2YTFA

Solution structure of the c2h2 type zinc finger (region 607-639) of human zinc finger protein 268
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
b'GSSGSSGTGEKPFECSECQKAFNTKSNLIVHQRTHTGEKPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 268
publication title Solution structure of the C2H2 type zinc finger (region 607-639) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ytfA01
4R2CA 1WJPA 5KL3A 2YRKA 2EN4A 2EPXA 2CTDA 4WSGA 2EN2A 2I13A 1X6FA 3EPHA 2YTJA 2YTPA 2EM2A 2YSPA 5KL7A 2ENAA 2EN6A 1RMDA 2EPAA 2GHFA 2D9HA 2EPZA 3EPJA 2A25A 2ADRA 1F2IG 2EM8A 2YTDA 1G2DC 3UK3C 2RPCA 2JPAA 1X6HA 4R2RA 5KL6A 1TF3A 1TF6A 1JK2A 2DLQA 1P47A 1YUIA 2EP3A 2BB8A 2ENCA 2EN3A 2EL4A 4IJDA 2EM7A 2EQ0A 2J7JA 2YRMA 1BBOA 2YSOA 2EL5A 2WCC3 2EOJA 2HGHA 2YTGA 2EOYA 4R2EA 2EMXA 2EJ4A 2YTEA 2MKDA 2ELYA 1TN9A 2EM9A 4R2SA 2LO3A 2EOOA 1NCSA 2ENHA 2EM3A 2EOXA 1A1HA 2EPRA 2WBTA 2EOIA 2E72A 2YRHA 2M9AA 2YTFA 1Z1BA 4R2DA 2EPCA 2EOHA 2EPUA 3EPKA 2CT1A 3VHTB 2EM5A 2MDGA 1G2FC 2EMHA 2PRTA 2EOZA 2EQ1A 1JK1A 1MEYC 1X5WA 1DGCA 1X6EA 5KL2A 1UBDC 1ZU1A 2VRDA 2DLKA 1LLMC 2EOFA 2EN8A 5KL4A 1YSAC 4R2PA 2LV2A 1ZR9A 2EMCA 1X3CA 2EE8A 2YU5A 2YTOA 4GZNC 2YTNA 2ELZA 2EMKA 1A1JA 2DMIA 1A1GA 2EOEA 2EMBA 2EQ3A 2RSIA 1AAYA 1A1LA 2EOSA 2R1FA 2EM0A 2NABA 2YTIA 2DRPA 2MKNA 2WBUA 1YUJA 4IS1C 1A1KA 2EMWA 4FK5C 2EM6A 1UN6B 2EMFA 2EOQA 4F2JC 1KJKA 2EMAA 1BB8A 2YTQA 3MHSC 1ZAAC 2EM4A 4F6MA 2LVHA 1A1IA 2CSHA 3M99B 2LCEA 2EMGA 3EPLA 2EMZA 2EMIA 5KL5A 4R2AA 4F6NA 4M9VC 2WBSA 2EMLA 4R2QA 1B69A 2EN7A 2EOMA 1A1FA 2DGCA 2GLIA 2EORA 3MHHC 2EN1A 2JP9A 2EL6A 2EPPA 2LT7A 4X9JA 2EMYA 2YU8A
chains in the Genus database with same CATH superfamily
3KZZA 4DUZE 3HPSA 2V89A 2EN4A 5A6JA 2N3GA 2YTPA 2YSPA 2HHHE 5KL7A 4X65E 2D9HA 2EPZA 1QU6A 2ADRA 2YTDA 1G2DC 2KONA 1RC7A 2JPAA 2K7IA 2DSYA 3IWDA 3VYYA 3ADIA 2EP3A 1XMQE 2EN3A 2EPOA 1YZ9A 1DQ3A 4DV2E 4WSPA 4DR5E 1EH8A 3J80C 4DMIA 4GKKE 1BBOA 2YSOA 4KHPE 2EL5A 2EOYA 2NA2A 2B7TA 1PDAA 1MGTA 2B9DA 2L8TA 3C6KA 4R2SA 2LBSB 2UXCE 2LUPB 2FV4B 2RS7A 1N3GA 2DIXA 1A1HA 1EH7A 2EPNA 4HTGA 2YRHA 2YTFA 4P7DA 4R2DA 2KOUA 2EPCA 4L5NC 2CT1A 4LFBE 2LE2A 1EKZA 2PRTA 2HC5A 2L3CA 