2JR1A

Solution structure of the dna binding domain of a nucleoid-associated protein, h-ns, from the phytopathogen xylella fastidiosa.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
79
structure length
79
Chain Sequence
FNVKQKSEITALVKEVTPPRKAPSKAKREAPIKYWLPHSGATWSGRGKIPKPFEAWIGTAAYTAWKAKHPDEKFPAFPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the DNA binding domain of a nucleoid-associated protein, H-NS, from the phytopathogen Xylella fastidiosa.
rcsb
source organism Xylella fastidiosa
molecule tags Dna binding protein
molecule keywords Virulence regulator
total genus 16
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2007-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.510 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2jr1A01
2JR1A
chains in the Genus database with same CATH superfamily
2EM5A 4KZSA 1T38A 2DMYA 4F2JC 3DJWA 1AAYA 1PJQA 4TUGA 4ZYDA 2L33A 1XMQE 4WX9A 2VQEE 2EMLA 3VHTB 3IWDA 4M0VA 5AC5A 2JR1A 4M2ZA 3THNA 1JK2A 2FTXB 3MSWA 1X6EA 1F2IG 4Q28A 3L00A 2EPAA 3J81C 5AC4A 4F6MA 2EOJA 1PJTA 4NZVA 2EM8A 2JWOA 2UXDE 3C6KA 1LLMC 5TSEA 4LFAE 4R2AA 3JAMC 1EKZA 2EMBA 1IQSA 2ENHA 3FIGA 1G2DC 5A69A 1N36E 3ADJA 4BMJA 4F9CB 5AE1A 1A1IA 2MC6A 5A6KA 2UU9E 4GEQB 2M9AA 2EN6A 2GHFA 1UILA 1EH8A 1X5WA 1Z1BA 3DF6A 1STUA 2MC5A 2EOFA 3K6QA 5CFFE 2B3TB 4AQYE 1UHZA 2ENAA 2L2NA 4GKJE 2EM7A 2YSPA 5AE2A 2MKNA 4WSGA 1WJPA 2EMGA 2PRTA 1JK1A 1B69A 4DUZE 2BBGA 3HPSA 4L5NC 2DGCA 4JI1E 4DR7E 2UXBE 4WFTA 3F6GA 5A6BA 2EZ6A 4F9AB 4JI4E 4Q35B 2E72A 2EOHA 2VRDA 1ZBQA 2EPOA 1RC7A 2JY9A 5A2QC 1HNXE 3OMLA 2EL5A 3AV0A 1SFEA 4NXNE 4FK5C 4IS1C 4HTGA 1RQ0A 2EOQA 2EM2A 4F9BB 4LF4E 2LBSB 2N3HA 2LUPB 3THOB 2EL6A 2EMXA 4YY3E 4BCAA 1WHQA 4X62E 2NUEA 2EQ3A 2Q8UA 3LMLA 2M7QA 4WPYA 2WBTA 2ADRA 2LCEA 4JYAE 4O24A 1TF3A 2EOMA 2M4IA 2ENCA 4X8WA 2YU5A 4LF9E 4NXME 2ODRD 4MLQA 3RMPA 4BBYA 5KL6A 2LRSA 2EPNA 1T4OA 2V86A 2EMFA 2LTRA 2V85A 4WSPA 1X3CA 2F4VE 2EM9A 2K4VA 2CPNA 2YTFA 1WXRA 3OTOE 1QU6A 3KZYA 4HEIA 2YSOA 2A25A 2EN4A 2NUFA 3JTZA 2EL4A 1A1FA 1IBME 5AE3A 2EOIA 3QG5C 3C6MA 1HNZE 3HPZA 2R76A 5LLQA 4F6NA 4DR6E 