M9VC 4BHBA 2MKNA 4FK5C 2B7VA 3LMLA 2EPKX 2NUGA 2JWOA 4BC7A 4R2EA 2BBGA 2EN6A 3BF2A 2WBSA 2VQFE 1UILA 1DQ3A 1YYKA 4X64E 3F6HA 3KWRA 4DR5E 2JXPA 2NA2A 3OTOE 3BIDA 1EH8A 2L92A 3MHHC 1A1IA 5A2QC 1BB8A 2YSOA 2YRKA 2EN8A 2V83A 3DF6A 4DV6E 2ODRC 4GEQB 3UK3C 1X3CA 2EMFA 1UBDC 3LLHA 3J81C 4JYAE 2V89A 4NXME 3L00A 1T38A 2EPCA 4J8ZA 2EPXA 2HJJA 2YU8A 3EQ1A 1BBOA 4BBYA 2KONA 1J5EE 4WXDA 4ZYHA 5A6BA 5KL2A 2R1FA 2EM8A 2EPOA 2WCC3 2VRDA 2B7TA 2LBSB 2EMLA 5DNYA 2UXBE 1WRJA 2M7QA 2YRHA 2N3GA 3HPZA 2NUEA 5IXMB 2YTGA 1A1JA 3IWBA 4I8OA 5LMNE 2ZM6E 1X49A 1A1GA 4HEIA 1PJTA 2EOHA 2CT1A 4R2QA 2BB8A 5A6BD 3T1HE 1F2IG 4LU9A 5KL4A 4DR3E 1IMUA 2EQ0A 2EOOA 2RQLA 3C6MA 5IT9C 3VYXA 3HQ1A 2MKDA 2EPUA 3FIGA 4MLQA 2JVAA 2RSMA 1DGCA 5F3WA 2HHHE 1XNQE 5AC4A 2UUCE 1YUIA 3M99B 2V88A 2B9DA 2IHR1 1ZBTA 4YHHE 2EMGA 4KWYA 2CTDA 4X8WA 4DV5E 5KL6A 3ADLA 1X6HA 1I94E 2DMIA 4DR6E 4JI0E 4L8NA 5AC5A 1YYWA 4LF8E 3KZYA 2UUAE 2EMAA 1KJKA 2WBTA 4YY3E 2N8XA 1L4SA 4DR4E 5LLQA 2RTXA 2EMKA 1JK2A 5TSEA 2M9AA 4MLVA 3HTXA 2EL5A 1Z1BA 2G7HA 2L3JA 1AH5A 4LF9E 1N3GA 2VE7C 2EQ1A 2EMHA 1HNZE 3AUZA 4TUIA 2EMCA 4F2JC 1A1FA 1NEIA 1PJSA 2J7JA 5BR8E 1T4LB 2YTJA 4M2ZA 2ELYA 4R8OA 2YT4A 3JU0A 4NXNE 2JOXA 2CSHA 2EOJA 2EM3A 4AQYE 4LF7E 4NZVA 4F6NA 1XNRE 3ADIA 5A6KA 1T4OA 2GHFA 1B69A 2F4VE 2DIXA 2EPRA 5KL7A 4WX9A 1IBKE 2EOIA 2F8BA 2DMYA 4DV0E 3C4BA 4LFBE 1SR9A 2ELZA 2K7IA 4R2PA 1XMOE 4KHPE 2EPPA 1NCSA 4WSPA 4N4RB 2EN3A 4Q35B 2LJHA 4BHCA 3MSWA 4WXCA 2UXDE 2E72A 4M0VA 1T4NA 4R03A 2EQ3A 1FJGE 1GTKA 2EOXA 4F54A 1FKAE 1PJQA 2KHXA 4F9AB 2YTQA 1STUA 2I9IA 2I13A 4DR1E 3VHTB 3QG5C 5LL6R 2JPAA 4M30A 2RS7A 2DRPA 2EMXA 2EPNA 4OX9E 4X9JA 4DV1E 1P47A 1UHZA 1N34E 2EPLX 4JI5E 4LF6E 2EM5A 1QU6A 4JI1E 4GZNC 4BMJA 3P1XA 2ODRD 2V85A 2YWQA 3HXLA 3KZZA 4JI4E 2LUPB 1A1KA 1HNXE 3THNA 5ADZA 4DUYE 4DV7E 4TUGA 1T39A 2YTFA 2EL6A 4F9CB 1HNWE 2EM0A 3VYYA 1WJPA 4DKKA 2EE8A 1YUJA 2ENHA 1DI2A 1ZR9A 2EJ4A 2EMBA 5A6JA 4R2CA 2YTNA 4Q28A 4DUZE 1X6EA 2LTSA 5KL3A 2ENCA 2DGCA 2DB2A 2EM2A 2YTIA 4NHRA 1X47A 1X5WA 2WBUA 3THOB 2L3CA 2NUFA 2LVHA 1N33E 4LFAE 4LTYA 4GKKE 3ZOQB 2GLIA 3J7AG 1TF6A 2YTEA 2M4IA 1G2FC 4L5NC 1G2DC 4O43A 3RMPA 5A69A 2LE2A 5AE3A 2E5LE 2V86A 4GKJE 4X66E 1A1HA 2L2KB 2JR1A 1YZ9A 2DLQA 4DR7E 2UXCE 1X6FA 3BBGA 1YYOA 2EM6A 2FGGA 2EOFA 4JI7E 2EMZA 1WHNA 3EPKA 1TF3A 5FLXC 4JI8E 