2JR1A

Solution structure of the dna binding domain of a nucleoid-associated protein, h-ns, from the phytopathogen xylella fastidiosa.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
79
structure length
79
Chain Sequence
FNVKQKSEITALVKEVTPPRKAPSKAKREAPIKYWLPHSGATWSGRGKIPKPFEAWIGTAAYTAWKAKHPDEKFPAFPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Virulence regulator
publication title Solution structure of the DNA binding domain of a nucleoid-associated protein, H-NS, from the phytopathogen Xylella fastidiosa.
rcsb
source organism Xylella fastidiosa
molecule tags Dna binding protein
total genus 16
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2007-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.510 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2jr1A01
2JR1A
chains in the Genus database with same CATH superfamily
4JI2E 3LMLA 1YPNA 5IXMB 2VF1A 2EMBA 2M4IA 4LF6E 2R1FA 2CTDA 2EQ1A 4F6MA 4R2SA 4BC7A 2RSIA 2YRMA 5LMNE 1IBME 2YSOA 3IWDA 2BB8A 2FTXB 2NUEA 1KJKA 4LFCE 1NCSA 2JP9A 3HQ1A 1EKZA 2RPCA 4BC9A 3F6HA 4NZVA 2V8QB 3TQMA 3BGHA 5KL3A 2LO3A 4R2PA 2V85A 1ZAAC 1A1LA 1QNTA 2BBGA 5KL6A 2EMKA 2YRHA 2RTXA 2V88A 4DR2E 1T39A 2V86A 3BBGA 2VRDA 1AAYA 2DGCA 4DV3E 3EQ1A 4BS9A 1TF3A 2EN2A 4Q35B 2DLQA 4O4KA 2CPNA 2JVAA 2LVHA 1UILA 4NHRA 2YTOA 5FLXC 2UU9E 1HNWE 4LF7E 4K0KE 2N8XA 2JY9A 2YTEA 2LUQA 4ZYHA 5DNYA 2YTGA 3EPHA 1T4LB 2EN6A 5F3WA 4O43A 2E5LE 2L33A 1UHZA 4R2CA 2LV2A 3MHHC 1G2FC 5IV8B 4LF9E 3ZOQB 1IBLE 1HR0E 2YTFA 2LJUA 4B3SE 1UN6B 5TSEA 4GKKE 2M9AA 3JTZA 2KOUA 4R2QA 2EJ4A 1KYQA 2EPXA 1T4NA 3RMPA 2EOQA 4DMIA 2GHFA 4WSPA 2YTJA 2LTRA 2EPNA 5LL6R 1X3CA 4R2RA 1T38A 3C6KA 3J81C 4LU9A 1YUIA 4LTYA 1JK1A 3VYXA 3EPJA 5A6BA 3KWRA 1SFEA 3OTOE 1YSAC 2YTIA 4DR7E 1J26A 2B7TA 2ENCA 2LE2A 3VYYA 2D9HA 4I8OA 2RQLA 3K6QA 3ADLA 2YWQA 2DSYA 3QG5C 1GZ6A 1YYKA 2YU5A 3MHSC 1WXRA 5T6JA 4HTGA 1A1IA 2F4VE 3JAMC 1BBOA 2EOEA 3UK3C 1O0WA 2CSHA 2EWLA 5A69A 2VE7C 4DV2E 4BHBA 2VQEE 4JI8E 2DRPA 2YTDA 5ADZA 4DV4E 2EPAA 4TUIA 2YZTA 2EE8A 2EOXA 2EM4A 2E72A 1PKPA 1X47A 1RC7A 1SR9A 2V83A 4MLVA 4LF4E 3VK6A 2E1MA 2FV4B 