2VE7C 4BHBA 1DGCA 2LVHA 4LF8E 2EOEA 4M9VC 4DV2E 2YRKA 2DB2A 2VF1A 2GPIA 1HR0E 1YUJA 2B7TA 4M30A 2LTSA 1GZ6A 4B3TE 2EWLA 2ODRC 2EMWA 2EOSA 1TN9A 2H36X 3T1YE 5LL6R 4BHCA 4R2RA 3EQ1A 5DNYA 2YT4A 1GTKA 2EPXA 3HQ1A 4O43A 2N8XA 1I94E 4N4RB 2EPPA 2EP3A 2B9DA 2YRHA 2CT1A 1L4SA 4R03A 1X48A 2JP9A 4O5GA 1WRJA 5T6JA 2EORA 2HC5A 1NCSA 2KHXA 2J7JA 2VQFE 2WBUA 3ADLA 2EPUA 4DMIA 1FKAE 2DLKA 1MEYC 1IMUA 2DLQA 2EN2A 5IWAE 2MKDA 2GLIA 1A1GA 5IT9C 4WXDA 1X49A 1P47A 4DR1E 4DV0E 3ADGA 3BF2A 1PJSA 2YTOA 5KL3A 5AASA 4GZNC 5LMUE 4LFBE 4BC7A 3AUZA 2YWQA 2DIXA 3M99B 4DV1E 2YTJA 3TQMA 2MDRA 4DR4E 2EPLX 4X9JA 2ELZA 2K7IA 4B3RE 4X66E 2NUGA 4R2DA 5LMNE 3VYXA 4K0KE 2EM0A 4JV5E 4WXCA 1X6FA 3HTXA 2YRMA 4I8OA 4ZYHA 2EQ1A 2YTEA 2YTGA 1N32E 2FGGA 1G2FC 2DMIA 2YTNA 4GKKE 3ZOQB 1A1LA 4DV7E 2HJJA 1XNQE 2E1MA 3ECRA 2EMHA 2EPZA 2EPMX 3JU0A 2JPAA 2B7VA 2DRPA 2EN7A 2LO3A 3C4BA 4JI2E 4LU9A 2CTDA 2DSYA 1A1HA 3EPJA 4R2PA 4LF6E 1YYWA 1YUIA 5FLXC 1KJKA 2EN1A 1SR9A 2EMZA 5KL7A 4L8NA 3HXLA 2EQ0A 2EMYA 3UK3C 4X64E 2G7HA 3J80C 2WCC3 2LJHA 4BS9A 2R1FA 4BC9A 2ZM6E 1IQOA 4RH8A 1NEIA 2EM4A 2N3GA 3BIDA 2EMKA 3KWRA 3IWCA 3VK6A 1X6HA 1YZ9A 2RSMA 4P7DA 3J7Yp 1IBKE 4R2QA 4KHPE 4DV5E 1J26A 4R8OA 1ZAAC 1BBGA 1PKPA 1EH7A 2UXCE 1WHNA 2LUQA 2YU8A 1YPNA 4JI8E 2EM6A 2WZOA 1N34E 4DKKA 2LE2A 4KWYA 2EJ4A 1BBOA 1O0WA 3EPLA 2V83A 2RTXA 1FJGE 4OOGC 4J8ZA 2YTDA 2EN8A 2EPKX 2RQLA 5F3WA 2YTQA 5BR8E 2EOXA 4OX9E 2EPRA 2RS7A 4JI5E 4F54A 1T39A 1IBLE 2L8TA 1KYQA 1UN6B 2F8BA 4DUYE 3P1XA 2EM3A 4ZYGA 1PDAA 1AH5A 1XMOE 4LTYA 2E5LE 2UUBE 2YZTA 5IXMB 1J5EE 3C4TA 2WBSA 2IHR1 4JI0E 2V88A 4WYQB 3T1HE 4IJDA 4MLVA 1RMDA 3J7AG 4DR5E 1N33E 3BBGA 2UUAE 4P78A 2NA2A 1YFHA 2LJUA 2JYAA 1YSAC 2M1SA 4O4KA 1ZU1A 4NHRA 1HNWE 2BB8A 1GQEA 3VYYA 1TF6A 2LMZA 1T4NA 2EOYA 4LF7E 1ZR9A 2D9HA 3F6HA 2JXPA 2V87A 3MHSC 5ADZA 3LLHA 2KOUA 1DQ3A 2EOZA 4R2CA 2I13A 2L3JA 3ADIA 1X47A 1UBDC 1BB8A 2RS6A 2L92A 4JI3E 4DV3E 4B3SE 2YTPA 2HHHE 2FV4B 1YYKA 2KONA 2RSIA 2YPNA 1MGTA 4DR3E 4JI7E 4R2SA 2MDGA 1A1KA 2CSHA 3MHHC 2L2MA 1EH6A 2NABA 4LFCE 4RHBB 1DI2A 4LF5E 1YYOA 2V89A 2EPCA 2UUCE 3KZZA 2LV2A 3BGHA 5KL4A 3IWBA 4DR2E 2V8QB 2EN3A 2RPCA 4B3ME 2JVAA 4ZYEA 1XNRE 4TUIA 1A1JA 2JOBA 5KL2A 4YHHE 5IV8B 5KL5A 3EPHA 2ELYA 2I9IA 2YTIA 4DV4E 2JOXA 1N3GA 2EE8A 2EOOA 2L6MA 2L2KB 4JI6E 1T4LB 5A6AA 3H09A 4X65E 1QNTA 2EMIA 4R2EA 2LT7A 5A6JA 5A6BD 2EMAA 2EMCA 1ZBTA 3EPKA 4DV6E 2L3CA 2HGHA