3THOB 1MEYC 4KWYA 2UUBE 4JI1E 1UBDC 1UILA 1LLMC 2VE7C 4MLQA 1HNZE 1YSAC 1ZBTA 1N32E 4L8NA 1YPNA 2YTOA 4DKKA 3KZYA 2DMIA 1T4NA 5ADZA 3BF2A 2V88A 1A1LA 2E5LE 2LJUA 3DJWA 2EOSA 2R1FA 2EM0A 4DV1E 3BIDA 2DRPA 4B3SE 1PKPA 2EMWA 1UN6B 3ADGA 2JXPA 1BB8A 2N3HA 4NZVA 4X8WA 3C4TA 4JI2E 4LF7E 1A1IA 4DR3E 1X47A 3TQMA 4O24A 2NUGA 4BHCA 1T39A 2EMZA 1HNXE 4F6NA 5KL5A 4R2QA 4ZYDA 2DGCA 3OMLA 2H36X 2B3TB 1XMOE 2NUFA 3MHHC 2JP9A 2EPKX 2EL6A 4DV4E 2YWQA 4DV5E 5DNYA 3ECRA 4K0KE 3THNA 2YU8A 4TUIA 4R2CA 2LUQA 4WXDA 5KL3A 3H09A 4BS9A 4B3RE 2I13A 3L00A 2FGGA 3EPHA 5LMUE 2YTJA 2EM2A 3J7Yp 2A25A 3UK3C 5A6BD 2RPCA 3BBGA 2DLQA 2YZTA 5AC4A 4IJDA 2EM7A 4BC7A 5IV8B 5LLQA 3P1XA 2EQ0A 4I8OA 2J7JA 1EH6A 5FLXC 4WXCA 5AC5A 4YY3E 1UHZA 1T4LB 2HGHA 2JOXA 5TSEA 2DMYA 4WYQB 4LF4E 2EMXA 2EJ4A 2MKDA 4WPYA 4B3TE 2LJHA 3ZOQB 3J7AG 2M7QA 1WXRA 1WHQA 4BMJA 4N4RB 4NXNE 3VHTB 2MDGA 1T38A 2R76A 3ADJA 2EOZA 2V83A 3ADLA 1X5WA 1X6EA 1ZU1A 2N8XA 2L2KB 2E1MA 4O43A 3HQ1A 4X62E 2LV2A 1ZR9A 2YU5A 2I9IA 1A1JA 4BHBA 3F6GA 2MC6A 4O4KA 4BCAA 4B3ME 2RQLA 3OTOE 1IMUA 4ZYEA 1IBLE 5F3WA 4JI3E 2MKNA 2WBUA 1YUJA 4IS1C 1A1KA 4FK5C 2EOQA 4F2JC 4DR7E 2LTSA 2EMAA 1ZAAC 2K4VA 5A6BA 4JI4E 4YHHE 3M99B 2LCEA 4NXME 2F8BA 4KZSA 4Q35B 1A1FA 3LLHA 1STUA 2RS6A 4F9CB 2EORA 1NEIA 5AE1A 4DV0E 2LT7A 3IWCA 2ZM6E 5AE2A 4DV6E 2ODRC 3QG5C 4M2ZA 1WJPA 1IBKE 4F54A 2YRKA 2EPXA 2EN2A 1X6FA 3EPLA 2GHFA 3EPJA 1F2IG 2V85A 2EM8A 1XNRE 4J8ZA 3AUZA 2L6MA 1YYWA 4R2RA 2UXDE 2JR1A 1P47A 1YUIA 2RTXA 4DV7E 2ENCA 2EL4A 1N33E 1RQ0A 2L33A 4X66E 1HR0E 2KHXA 2YRMA 2LTRA 4O5GA 4TUGA 5IWAE 2YTGA 1N36E 4WFTA 4ZYGA 1XNQE 4DR4E 4M30A 1YYKA 1PJSA 5IT9C 4GKJE 1O0WA 1GQEA 1GTKA 2EM9A 1TN9A 3JTZA 3HXLA 5A69A 2ENHA 4JI7E 2VF1A 2WBTA 4RH8A 3DF6A 2MDRA 1L4SA 4HEIA 2EOHA 4NHRA 3J81C 2EM5A 3KWRA 1G2FC 3FIGA 1X49A 2G7HA 2F4VE 5KL2A 2VQFE 2VRDA 3IWBA 5KL4A 4P78A 2JWOA 2BBGA 4DUYE 4R2PA 1PJQA 2V86A 4BC9A 2EMCA 1X3CA 5AE3A 2UU9E 4LU9A 4JI6E 2V87A 4DR2E 2IHR1 1YYOA 3MSWA 4GZNC 1WHNA 3EQ1A 4LF8E 4DR1E 2EPLX 2L2NA 2LRSA 2RSIA 5LL6R 5T6JA 1AAYA 2JVAA 3K6QA 4R03A 4DR6E 2B7VA 3HTXA 3T1HE 1FJGE 3JU0A 2EM6A 5A6AA 3F6HA 2YTQA 2EM4A 2LVHA 4JI8E 3C4BA 2CSHA 2V8QB 3LMLA 