4BCAA 2YSPA 5A6AA 4R2AA 3HPSA 5AC5A 1A1FA 1XNQE 2UUCE 4N4RB 4OX9E 2EN1A 2EOMA 2EPLX 3ADIA 1BB8A 4M9VC 4LF8E 3LLHA 2NABA 2ADRA 1X48A 2MDRA 4IJDA 2EM6A 4LF5E 4F54A 1X5WA 1XNRE 1PJSA 3ADJA 3THNA 4O5GA 1X6EA 1HNXE 5IWAE 1WJPA 2EOIA 5AASA 4JV5E 2G7HA 2YPNA 2JYAA 4FK5C 2EOJA 4P78A 2EMIA 4HEIA 4WFTA 2WCC3 1F2IG 2EPMX 3P1XA 3L00A 5KL7A 2L2NA 4GEQB 1EH6A 2EN7A 3C4TA 2L2KB 2K7IA 1XMOE 2YT4A 4J8ZA 2UUAE 1YYOA 2LJHA 2V87A 1N33E 2ZM6E 2VQFE 1UBDC 4X62E 2EPZA 4WSGA 2L8TA 2RS6A 2LRSA 4X65E 2DMIA 2ELYA 5AE1A 4LFAE 1A1JA 2RSMA 5KL5A 2EOYA 1PJQA 1EH7A 4WX9A 2I13A 1IQOA 3IWCA 2JWOA 5AE2A 4F2JC 1B69A 2I9IA 2EPPA 5BR8E 3HPZA 4YY3E 3F6GA 1N3GA 1X49A 3OMLA 2EMYA 4X9JA 2LBSB 2GLIA 1A1HA 1N34E 5A6KA 1NEIA 4NXME 4BBYA 1FKAE 2MKNA 2UXCE 1IBKE 2EMCA 2LUPB 1XMQE 2YTQA 3MSWA 2EMGA 2DLKA 2DMYA 2GPIA 1TN9A 2EMHA 1N32E 1BBGA 1J5EE 4AQYE 4KWYA 2K4VA 4MLQA 2EMAA 1GQEA 1ZU1A 1X6FA 2YU8A 2ODRD 1IMUA 3FIGA 1GTKA 3BIDA 2EPRA 4R2DA 2RS7A 2LMZA 4B3TE 3KZZA 2UUBE 5A6JA 1A1GA 3VHTB 4DKKA 4L8NA 2ODRC 3BF2A 2M7QA 5A6BD 4JYAE 1RMDA 4ZYDA 2EM9A 1ZR9A 3H09A 2ENAA 4YHHE 2NA2A 2JPAA 2YTNA 4F9CB 3J80C 3DJWA 2EPUA 1DI2A 2EM3A 4NXNE 3IWBA 4BHCA 2M1SA 5IT9C 2L92A 2EQ0A 2L2MA 2CT1A 2EPKX 2H36X 2YRKA 4JI0E 2UXDE 2L3CA 1N36E 1YUJA 2EMFA 2EZ6A 2EOSA 4F6NA 1I94E 2ENHA 2HGHA 2EL6A 4KZSA 3AV0A 4R2EA 2LTSA 3JU0A 4P7DA 4LFBE 3ADGA 5LMUE 2HHHE 2WBSA 4OOGC 2EMZA 4R8OA 4F9BB 2EOFA 4JI7E 1MEYC 4JI4E 2YTPA 4B3ME 4DV0E 1STUA 4TUGA 4X8WA 1P47A 2MC6A 2EPOA 1FJGE 2EM2A 3T1HE 2JXPA 1A1KA 3J7AG 2FGGA 4DR6E 4DR4E 1DGCA 2V89A 2EMWA 1AH5A 1HNZE 4KHPE 2EN3A 1Z1BA 5AE3A 1MGTA 5A2QC 2EL5A 4DV7E 2EOZA 1PDAA 4WXDA 4L5NC 5LLQA 4WYQB 4X64E 2KHXA 2LT7A 1QU6A 4R03A 4DR5E 4DV6E 2WBUA 1JK2A 2JOBA 2PRTA 2L6MA 4Q28A 4JI3E 3C6MA 1T4OA 2EM5A 1WHNA 1DQ3A 2B3TB 2EORA 4RHBB 3THOB 5KL2A 5CFFE 2EMLA 2EM7A 5KL4A 2L3JA 4RH8A 4DUYE 2MC5A 2EOHA 3M99B 2HC5A 4DV1E 2NUFA 4DR3E 1IQSA 2EP3A 4IS1C 4JI6E 2HJJA 2MKDA 2EOOA 1WHQA 3T1YE 4M2ZA 2UXBE 2KONA 2MDGA 1L4SA 2Q8UA 3EPKA 1YZ9A 2LCEA 4DUZE 1X6HA 3AUZA 1LLMC 2N3HA 2F8BA 2EN8A 2A25A 2JR1A 4BMJA 2DB2A 1EH8A 1YYWA 2IHR1 4M30A 4JI1E 1ZBTA 4ZYEA 3J7Yp 3C4BA 2ELZA 1WRJA 2EM0A 1PJTA 4WPYA 3EPLA 4GZNC 2B7VA 1G2DC 2JOXA 4GKJE 1ZBQA 2EM8A 1YFHA 3HTXA 2WZOA 2EPCA 4X66E 2J7JA 1RQ0A 2NUGA 3KZYA 2EQ3A 4O24A 3ECRA 4F9AB 4DR1E 2R76A 3DF6A 4JI5E 2DIXA 2EN4A 2B9DA 2WBTA 4WXCA 4M0VA 4ZYGA 4DV5E 3HXLA 4B3RE 2EL4A 1TF6A 2N3GA 5AC4A 2EMXA