chains in the Genus database with same CATH topology
2E5LE 2MDRA 3LMLA 4KZSA 4DR4E 2UUBE 2YZTA 2M7QA 4B3RE 1J5EE 2DMYA 3C4TA 4X66E 2NUGA 4WPYA 2IHR1 3DJWA 4JI0E 4JYAE 5LMNE 2V88A 4TUGA 3VYXA 2L33A 4WYQB 4K0KE 3T1HE 1XMQE 4JV5E 2VQEE 2M4IA 3J7AG 3IWDA 4M0VA 4X8WA 3HTXA 4DR5E 4LF9E 1N33E 2UUAE 2JR1A 4P78A 4M2ZA 4NXME 2NA2A 2ODRD 4I8OA 3RMPA 4BBYA 2LRSA 2FTXB 1T4OA 2M1SA 2V86A 3MSWA 1N32E 2FGGA 2LTRA 2V85A 4Q28A 4WSPA 3J81C 1HNWE 1GQEA 2F4VE 4GKKE 3ZOQB 2K4VA 2CPNA 1WXRA 3OTOE 3VYYA 4DV7E 1QU6A 2LMZA 1T4NA 1XNQE 4LF7E 2JWOA 2UXDE 2NUFA 2E1MA 3JTZA 3F6HA 4LFAE 1IBME 3JU0A 5AE3A 3JAMC 1EKZA 2B7VA 2V87A 3C4BA 5ADZA 4JI2E 3LLHA 2KOUA 1DQ3A 4LU9A 1HNZE 3FIGA 3HPZA 2DSYA 2L3JA 3ADIA 1X47A 4DR6E 2VE7C 1N36E 4LF6E 3ADJA 4BMJA 4LF8E 1YYWA 5FLXC 4F9CB 5AE1A 2RS6A 2MC6A 4DV2E 2L92A 1XMOE 1SR9A 2VF1A 2DB2A 2UU9E 1HR0E 4JI3E 2B7TA 4M30A 4DV3E 2LTSA 4GEQB 4L8NA 1GZ6A 3HXLA 4B3SE 2HHHE 2FV4B 1YYKA 4B3TE 2KONA 2EWLA 1UILA 2ODRC 4X64E 2G7HA 3J80C 4DR3E 3DF6A 4JI7E 1STUA 2MC5A 2LJHA 2H36X 4BS9A 3T1YE 5LL6R 3K6QA 2L2MA 4BC9A 5DNYA 2ZM6E 5CFFE 2B3TB 2YT4A 4AQYE 4LFCE 3HQ1A 1UHZA 2L2NA 1DI2A 4LF5E 4GKJE 2N3GA 1YYOA 2V89A 1I94E 2B9DA 3KWRA 5AE2A 2UUCE 3IWCA 3VK6A 1YZ9A 3IWBA 2RSMA 4P7DA 2V8QB 3J7Yp 4DR2E 1IBKE 4DUZE 3HPSA 1X48A 4L5NC 4R03A 4JI1E 4KHPE 4DV5E 4B3ME 4DR7E 2UXBE 4R8OA 4WFTA 3F6GA 1J26A 2JVAA 1PKPA 1XNRE 4F9AB 5T6JA 4TUIA 2JOBA 4JI4E 2EZ6A 4YHHE 1WHNA 2UXCE 2KHXA 2LUQA 4JI8E 2VQFE 3ADLA 4DMIA 2WZOA 1FKAE 1N34E 1ZBQA 4DKKA 2LE2A 1RC7A 2JY9A 5A2QC 1O0WA 1HNXE 3OMLA 3AV0A 2V83A 2RTXA 1FJGE 4NXNE 5IWAE 4DV4E 5IT9C 4OOGC 1X49A 4J8ZA 1RQ0A 4F9BB 2JOXA 2L6MA 2L2KB 4DR1E 5F3WA 5BR8E 4DV0E 4JI6E 4LF4E 3ADGA 4OX9E 1T4LB 2RS7A 3H09A 2LBSB 4F54A 4JI5E 4X65E 2N3HA 2LUPB 2L8TA 1IBLE 5AASA 2F8BA 5LMUE 4DUYE 4LFBE 3P1XA 4YY3E 4BCAA 1WHQA 4BC7A 1ZBTA 3AUZA 4X62E 2DIXA 4DV1E 4DV6E 2NUEA 2L3CA 4LTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JR1 A; 