2DB2A 2EMIA 4M9VC 2EZ6A 4F9BB 2EMLA 1B69A 2EOMA 2Q8UA 2EPPA 1FKAE 4LFCE 4X9JA 1J5EE 1QNTA 4JI5E 3BGHA 2L92A 2CTDA 4WSGA 2YPNA 2JOBA 2ENAA 2EN6A 1RMDA 2EPAA 4LTYA 1WRJA 2WZOA 1X6HA 4F9AB 5KL6A 1TF3A 1TF6A 4ZYHA 1JK2A 5A2QC 5AASA 1BBGA 2LMZA 5CFFE 2BB8A 4JV5E 3T1YE 1DI2A 1IQOA 4OOGC 1N34E 3VK6A 2JYAA 2YT4A 2MC5A 4LF5E 2WCC3 4JYAE 2EOJA 4MLVA 5LMNE 5BR8E 1SFEA 4R2EA 2YTEA 2ELYA 2L3JA 1HNWE 2GPIA 3C6MA 2LO3A 2EOOA 1NCSA 2L2MA 4R8OA 3HPZA 2EWLA 2EM3A 1J26A 2EOXA 2VQEE 2EPRA 2M4IA 2EOIA 2E72A 3VYXA 4LFAE 2M9AA 1Z1BA 2EPUA 2CPNA 3EPKA 4GEQB 2EMHA 4LF6E 2EQ1A 1GZ6A 1JK1A 1DGCA 4RHBB 4BBYA 4JI0E 2DLKA 1IBME 2EOFA 5A6KA 2EN8A 1I94E 1PJTA 2ODRD 2RSMA 4OX9E 4DV3E 2EE8A 2HJJA 2FTXB 2YTNA 2ELZA 2EMKA 4M0VA 1A1GA 2EOEA 2EMBA 2EQ3A 1SR9A 2UXBE 2NUEA 2NABA 2YTIA 4WX9A 1X48A 2EPMX 2EMFA 1YFHA 1KJKA 1AH5A 3MHSC 1IQSA 3RMPA 1T4OA 4F6MA 2UUCE 2JY9A 4X64E 2EMGA 3JAMC 4R2AA 2WBSA 2UUAE 1ZBQA 2EN7A 2GLIA 4LF9E 2EN1A 2M1SA 1KYQA 4Q28A 2EMYA 5IXMB 4AQYE 3AV0A
chains in the Genus database with same CATH topology
4R2CA 1WJPA 5KL3A 2YRKA 2EN4A 2EPXA 2CTDA 4WSGA 2EN2A 2I13A 1X6FA 3EPHA 2YTJA 2YTPA 2EM2A 2YSPA 5KL7A 2ENAA 2EN6A 1RMDA 2EPAA 2GHFA 2D9HA 2EPZA 3EPJA 2A25A 2ADRA 1F2IG 2EM8A 2YTDA 1G2DC 3UK3C 2RPCA 2JPAA 1X6HA 4R2RA 5KL6A 1TF3A 1TF6A 1JK2A 2DLQA 1P47A 1YUIA 2EP3A 2BB8A 2ENCA 2EN3A 2EL4A 4IJDA 2EM7A 2EQ0A 2J7JA 2YRMA 1BBOA 2YSOA 2EL5A 2WCC3 2EOJA 2HGHA 2YTGA 2EOYA 4R2EA 2EMXA 2EJ4A 2YTEA 2MKDA 2ELYA 1TN9A 2EM9A 4R2SA 2LO3A 2EOOA 1NCSA 2ENHA 2EM3A 2EOXA 1A1HA 2EPRA 2WBTA 2EOIA 2E72A 2YRHA 2M9AA 2YTFA 1Z1BA 4R2DA 2EPCA 2EOHA 2EPUA 3EPKA 2CT1A 3VHTB 2EM5A 2MDGA 1G2FC 2EMHA 2PRTA 2EOZA 2EQ1A 1JK1A 1MEYC 1X5WA 1DGCA 1X6EA 5KL2A 1UBDC 1ZU1A 2VRDA 2DLKA 1LLMC 2EOFA 2EN8A 5KL4A 1YSAC 4R2PA 2LV2A 1ZR9A 2EMCA 1X3CA 2EE8A 2YU5A 2YTOA 4GZNC 2YTNA 2ELZA 2EMKA 1A1JA 2DMIA 1A1GA 2EOEA 2EMBA 2EQ3A 2RSIA 1AAYA 1A1LA 2EOSA 2R1FA 2EM0A 2NABA 2YTIA 2DRPA 2MKNA 2WBUA 1YUJA 4IS1C 1A1KA 2EMWA 4FK5C 2EM6A 1UN6B 2EMFA 2EOQA 4F2JC 1KJKA 2EMAA 1BB8A 2YTQA 3MHSC 1ZAAC 2EM4A 4F6MA 2LVHA 1A1IA 2CSHA 3M99B 2LCEA 2EMGA 3EPLA 2EMZA 2EMIA 5KL5A 4R2AA 4F6NA 4M9VC 2WBSA 2EMLA 4R2QA 1B69A 2EN7A 