chains in the Genus database with same CATH topology
4JI2E 2B7TA 2LE2A 5BR8E 3HPZA 4YY3E 3VYYA 4KHPE 3F6GA 3LMLA 3K6QA 4I8OA 1X49A 3ADLA 3OMLA 2DSYA 1GZ6A 2VF1A 2LBSB 4LF6E 2M4IA 5AE3A 1N34E 1YYKA 5A2QC 4NXME 1WXRA 5T6JA 4DV7E 4BBYA 4BC7A 1FKAE 5LMNE 1IBME 2F4VE 2UXCE 2V89A 3IWDA 3JAMC 1IBKE 2LUPB 2FTXB 1XMQE 4LFBE 4L5NC 4WYQB 1O0WA 3MSWA 2EWLA 4X64E 4LFCE 2NUEA 2KHXA 2VE7C 1QU6A 4DV2E 2DMYA 3HQ1A 2VQEE 4JI8E 4R03A 4DR5E 1EKZA 1N32E 4DV6E 4BC9A 3F6HA 2JOBA 5ADZA 4DV4E 1J5EE 2V8QB 4AQYE 2K4VA 2L6MA 4Q28A 4JI3E 1GQEA 2V85A 2YZTA 4TUIA 1T4OA 2ODRD 3FIGA 1WHNA 1DQ3A 1PKPA 2B3TB 1X47A 2RTXA 2V88A 4DR2E 1SR9A 2RS7A 1RC7A 2V86A 2LMZA 2V83A 4B3TE 4LF4E 3VK6A 5CFFE 2E1MA 2L3JA 2FV4B 4DV3E 2UUBE 4BCAA 4DUYE 2MC5A 3HPSA 4BS9A 4DV1E 2NUFA 4DKKA 1XNQE 4L8NA 4DR3E 2UUCE 2CPNA 2JVAA 2ODRC 4OX9E 1UILA 3ADIA 5FLXC 1HNWE 2UU9E 2M7QA 4LF7E 4JYAE 4LF8E 3LLHA 4JI6E 4K0KE 1X48A 2MDRA 3H09A 1WHQA 3T1YE 4M2ZA 2JY9A 4YHHE 2LUQA 2NA2A 5DNYA 2UXBE 2KONA 4LF5E 4F54A 1XNRE 4F9CB 3ADJA 3J80C 1T4LB 1YZ9A 1HNXE 3DJWA 5F3WA 1DI2A 5IWAE 4DUZE 4NXNE 2E5LE 2L33A 1UHZA 5AASA 3IWBA 3AUZA 2G7HA 4JV5E 2M1SA 2N3HA 2F8BA 4P78A 5IT9C 2L92A 2L2MA 4WFTA 4LF9E 3ZOQB 2JR1A 2H36X 4BMJA 4JI0E 2DB2A 1IBLE 2UXDE 1YYWA 2L3CA 3P1XA 1N36E 1HR0E 2IHR1 4M30A 4JI1E 1ZBTA 2L2NA 4B3SE 2EZ6A 3J7Yp 3C4BA 4GEQB 4GKKE 3JTZA 3C4TA 2L2KB 2KOUA 1I94E 4WPYA 1XMOE 2YT4A 4J8ZA 2UUAE 1YYOA 3IWCA 2B7VA 2LJHA 2V87A 4KZSA 2JOXA 3AV0A 4GKJE 1ZBQA 2LTSA 1N33E 3HTXA 1T4NA 2WZOA 3RMPA 3JU0A 4P7DA 4X66E 3ADGA 4DMIA 2ZM6E 2VQFE 1RQ0A 4WSPA 4X62E 5LMUE 2HHHE 2NUGA 2LTRA 2L8TA 2RS6A 4R8OA 4OOGC 2LRSA 5LL6R 4F9AB 4F9BB 5AE1A 4X65E 4DR1E 4JI7E 3DF6A 4JI5E 4LFAE 4JI4E 2RSMA 4B3ME 4DV0E 1STUA 4TUGA 4X8WA 3J81C 4LU9A 4LTYA 2MC6A 2DIXA 1FJGE 2B9DA 3VYXA 3T1HE 3KWRA 4M0VA 3J7AG 4DV5E 3HXLA 3OTOE 4B3RE 2FGGA 2N3GA 4DR6E 4DR4E 2JWOA 5AE2A 4DR7E 1HNZE 1J26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JR1 A; 