#chains in the Genus database with same CATH topology
 2EM5 A;  4KZS A;  1T38 A;  2DMY A;  4F2J C;  3DJW A;  1AAY A;  1PJQ A;  4TUG A;  4ZYD A;  2L33 A;  1XMQ E;  4WX9 A;  2VQE E;  2EML A;  3VHT B;  3IWD A;  4M0V A;  5AC5 A;  2JR1 A;  4M2Z A;  3THN A;  1JK2 A;  2FTX B;  3MSW A;  1X6E A;  1F2I G;  4Q28 A;  3L00 A;  2EPA A;  3J81 C;  5AC4 A;  4F6M A;  2EOJ A;  1PJT A;  4NZV A;  2EM8 A;  2JWO A;  2UXD E;  3C6K A;  1LLM C;  5TSE A;  4LFA E;  4R2A A;  3JAM C;  1EKZ A;  2EMB A;  1IQS A;  2ENH A;  3FIG A;  1G2D C;  5A69 A;  1N36 E;  3ADJ A;  4BMJ A;  4F9C B;  5AE1 A;  1A1I A;  2MC6 A;  5A6K A;  2UU9 E;  4GEQ B;  2M9A A;  2EN6 A;  2GHF A;  1UIL A;  1EH8 A;  1X5W A;  1Z1B A;  3DF6 A;  1STU A;  2MC5 A;  2EOF A;  3K6Q A;  5CFF E;  2B3T B;  4AQY E;  1UHZ A;  2ENA A;  2L2N A;  4GKJ E;  2EM7 A;  2YSP A;  5AE2 A;  2MKN A;  4WSG A;  1WJP A;  2EMG A;  2PRT A;  1JK1 A;  1B69 A;  4DUZ E;  2BBG A;  3HPS A;  4L5N C;  2DGC A;  4JI1 E;  4DR7 E;  2UXB E;  4WFT A;  3F6G A;  5A6B A;  2EZ6 A;  4F9A B;  4JI4 E;  4Q35 B;  2E72 A;  2EOH A;  2VRD A;  1ZBQ A;  2EPO A;  1RC7 A;  2JY9 A;  5A2Q C;  1HNX E;  3OML A;  2EL5 A;  3AV0 A;  1SFE A;  4NXN E;  4FK5 C;  4IS1 C;  4HTG A;  1RQ0 A;  2EOQ A;  2EM2 A;  4F9B B;  4LF4 E;  2LBS B;  2N3H A;  2LUP B;  3THO B;  2EL6 A;  2EMX A;  4YY3 E;  4BCA A;  1WHQ A;  4X62 E;  2NUE A;  2EQ3 A;  2Q8U A;  3LML A;  2M7Q A;  4WPY A;  2WBT A;  2ADR A;  2LCE A;  4JYA E;  4O24 A;  1TF3 A;  2EOM A;  2M4I A;  2ENC A;  4X8W A;  2YU5 A;  4LF9 E;  4NXM E;  2ODR D;  4MLQ A;  3RMP A;  4BBY A;  5KL6 A;  2LRS A;  2EPN A;  1T4O A;  2V86 A;  2EMF A;  2LTR A;  2V85 A;  4WSP A;  1X3C A;  2F4V E;  2EM9 A;  2K4V A;  2CPN A;  2YTF A;  1WXR A;  3OTO E;  1QU6 A;  3KZY A;  4HEI A;  2YSO A;  2A25 A;  2EN4 A;  2NUF A;  3JTZ A;  2EL4 A;  1A1F A;  1IBM E;  5AE3 A;  2EOI A;  3QG5 C;  3C6M A;  1HNZ E;  3HPZ A;  2R76 A;  5LLQ A;  4F6N A;  4DR6 E;  2VE7 C;  4BHB A;  1DGC A;  2LVH A;  4LF8 E;  2EOE A;  4M9V C;  4DV2 E;  2YRK A;  