2HGHA 3ADJA 5IV8B 2LCEA 1YFHA 2D9HA 2KOUA 3J7Yp 4R2SA 4WFTA 1RQ0A 2HC5A 2JYAA 3BGHA 3F6GA 3OMLA 2LMZA 4RH8A 2FTXB 4IJDA 4F6MA 1YPNA 2EPAA 4DR2E 1LLMC 3HPSA 2K4VA 3K6QA 2JOBA 1IBME 4JV5E 3T1YE 5AE2A 1BBGA 1A1LA 2EM9A 2EN4A 4O5GA 1IBLE 2VQEE 1EH6A 1X48A 2YZTA 2EMIA 5IWAE 4JI3E 2L2MA 4P7DA 2H36X 2UUBE 4DV3E 3DJWA 1N32E 1ZBQA 4K0KE 2EM7A 3EPHA 2EOZA 1GQEA 2M1SA 2E1MA 1WHQA 2LJUA 2EMWA 4F9BB 4LF4E 2DLKA 2RSIA 2JY9A 2N3HA 4BC9A 2EZ6A 4IS1C 4O4KA 2EMYA 5AE1A 2EORA 2MDGA 4B3ME 4DV4E 2EPMX 4O24A 3ADGA 4ZYGA 1IQOA 2EOQA 4OOGC 2LV2A 4P78A 4ZYEA 2MC5A 2YTPA 2LUQA 4DMIA 3EPJA 5LMUE 1HR0E 1O0WA 4WSGA 4KZSA 2EOYA 2LT7A 2EN7A 2L33A 5KL5A 3JTZA 3EPLA 1WXRA 3J80C 3IWDA 4WPYA 1JK1A 4B3RE 2YRMA 2L8TA 2RS6A 2FV4B 4LF5E 4R2RA 2UU9E 3VK6A 1GZ6A 2GPIA 2DSYA 2L6MA 2A25A 1KYQA 4WYQB 2EP3A 2WZOA 1J26A 2NABA 5AASA 2YU5A 1RC7A 2MDRA 1EH7A 1IQSA 3AV0A 2EM4A 3TQMA 2EOMA 2V87A 1UN6B 2LO3A 2YTDA 2EPZA 3IWCA 5CFFE 1SFEA 4B3SE 1PDAA 2EWLA 2ENAA 3JAMC 5A6AA 4X62E 2VF1A 4R2DA 4HTGA 5T6JA 2EOEA 1ZAAC 2YTOA 4BCAA 2EN1A 3H09A 2B3TB 4ZYDA 2V8QB 1N36E 1AAYA 3C6KA 4DV2E 4BS9A 2LTRA 1RMDA 2JP9A 2L2NA 4RHBB 2R76A 2ADRA 1YSAC 4LFCE 1QNTA 4JI2E 2MC6A 1PKPA 2LRSA
chains in the Genus database with same CATH topology
2HJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJJ A; 
#chains in the Genus database with same CATH topology
 1MGT A;  2YSP A;  1XMQ E;  2PRT A;  2CPN A;  2RPC A;  2YPN A;  4R2A A;  1MEY C;  1EKZ A;  2EL4 A;  3C4T A;  4JI6 E;  2EN2 A;  1ZU1 A;  3ECR A;  4X65 E;  2Q8U A;  2EOS A;  1TN9 A;  3MHS C;  4B3T E;  4M9V C;  4BHB A;  2MKN A;  4FK5 C;  2B7V A;  3LML A;  2EPK X;  2NUG A;  2JWO A;  4BC7 A;  4R2E A;  2BBG A;  2EN6 A;  3BF2 A;  2WBS A;  2VQF E;  1UIL A;  1DQ3 A;  1YYK A;  4X64 E;  3F6H A;  3KWR A;  4DR5 E;  2JXP A;  2NA2 A;  3OTO E;  3BID A;  1EH8 A;  2L92 A;  3MHH C;  1A1I A;  5A2Q C;  1BB8 A;  2YSO A;  2YRK A;  2EN8 A;  2V83 A;  3DF6 A;  4DV6 E;  2ODR C;  4GEQ B;  3UK3 C;  1X3C A;  2EMF A;  1UBD C;  3LLH A;  3J81 C;  4JYA E;  2V89 A;  4NXM E;  3L00 A;  1T38 A;  2EPC A;  4J8Z A;  2EPX A;  2HJJ A;  2YU8 A;  3EQ1 A;  1BBO A;  4BBY A;  2KON A;  1J5E E;  4WXD A;  4ZYH A;  5A6B A;  5KL2 A;  2R1F A;  2EM8 A;  2EPO A;  2WCC 3;  2VRD A;  2B7T A;  2LBS B;  2EML A;  5DNY A;  2UXB E;  1WRJ A;  2M7Q A;  2YRH A;  