#chains in the Genus database with same CATH topology
 4JI2 E;  3LML A;  1YPN A;  5IXM B;  2VF1 A;  2EMB A;  2M4I A;  4LF6 E;  2R1F A;  2CTD A;  2EQ1 A;  4F6M A;  4R2S A;  4BC7 A;  2RSI A;  2YRM A;  5LMN E;  1IBM E;  2YSO A;  3IWD A;  2BB8 A;  2FTX B;  2NUE A;  1KJK A;  4LFC E;  1NCS A;  2JP9 A;  3HQ1 A;  1EKZ A;  2RPC A;  4BC9 A;  3F6H A;  4NZV A;  2V8Q B;  3TQM A;  3BGH A;  5KL3 A;  2LO3 A;  4R2P A;  2V85 A;  1ZAA C;  1A1L A;  1QNT A;  2BBG A;  5KL6 A;  2EMK A;  2YRH A;  2RTX A;  2V88 A;  4DR2 E;  1T39 A;  2V86 A;  3BBG A;  2VRD A;  1AAY A;  2DGC A;  4DV3 E;  3EQ1 A;  4BS9 A;  1TF3 A;  2EN2 A;  4Q35 B;  2DLQ A;  4O4K A;  2CPN A;  2JVA A;  2LVH A;  1UIL A;  4NHR A;  2YTO A;  5FLX C;  2UU9 E;  1HNW E;  4LF7 E;  4K0K E;  2N8X A;  2JY9 A;  2YTE A;  2LUQ A;  4ZYH A;  5DNY A;  2YTG A;  3EPH A;  1T4L B;  2EN6 A;  5F3W A;  4O43 A;  2E5L E;  2L33 A;  1UHZ A;  4R2C A;  2LV2 A;  3MHH C;  1G2F C;  5IV8 B;  4LF9 E;  3ZOQ B;  1IBL E;  1HR0 E;  2YTF A;  2LJU A;  4B3S E;  1UN6 B;  5TSE A;  4GKK E;  2M9A A;  3JTZ A;  2KOU A;  4R2Q A;  2EJ4 A;  1KYQ A;  2EPX A;  1T4N A;  3RMP A;  2EOQ A;  4DMI A;  2GHF A;  4WSP A;  2YTJ A;  2LTR A;  2EPN A;  5LL6 R;  1X3C A;  4R2R A;  1T38 A;  3C6K A;  3J81 C;  4LU9 A;  1YUI A;  4LTY A;  1JK1 A;  3VYX A;  3EPJ A;  5A6B A;  3KWR A;  1SFE A;  3OTO E;  1YSA C;  2YTI A;  4DR7 E;  1J26 A;  2B7T A;  2ENC A;  2LE2 A;  3VYY A;  2D9H A;  4I8O A;  2RQL A;  3K6Q A;  3ADL A;  2YWQ A;  2DSY A;  3QG5 C;  1GZ6 A;  1YYK A;  2YU5 A;  3MHS C;  1WXR A;  5T6J A;  4HTG A;  1A1I A;  2F4V E;  3JAM C;  1BBO A;  2EOE A;  3UK3 C;  1O0W A;  2CSH A;  2EWL A;  5A69 A;  2VE7 C;  4DV2 E;  4BHB A;  2VQE E;  4JI8 E;  2DRP A;  2YTD A;  5ADZ A;  4DV4 E;  2EPA A;  4TUI A;  2YZT A;  2EE8 A;  2EOX A;  2EM4 A;  2E72 A;  1PKP A;  1X47 A;  1RC7 A;  1SR9 A;  2V83 A;  4MLV A;  4LF4 E;  3VK6 A;  2E1M A;  2FV4 B;  4BCA A;  2YSP A;  5A6A A;  4R2A A;  3HPS A;  5AC5 A;  1A1F A;  1XNQ E;  2UUC E;  4N4R B;  4OX9 E;  