2DB2 A;  2VF1 A;  2GPI A;  1HR0 E;  1YUJ A;  2B7T A;  4M30 A;  2LTS A;  1GZ6 A;  4B3T E;  2EWL A;  2ODR C;  2EMW A;  2EOS A;  1TN9 A;  2H36 X;  3T1Y E;  5LL6 R;  4BHC A;  4R2R A;  3EQ1 A;  5DNY A;  2YT4 A;  1GTK A;  2EPX A;  3HQ1 A;  4O43 A;  2N8X A;  1I94 E;  4N4R B;  2EPP A;  2EP3 A;  2B9D A;  2YRH A;  2CT1 A;  1L4S A;  4R03 A;  1X48 A;  2JP9 A;  4O5G A;  1WRJ A;  5T6J A;  2EOR A;  2HC5 A;  1NCS A;  2KHX A;  2J7J A;  2VQF E;  2WBU A;  3ADL A;  2EPU A;  4DMI A;  1FKA E;  2DLK A;  1MEY C;  1IMU A;  2DLQ A;  2EN2 A;  5IWA E;  2MKD A;  2GLI A;  1A1G A;  5IT9 C;  4WXD A;  1X49 A;  1P47 A;  4DR1 E;  4DV0 E;  3ADG A;  3BF2 A;  1PJS A;  2YTO A;  5KL3 A;  5AAS A;  4GZN C;  5LMU E;  4LFB E;  4BC7 A;  3AUZ A;  2YWQ A;  2DIX A;  3M99 B;  4DV1 E;  2YTJ A;  3TQM A;  2MDR A;  4DR4 E;  2EPL X;  4X9J A;  2ELZ A;  2K7I A;  4B3R E;  4X66 E;  2NUG A;  4R2D A;  5LMN E;  3VYX A;  4K0K E;  2EM0 A;  4JV5 E;  4WXC A;  1X6F A;  3HTX A;  2YRM A;  4I8O A;  4ZYH A;  2EQ1 A;  2YTE A;  2YTG A;  1N32 E;  2FGG A;  1G2F C;  2DMI A;  2YTN A;  4GKK E;  3ZOQ B;  1A1L A;  4DV7 E;  2HJJ A;  1XNQ E;  2E1M A;  3ECR A;  2EMH A;  2EPZ A;  2EPM X;  3JU0 A;  2JPA A;  2B7V A;  2DRP A;  2EN7 A;  2LO3 A;  3C4B A;  4JI2 E;  4LU9 A;  2CTD A;  2DSY A;  1A1H A;  3EPJ A;  4R2P A;  4LF6 E;  1YYW A;  1YUI A;  5FLX C;  1KJK A;  2EN1 A;  1SR9 A;  2EMZ A;  5KL7 A;  4L8N A;  3HXL A;  2EQ0 A;  2EMY A;  3UK3 C;  4X64 E;  2G7H A;  3J80 C;  2WCC 3;  2LJH A;  4BS9 A;  2R1F A;  4BC9 A;  2ZM6 E;  1IQO A;  4RH8 A;  1NEI A;  2EM4 A;  2N3G A;  3BID A;  2EMK A;  3KWR A;  3IWC A;  3VK6 A;  1X6H A;  1YZ9 A;  2RSM A;  4P7D A;  3J7Y p;  1IBK E;  4R2Q A;  4KHP E;  4DV5 E;  1J26 A;  4R8O A;  1ZAA C;  1BBG A;  1PKP A;  1EH7 A;  2UXC E;  1WHN A;  2LUQ A;  2YU8 A;  1YPN A;  4JI8 E;  2EM6 A;  2WZO A;  1N34 E;  4DKK A;  2LE2 A;  4KWY A;  2EJ4 A;  1BBO A;  1O0W A;  3EPL A;  2V83 A;  2RTX A;  1FJG E;  4OOG C;  4J8Z A;  2YTD A;  2EN8 A;  2EPK X;  2RQL A;  5F3W A;  2YTQ A;  5BR8 E;  2EOX A;  4OX9 E;  2EPR A;  2RS7 A;  4JI5 E;  4F54 A;  1T39 A;  1IBL E;  2L8T A;  1KYQ A;  