2EOMA 1A1FA 2DGCA 2GLIA 2EORA 3MHHC 2EN1A 2JP9A 2EL6A 2EPPA 2LT7A 4X9JA 2EMYA 2YU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R2C A;  1WJP A;  5KL3 A;  2YRK A;  2EN4 A;  2EPX A;  2CTD A;  4WSG A;  2EN2 A;  2I13 A;  1X6F A;  3EPH A;  2YTJ A;  2YTP A;  2EM2 A;  2YSP A;  5KL7 A;  2ENA A;  2EN6 A;  1RMD A;  2EPA A;  2GHF A;  2D9H A;  2EPZ A;  3EPJ A;  2A25 A;  2ADR A;  1F2I G;  2EM8 A;  2YTD A;  1G2D C;  3UK3 C;  2RPC A;  2JPA A;  1X6H A;  4R2R A;  5KL6 A;  1TF3 A;  1TF6 A;  1JK2 A;  2DLQ A;  1P47 A;  1YUI A;  2EP3 A;  2BB8 A;  2ENC A;  2EN3 A;  2EL4 A;  4IJD A;  2EM7 A;  2EQ0 A;  2J7J A;  2YRM A;  1BBO A;  2YSO A;  2EL5 A;  2WCC 3;  2EOJ A;  2HGH A;  2YTG A;  2EOY A;  4R2E A;  2EMX A;  2EJ4 A;  2YTE A;  2MKD A;  2ELY A;  1TN9 A;  2EM9 A;  4R2S A;  2LO3 A;  2EOO A;  1NCS A;  2ENH A;  2EM3 A;  2EOX A;  1A1H A;  2EPR A;  2WBT A;  2EOI A;  2E72 A;  2YRH A;  2M9A A;  2YTF A;  1Z1B A;  4R2D A;  2EPC A;  2EOH A;  2EPU A;  3EPK A;  2CT1 A;  3VHT B;  2EM5 A;  2MDG A;  1G2F C;  2EMH A;  2PRT A;  2EOZ A;  2EQ1 A;  1JK1 A;  1MEY C;  1X5W A;  1DGC A;  1X6E A;  5KL2 A;  1UBD C;  1ZU1 A;  2VRD A;  2DLK A;  1LLM C;  2EOF A;  2EN8 A;  5KL4 A;  1YSA C;  4R2P A;  2LV2 A;  1ZR9 A;  2EMC A;  1X3C A;  2EE8 A;  2YU5 A;  2YTO A;  4GZN C;  2YTN A;  2ELZ A;  2EMK A;  1A1J A;  2DMI A;  1A1G A;  2EOE A;  2EMB A;  2EQ3 A;  2RSI A;  1AAY A;  1A1L A;  2EOS A;  2R1F A;  2EM0 A;  2NAB A;  2YTI A;  2DRP A;  2MKN A;  2WBU A;  1YUJ A;  4IS1 C;  1A1K A;  2EMW A;  4FK5 C;  2EM6 A;  1UN6 B;  2EMF A;  2EOQ A;  4F2J C;  1KJK A;  2EMA A;  1BB8 A;  2YTQ A;  3MHS C;  1ZAA C;  2EM4 A;  4F6M A;  2LVH A;  1A1I A;  2CSH A;  3M99 B;  2LCE A;  2EMG A;  3EPL A;  2EMZ A;  2EMI A;  5KL5 A;  4R2A A;  4F6N A;  4M9V C;  2WBS A;  2EML A;  4R2Q A;  1B69 A;  2EN7 A;  2EOM A;  1A1F A;  2DGC A;  2GLI A;  2EOR A;  3MHH C;  2EN1 A;  2JP9 A;  2EL6 A;  2EPP A;  2LT7 A;  4X9J A;  2EMY A;  2YU8 A; 
#chains in the Genus database with same CATH topology