2EN1 A;  2EOM A;  2EPL X;  3ADI A;  1BB8 A;  4M9V C;  4LF8 E;  3LLH A;  2NAB A;  2ADR A;  1X48 A;  2MDR A;  4IJD A;  2EM6 A;  4LF5 E;  4F54 A;  1X5W A;  1XNR E;  1PJS A;  3ADJ A;  3THN A;  4O5G A;  1X6E A;  1HNX E;  5IWA E;  1WJP A;  2EOI A;  5AAS A;  4JV5 E;  2G7H A;  2YPN A;  2JYA A;  4FK5 C;  2EOJ A;  4P78 A;  2EMI A;  4HEI A;  4WFT A;  2WCC 3;  1F2I G;  2EPM X;  3P1X A;  3L00 A;  5KL7 A;  2L2N A;  4GEQ B;  1EH6 A;  2EN7 A;  3C4T A;  2L2K B;  2K7I A;  1XMO E;  2YT4 A;  4J8Z A;  2UUA E;  1YYO A;  2LJH A;  2V87 A;  1N33 E;  2ZM6 E;  2VQF E;  1UBD C;  4X62 E;  2EPZ A;  4WSG A;  2L8T A;  2RS6 A;  2LRS A;  4X65 E;  2DMI A;  2ELY A;  5AE1 A;  4LFA E;  1A1J A;  2RSM A;  5KL5 A;  2EOY A;  1PJQ A;  1EH7 A;  4WX9 A;  2I13 A;  1IQO A;  3IWC A;  2JWO A;  5AE2 A;  4F2J C;  1B69 A;  2I9I A;  2EPP A;  5BR8 E;  3HPZ A;  4YY3 E;  3F6G A;  1N3G A;  1X49 A;  3OML A;  2EMY A;  4X9J A;  2LBS B;  2GLI A;  1A1H A;  1N34 E;  5A6K A;  1NEI A;  4NXM E;  4BBY A;  1FKA E;  2MKN A;  2UXC E;  1IBK E;  2EMC A;  2LUP B;  1XMQ E;  2YTQ A;  3MSW A;  2EMG A;  2DLK A;  2DMY A;  2GPI A;  1TN9 A;  2EMH A;  1N32 E;  1BBG A;  1J5E E;  4AQY E;  4KWY A;  2K4V A;  4MLQ A;  2EMA A;  1GQE A;  1ZU1 A;  1X6F A;  2YU8 A;  2ODR D;  1IMU A;  3FIG A;  1GTK A;  3BID A;  2EPR A;  4R2D A;  2RS7 A;  2LMZ A;  4B3T E;  3KZZ A;  2UUB E;  5A6J A;  1A1G A;  3VHT B;  4DKK A;  4L8N A;  2ODR C;  3BF2 A;  2M7Q A;  5A6B D;  4JYA E;  1RMD A;  4ZYD A;  2EM9 A;  1ZR9 A;  3H09 A;  2ENA A;  4YHH E;  2NA2 A;  2JPA A;  2YTN A;  4F9C B;  3J80 C;  3DJW A;  2EPU A;  1DI2 A;  2EM3 A;  4NXN E;  3IWB A;  4BHC A;  2M1S A;  5IT9 C;  2L92 A;  2EQ0 A;  2L2M A;  2CT1 A;  2EPK X;  2H36 X;  2YRK A;  4JI0 E;  2UXD E;  2L3C A;  1N36 E;  1YUJ A;  2EMF A;  2EZ6 A;  2EOS A;  4F6N A;  1I94 E;  2ENH A;  2HGH A;  2EL6 A;  4KZS A;  3AV0 A;  4R2E A;  2LTS A;  3JU0 A;  4P7D A;  4LFB E;  3ADG A;  5LMU E;  2HHH E;  2WBS A;  4OOG C;  2EMZ A;  4R8O A;  4F9B B;  2EOF A;  4JI7 E;  1MEY C;  4JI4 E;  2YTP A;  4B3M E;  4DV0 E;  1STU A;  4TUG A;  4X8W A;  1P47 A;  2MC6 A;  2EPO A;  1FJG E;  2EM2 