1UN6 B;  2F8B A;  4DUY E;  3P1X A;  2EM3 A;  4ZYG A;  1PDA A;  1AH5 A;  1XMO E;  4LTY A;  2E5L E;  2UUB E;  2YZT A;  5IXM B;  1J5E E;  3C4T A;  2WBS A;  2IHR 1;  4JI0 E;  2V88 A;  4WYQ B;  3T1H E;  4IJD A;  4MLV A;  1RMD A;  3J7A G;  4DR5 E;  1N33 E;  3BBG A;  2UUA E;  4P78 A;  2NA2 A;  1YFH A;  2LJU A;  2JYA A;  1YSA C;  2M1S A;  4O4K A;  1ZU1 A;  4NHR A;  1HNW E;  2BB8 A;  1GQE A;  3VYY A;  1TF6 A;  2LMZ A;  1T4N A;  2EOY A;  4LF7 E;  1ZR9 A;  2D9H A;  3F6H A;  2JXP A;  2V87 A;  3MHS C;  5ADZ A;  3LLH A;  2KOU A;  1DQ3 A;  2EOZ A;  4R2C A;  2I13 A;  2L3J A;  3ADI A;  1X47 A;  1UBD C;  1BB8 A;  2RS6 A;  2L92 A;  4JI3 E;  4DV3 E;  4B3S E;  2YTP A;  2HHH E;  2FV4 B;  1YYK A;  2KON A;  2RSI A;  2YPN A;  1MGT A;  4DR3 E;  4JI7 E;  4R2S A;  2MDG A;  1A1K A;  2CSH A;  3MHH C;  2L2M A;  1EH6 A;  2NAB A;  4LFC E;  4RHB B;  1DI2 A;  4LF5 E;  1YYO A;  2V89 A;  2EPC A;  2UUC E;  3KZZ A;  2LV2 A;  3BGH A;  5KL4 A;  3IWB A;  4DR2 E;  2V8Q B;  2EN3 A;  2RPC A;  4B3M E;  2JVA A;  4ZYE A;  1XNR E;  4TUI A;  1A1J A;  2JOB A;  5KL2 A;  4YHH E;  5IV8 B;  5KL5 A;  3EPH A;  2ELY A;  2I9I A;  2YTI A;  4DV4 E;  2JOX A;  1N3G A;  2EE8 A;  2EOO A;  2L6M A;  2L2K B;  4JI6 E;  1T4L B;  5A6A A;  3H09 A;  4X65 E;  1QNT A;  2EMI A;  4R2E A;  2LT7 A;  5A6J A;  5A6B D;  2EMA A;  2EMC A;  1ZBT A;  3EPK A;  4DV6 E;  2L3C A;  2HGH A; 
#chains in the Genus database with same CATH homology
 2E5L E;  2MDR A;  3LML A;  4KZS A;  4DR4 E;  2UUB E;  2YZT A;  2M7Q A;  4B3R E;  1J5E E;  2DMY A;  3C4T A;  4X66 E;  2NUG A;  4WPY A;  2IHR 1;  3DJW A;  4JI0 E;  4JYA E;  5LMN E;  2V88 A;  4TUG A;  3VYX A;  2L33 A;  4WYQ B;  4K0K E;  3T1H E;  1XMQ E;  4JV5 E;  2VQE E;  2M4I A;  3J7A G;  3IWD A;  4M0V A;  4X8W A;  3HTX A;  4DR5 E;  4LF9 E;  1N33 E;  2UUA E;  2JR1 A;  4P78 A;  4M2Z A;  4NXM E;  2NA2 A;  2ODR D;  4I8O A;  3RMP A;  4BBY A;  2LRS A;  2FTX B;  1T4O A;  2M1S A;  2V86 A;  3MSW A;  1N32 E;  2FGG A;  2LTR A;  2V85 A;  4Q28 A;  4WSP A;  3J81 C;  1HNW E;  1GQE A;  2F4V E;  4GKK E;  3ZOQ B;  2K4V A;  2CPN A;  1WXR A;  3OTO E;  3VYY