2N3G A;  3HPZ A;  2NUE A;  5IXM B;  2YTG A;  1A1J A;  3IWB A;  4I8O A;  5LMN E;  2ZM6 E;  1X49 A;  1A1G A;  4HEI A;  1PJT A;  2EOH A;  2CT1 A;  4R2Q A;  2BB8 A;  5A6B D;  3T1H E;  1F2I G;  4LU9 A;  5KL4 A;  4DR3 E;  1IMU A;  2EQ0 A;  2EOO A;  2RQL A;  3C6M A;  5IT9 C;  3VYX A;  3HQ1 A;  2MKD A;  2EPU A;  3FIG A;  4MLQ A;  2JVA A;  2RSM A;  1DGC A;  5F3W A;  2HHH E;  1XNQ E;  5AC4 A;  2UUC E;  1YUI A;  3M99 B;  2V88 A;  2B9D A;  2IHR 1;  1ZBT A;  4YHH E;  2EMG A;  4KWY A;  2CTD A;  4X8W A;  4DV5 E;  5KL6 A;  3ADL A;  1X6H A;  1I94 E;  2DMI A;  4DR6 E;  4JI0 E;  4L8N A;  5AC5 A;  1YYW A;  4LF8 E;  3KZY A;  2UUA E;  2EMA A;  1KJK A;  2WBT A;  4YY3 E;  2N8X A;  1L4S A;  4DR4 E;  5LLQ A;  2RTX A;  2EMK A;  1JK2 A;  5TSE A;  2M9A A;  4MLV A;  3HTX A;  2EL5 A;  1Z1B A;  2G7H A;  2L3J A;  1AH5 A;  4LF9 E;  1N3G A;  2VE7 C;  2EQ1 A;  2EMH A;  1HNZ E;  3AUZ A;  4TUI A;  2EMC A;  4F2J C;  1A1F A;  1NEI A;  1PJS A;  2J7J A;  5BR8 E;  1T4L B;  2YTJ A;  4M2Z A;  2ELY A;  4R8O A;  2YT4 A;  3JU0 A;  4NXN E;  2JOX A;  2CSH A;  2EOJ A;  2EM3 A;  4AQY E;  4LF7 E;  4NZV A;  4F6N A;  1XNR E;  3ADI A;  5A6K A;  1T4O A;  2GHF A;  1B69 A;  2F4V E;  2DIX A;  2EPR A;  5KL7 A;  4WX9 A;  1IBK E;  2EOI A;  2F8B A;  2DMY A;  4DV0 E;  3C4B A;  4LFB E;  1SR9 A;  2ELZ A;  2K7I A;  4R2P A;  1XMO E;  4KHP E;  2EPP A;  1NCS A;  4WSP A;  4N4R B;  2EN3 A;  4Q35 B;  2LJH A;  4BHC A;  3MSW A;  4WXC A;  2UXD E;  2E72 A;  4M0V A;  1T4N A;  4R03 A;  2EQ3 A;  1FJG E;  1GTK A;  2EOX A;  4F54 A;  1FKA E;  1PJQ A;  2KHX A;  4F9A B;  2YTQ A;  1STU A;  2I9I A;  2I13 A;  4DR1 E;  3VHT B;  3QG5 C;  5LL6 R;  2JPA A;  4M30 A;  2RS7 A;  2DRP A;  2EMX A;  2EPN A;  4OX9 E;  4X9J A;  4DV1 E;  1P47 A;  1UHZ A;  1N34 E;  2EPL X;  4JI5 E;  4LF6 E;  2EM5 A;  1QU6 A;  4JI1 E;  4GZN C;  4BMJ A;  3P1X A;  2ODR D;  2V85 A;  2YWQ A;  3HXL A;  3KZZ A;  4JI4 E;  2LUP B;  1A1K A;  1HNX E;  3THN A;  5ADZ A;  4DUY E;  4DV7 E;  4TUG A;  1T39 A;  2YTF A;  2EL6 A;  4F9C B;  1HNW E;  2EM0 A;  3VYY A;  1WJP A;  4DKK A;  2EE8 A;  1YUJ A;  2ENH A;  1DI2 A;  1ZR9 A;  2EJ4 A;  2EMB A;  5A6J A;  4R2C A;  2YTN A;  4Q28 A;  4DUZ E;  1X6E A;  2LTS A;  5KL3 A;  2ENC A;  2DGC A;  2DB2 A;  2EM2 A;  2YTI A;  4NHR A;  1X47 A;  1X5W A;  2WBU A;  3THO B;  2L3C