A;  3T1H E;  2JXP A;  1A1K A;  3J7A G;  2FGG A;  4DR6 E;  4DR4 E;  1DGC A;  2V89 A;  2EMW A;  1AH5 A;  1HNZ E;  4KHP E;  2EN3 A;  1Z1B A;  5AE3 A;  1MGT A;  5A2Q C;  2EL5 A;  4DV7 E;  2EOZ A;  1PDA A;  4WXD A;  4L5N C;  5LLQ A;  4WYQ B;  4X64 E;  2KHX A;  2LT7 A;  1QU6 A;  4R03 A;  4DR5 E;  4DV6 E;  2WBU A;  1JK2 A;  2JOB A;  2PRT A;  2L6M A;  4Q28 A;  4JI3 E;  3C6M A;  1T4O A;  2EM5 A;  1WHN A;  1DQ3 A;  2B3T B;  2EOR A;  4RHB B;  3THO B;  5KL2 A;  5CFF E;  2EML A;  2EM7 A;  5KL4 A;  2L3J A;  4RH8 A;  4DUY E;  2MC5 A;  2EOH A;  3M99 B;  2HC5 A;  4DV1 E;  2NUF A;  4DR3 E;  1IQS A;  2EP3 A;  4IS1 C;  4JI6 E;  2HJJ A;  2MKD A;  2EOO A;  1WHQ A;  3T1Y E;  4M2Z A;  2UXB E;  2KON A;  2MDG A;  1L4S A;  2Q8U A;  3EPK A;  1YZ9 A;  2LCE A;  4DUZ E;  1X6H A;  3AUZ A;  1LLM C;  2N3H A;  2F8B A;  2EN8 A;  2A25 A;  2JR1 A;  4BMJ A;  2DB2 A;  1EH8 A;  1YYW A;  2IHR 1;  4M30 A;  4JI1 E;  1ZBT A;  4ZYE A;  3J7Y p;  3C4B A;  2ELZ A;  1WRJ A;  2EM0 A;  1PJT A;  4WPY A;  3EPL A;  4GZN C;  2B7V A;  1G2D C;  2JOX A;  4GKJ E;  1ZBQ A;  2EM8 A;  1YFH A;  3HTX A;  2WZO A;  2EPC A;  4X66 E;  2J7J A;  1RQ0 A;  2NUG A;  3KZY A;  2EQ3 A;  4O24 A;  3ECR A;  4F9A B;  4DR1 E;  2R76 A;  3DF6 A;  4JI5 E;  2DIX A;  2EN4 A;  2B9D A;  2WBT A;  4WXC A;  4M0V A;  4ZYG A;  4DV5 E;  3HXL A;  4B3R E;  2EL4 A;  1TF6 A;  2N3G A;  5AC4 A;  2EMX A; 
#chains in the Genus database with same CATH homology
 4JI2 E;  2B7T A;  2LE2 A;  5BR8 E;  3HPZ A;  4YY3 E;  3VYY A;  4KHP E;  3F6G A;  3LML A;  3K6Q A;  4I8O A;  1X49 A;  3ADL A;  3OML A;  2DSY A;  1GZ6 A;  2VF1 A;  2LBS B;  4LF6 E;  2M4I A;  5AE3 A;  1N34 E;  1YYK A;  5A2Q C;  4NXM E;  1WXR A;  5T6J A;  4DV7 E;  4BBY A;  4BC7 A;  1FKA E;  5LMN E;  1IBM E;  2F4V E;  2UXC E;  2V89 A;  3IWD A;  3JAM C;  1IBK E;  2LUP B;  2FTX B;  1XMQ E;  4LFB E;  4L5N C;  4WYQ B;  1O0W A;  3MSW A;  2EWL A;  4X64 E;  4LFC E;  2NUE A;  2KHX A;  2VE7 C;  1QU6 A;  4DV2 E;  2DMY A;  3HQ1 A;  2VQE E;  4JI8 E;  4R03 A;  4DR5 E;  1EKZ A;  1N32 E;  4DV6 E;  4BC9 A;  3F6H A;  2JOB A;  5ADZ A;  4DV4 E;  1J5E E;  2V8Q