A;  4DV7 E;  1QU6 A;  2LMZ A;  1T4N A;  1XNQ E;  4LF7 E;  2JWO A;  2UXD E;  2NUF A;  2E1M A;  3JTZ A;  3F6H A;  4LFA E;  1IBM E;  3JU0 A;  5AE3 A;  3JAM C;  1EKZ A;  2B7V A;  2V87 A;  3C4B A;  5ADZ A;  4JI2 E;  3LLH A;  2KOU A;  1DQ3 A;  4LU9 A;  1HNZ E;  3FIG A;  3HPZ A;  2DSY A;  2L3J A;  3ADI A;  1X47 A;  4DR6 E;  2VE7 C;  1N36 E;  4LF6 E;  3ADJ A;  4BMJ A;  4LF8 E;  1YYW A;  5FLX C;  4F9C B;  5AE1 A;  2RS6 A;  2MC6 A;  4DV2 E;  2L92 A;  1XMO E;  1SR9 A;  2VF1 A;  2DB2 A;  2UU9 E;  1HR0 E;  4JI3 E;  2B7T A;  4M30 A;  4DV3 E;  2LTS A;  4GEQ B;  4L8N A;  1GZ6 A;  3HXL A;  4B3S E;  2HHH E;  2FV4 B;  1YYK A;  4B3T E;  2KON A;  2EWL A;  1UIL A;  2ODR C;  4X64 E;  2G7H A;  3J80 C;  4DR3 E;  3DF6 A;  4JI7 E;  1STU A;  2MC5 A;  2LJH A;  2H36 X;  4BS9 A;  3T1Y E;  5LL6 R;  3K6Q A;  2L2M A;  4BC9 A;  5DNY A;  2ZM6 E;  5CFF E;  2B3T B;  2YT4 A;  4AQY E;  4LFC E;  3HQ1 A;  1UHZ A;  2L2N A;  1DI2 A;  4LF5 E;  4GKJ E;  2N3G A;  1YYO A;  2V89 A;  1I94 E;  2B9D A;  3KWR A;  5AE2 A;  2UUC E;  3IWC A;  3VK6 A;  1YZ9 A;  3IWB A;  2RSM A;  4P7D A;  2V8Q B;  3J7Y p;  4DR2 E;  1IBK E;  4DUZ E;  3HPS A;  1X48 A;  4L5N C;  4R03 A;  4JI1 E;  4KHP E;  4DV5 E;  4B3M E;  4DR7 E;  2UXB E;  4R8O A;  4WFT A;  3F6G A;  1J26 A;  2JVA A;  1PKP A;  1XNR E;  4F9A B;  5T6J A;  4TUI A;  2JOB A;  4JI4 E;  2EZ6 A;  4YHH E;  1WHN A;  2UXC E;  2KHX A;  2LUQ A;  4JI8 E;  2VQF E;  3ADL A;  4DMI A;  2WZO A;  1FKA E;  1N34 E;  1ZBQ A;  4DKK A;  2LE2 A;  1RC7 A;  2JY9 A;  5A2Q C;  1O0W A;  1HNX E;  3OML A;  3AV0 A;  2V83 A;  2RTX A;  1FJG E;  4NXN E;  5IWA E;  4DV4 E;  5IT9 C;  4OOG C;  1X49 A;  4J8Z A;  1RQ0 A;  4F9B B;  2JOX A;  2L6M A;  2L2K B;  4DR1 E;  5F3W A;  5BR8 E;  4DV0 E;  4JI6 E;  4LF4 E;  3ADG A;  4OX9 E;  1T4L B;  2RS7 A;  3H09 A;  2LBS B;  4F54 A;  4JI5 E;  4X65 E;  2N3H A;  2LUP B;  2L8T A;  1IBL E;  5AAS A;  2F8B A;  5LMU E;  4DUY E;  4LFB E;  3P1X A;  4YY3 E;  4BCA A;  1WHQ A;  4BC7 A;  1ZBT A;  3AUZ A;  4X62 E;  2DIX A;  4DV1 E;  4DV6 E;  2NUE A;  2L3C A;  4LTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...