A;  2NUF A;  2LVH A;  1N33 E;  4LFA E;  4LTY A;  4GKK E;  3ZOQ B;  2GLI A;  3J7A G;  1TF6 A;  2YTE A;  2M4I A;  1G2F C;  4L5N C;  1G2D C;  4O43 A;  3RMP A;  5A69 A;  2LE2 A;  5AE3 A;  2E5L E;  2V86 A;  4GKJ E;  4X66 E;  1A1H A;  2L2K B;  2JR1 A;  1YZ9 A;  2DLQ A;  4DR7 E;  2UXC E;  1X6F A;  3BBG A;  1YYO A;  2EM6 A;  2FGG A;  2EOF A;  4JI7 E;  2EMZ A;  1WHN A;  3EPK A;  1TF3 A;  5FLX C;  4JI8 E;  2HGH A;  3ADJ A;  5IV8 B;  2LCE A;  1YFH A;  2D9H A;  2KOU A;  3J7Y p;  4R2S A;  4WFT A;  1RQ0 A;  2HC5 A;  2JYA A;  3BGH A;  3F6G A;  3OML A;  2LMZ A;  4RH8 A;  2FTX B;  4IJD A;  4F6M A;  1YPN A;  2EPA A;  4DR2 E;  1LLM C;  3HPS A;  2K4V A;  3K6Q A;  2JOB A;  1IBM E;  4JV5 E;  3T1Y E;  5AE2 A;  1BBG A;  1A1L A;  2EM9 A;  2EN4 A;  4O5G A;  1IBL E;  2VQE E;  1EH6 A;  1X48 A;  2YZT A;  2EMI A;  5IWA E;  4JI3 E;  2L2M A;  4P7D A;  2H36 X;  2UUB E;  4DV3 E;  3DJW A;  1N32 E;  1ZBQ A;  4K0K E;  2EM7 A;  3EPH A;  2EOZ A;  1GQE A;  2M1S A;  2E1M A;  1WHQ A;  2LJU A;  2EMW A;  4F9B B;  4LF4 E;  2DLK A;  2RSI A;  2JY9 A;  2N3H A;  4BC9 A;  2EZ6 A;  4IS1 C;  4O4K A;  2EMY A;  5AE1 A;  2EOR A;  2MDG A;  4B3M E;  4DV4 E;  2EPM X;  4O24 A;  3ADG A;  4ZYG A;  1IQO A;  2EOQ A;  4OOG C;  2LV2 A;  4P78 A;  4ZYE A;  2MC5 A;  2YTP A;  2LUQ A;  4DMI A;  3EPJ A;  5LMU E;  1HR0 E;  1O0W A;  4WSG A;  4KZS A;  2EOY A;  2LT7 A;  2EN7 A;  2L33 A;  5KL5 A;  3JTZ A;  3EPL A;  1WXR A;  3J80 C;  3IWD A;  4WPY A;  1JK1 A;  4B3R E;  2YRM A;  2L8T A;  2RS6 A;  2FV4 B;  4LF5 E;  4R2R A;  2UU9 E;  3VK6 A;  1GZ6 A;  2GPI A;  2DSY A;  2L6M A;  2A25 A;  1KYQ A;  4WYQ B;  2EP3 A;  2WZO A;  1J26 A;  2NAB A;  5AAS A;  2YU5 A;  1RC7 A;  2MDR A;  1EH7 A;  1IQS A;  3AV0 A;  2EM4 A;  3TQM A;  2EOM A;  2V87 A;  1UN6 B;  2LO3 A;  2YTD A;  2EPZ A;  3IWC A;  5CFF E;  1SFE A;  4B3S E;  1PDA A;  2EWL A;  2ENA A;  3JAM C;  5A6A A;  4X62 E;  2VF1 A;  4R2D A;  4HTG A;  5T6J A;  2EOE A;  1ZAA C;  2YTO A;  4BCA A;  2EN1 A;  3H09 A;  2B3T B;  4ZYD A;  2V8Q B;  1N36 E;  1AAY A;  3C6K A;  4DV2 E;  4BS9 A;  2LTR A;  1RMD A;  2JP9 A;  2L2N A;  4RHB B;  2R76 A;  2ADR A;  1YSA C;  4LFC E;  1QNT A;  4JI2 E;  2MC6 A;  1PKP A;  2LRS A; 
#chains in the Genus database with same CATH homology
 2HJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...