B;  4AQY E;  2K4V A;  2L6M A;  4Q28 A;  4JI3 E;  1GQE A;  2V85 A;  2YZT A;  4TUI A;  1T4O A;  2ODR D;  3FIG A;  1WHN A;  1DQ3 A;  1PKP A;  2B3T B;  1X47 A;  2RTX A;  2V88 A;  4DR2 E;  1SR9 A;  2RS7 A;  1RC7 A;  2V86 A;  2LMZ A;  2V83 A;  4B3T E;  4LF4 E;  3VK6 A;  5CFF E;  2E1M A;  2L3J A;  2FV4 B;  4DV3 E;  2UUB E;  4BCA A;  4DUY E;  2MC5 A;  3HPS A;  4BS9 A;  4DV1 E;  2NUF A;  4DKK A;  1XNQ E;  4L8N A;  4DR3 E;  2UUC E;  2CPN A;  2JVA A;  2ODR C;  4OX9 E;  1UIL A;  3ADI A;  5FLX C;  1HNW E;  2UU9 E;  2M7Q A;  4LF7 E;  4JYA E;  4LF8 E;  3LLH A;  4JI6 E;  4K0K E;  1X48 A;  2MDR A;  3H09 A;  1WHQ A;  3T1Y E;  4M2Z A;  2JY9 A;  4YHH E;  2LUQ A;  2NA2 A;  5DNY A;  2UXB E;  2KON A;  4LF5 E;  4F54 A;  1XNR E;  4F9C B;  3ADJ A;  3J80 C;  1T4L B;  1YZ9 A;  1HNX E;  3DJW A;  5F3W A;  1DI2 A;  5IWA E;  4DUZ E;  4NXN E;  2E5L E;  2L33 A;  1UHZ A;  5AAS A;  3IWB A;  3AUZ A;  2G7H A;  4JV5 E;  2M1S A;  2N3H A;  2F8B A;  4P78 A;  5IT9 C;  2L92 A;  2L2M A;  4WFT A;  4LF9 E;  3ZOQ B;  2JR1 A;  2H36 X;  4BMJ A;  4JI0 E;  2DB2 A;  1IBL E;  2UXD E;  1YYW A;  2L3C A;  3P1X A;  1N36 E;  1HR0 E;  2IHR 1;  4M30 A;  4JI1 E;  1ZBT A;  2L2N A;  4B3S E;  2EZ6 A;  3J7Y p;  3C4B A;  4GEQ B;  4GKK E;  3JTZ A;  3C4T A;  2L2K B;  2KOU A;  1I94 E;  4WPY A;  1XMO E;  2YT4 A;  4J8Z A;  2UUA E;  1YYO A;  3IWC A;  2B7V A;  2LJH A;  2V87 A;  4KZS A;  2JOX A;  3AV0 A;  4GKJ E;  1ZBQ A;  2LTS A;  1N33 E;  3HTX A;  1T4N A;  2WZO A;  3RMP A;  3JU0 A;  4P7D A;  4X66 E;  3ADG A;  4DMI A;  2ZM6 E;  2VQF E;  1RQ0 A;  4WSP A;  4X62 E;  5LMU E;  2HHH E;  2NUG A;  2LTR A;  2L8T A;  2RS6 A;  4R8O A;  4OOG C;  2LRS A;  5LL6 R;  4F9A B;  4F9B B;  5AE1 A;  4X65 E;  4DR1 E;  4JI7 E;  3DF6 A;  4JI5 E;  4LFA E;  4JI4 E;  2RSM A;  4B3M E;  4DV0 E;  1STU A;  4TUG A;  4X8W A;  3J81 C;  4LU9 A;  4LTY A;  2MC6 A;  2DIX A;  1FJG E;  2B9D A;  3VYX A;  3T1H E;  3KWR A;  4M0V A;  3J7A G;  4DV5 E;  3HXL A;  3OTO E;  4B3R E;  2FGG A;  2N3G A;  4DR6 E;  4DR4 E;  2JWO A;  5AE2 A;  4DR7 E;  1HNZ E;  1J26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...