 3KZZ A;  4DUZ E;  3HPS A;  2V89 A;  2EN4 A;  5A6J A;  2N3G A;  2YTP A;  2YSP A;  2HHH E;  5KL7 A;  4X65 E;  2D9H A;  2EPZ A;  1QU6 A;  2ADR A;  2YTD A;  1G2D C;  2KON A;  1RC7 A;  2JPA A;  2K7I A;  2DSY A;  3IWD A;  3VYY A;  3ADI A;  2EP3 A;  1XMQ E;  2EN3 A;  2EPO A;  1YZ9 A;  1DQ3 A;  4DV2 E;  4WSP A;  4DR5 E;  1EH8 A;  3J80 C;  4DMI A;  4GKK E;  1BBO A;  2YSO A;  4KHP E;  2EL5 A;  2EOY A;  2NA2 A;  2B7T A;  1PDA A;  1MGT A;  2B9D A;  2L8T A;  3C6K A;  4R2S A;  2LBS B;  2UXC E;  2LUP B;  2FV4 B;  2RS7 A;  1N3G A;  2DIX A;  1A1H A;  1EH7 A;  2EPN A;  4HTG A;  2YRH A;  2YTF A;  4P7D A;  4R2D A;  2KOU A;  2EPC A;  4L5N C;  2CT1 A;  4LFB E;  2LE2 A;  1EKZ A;  2PRT A;  2HC5 A;  2L3C A;  3THO B;  1MEY C;  4KWY A;  2UUB E;  4JI1 E;  1UBD C;  1UIL A;  1LLM C;  2VE7 C;  4MLQ A;  1HNZ E;  1YSA C;  1ZBT A;  1N32 E;  4L8N A;  1YPN A;  2YTO A;  4DKK A;  3KZY A;  2DMI A;  1T4N A;  5ADZ A;  3BF2 A;  2V88 A;  1A1L A;  2E5L E;  2LJU A;  3DJW A;  2EOS A;  2R1F A;  2EM0 A;  4DV1 E;  3BID A;  2DRP A;  4B3S E;  1PKP A;  2EMW A;  1UN6 B;  3ADG A;  2JXP A;  1BB8 A;  2N3H A;  4NZV A;  4X8W A;  3C4T A;  4JI2 E;  4LF7 E;  1A1I A;  4DR3 E;  1X47 A;  3TQM A;  4O24 A;  2NUG A;  4BHC A;  1T39 A;  2EMZ A;  1HNX E;  4F6N A;  5KL5 A;  4R2Q A;  4ZYD A;  2DGC A;  3OML A;  2H36 X;  2B3T B;  1XMO E;  2NUF A;  3MHH C;  2JP9 A;  2EPK X;  2EL6 A;  4DV4 E;  2YWQ A;  4DV5 E;  5DNY A;  3ECR A;  4K0K E;  3THN A;  2YU8 A;  4TUI A;  4R2C A;  2LUQ A;  4WXD A;  5KL3 A;  3H09 A;  4BS9 A;  4B3R E;  2I13 A;  3L00 A;  2FGG A;  3EPH A;  5LMU E;  2YTJ A;  2EM2 A;  3J7Y p;  2A25 A;  3UK3 C;  5A6B D;  2RPC A;  3BBG A;  2DLQ A;  2YZT A;  5AC4 A;  4IJD A;  2EM7 A;  4BC7 A;  5IV8 B;  5LLQ A;  3P1X A;  2EQ0 A;  4I8O A;  2J7J A;  1EH6 A;  5FLX C;  4WXC A;  5AC5 A;  4YY3 E;  1UHZ A;  1T4L B;  2HGH A;  2JOX A;  5TSE A;  2DMY A;  4WYQ B;  4LF4 E;  2EMX A;  2EJ4 A;  2MKD A;  4WPY A;  4B3T E;  2LJH A;  3ZOQ B;  3J7A G;  2M7Q A;  1WXR A;  1WHQ A;  4BMJ A;  4N4R B;  4NXN E;  3VHT B;  2MDG A;  1T38 A;  2R76 A;  3ADJ A;  2EOZ A;  2V83 A;  3ADL A;  1X5W A;  1X6E A;  1ZU1 A;  2N8X A;  2L2K B;  2E1M A;  4O43 A;  3HQ1 A;  4X62 E;  2LV2 A;  1ZR9 A;  2YU5 A;  2I9I A;  1A1J A;  4BHB A;  3F6G A;  2MC6 A;  4O4K A;  4BCA A;  4B3M E;  2RQL A;  3OTO E;  1IMU A;  4ZYE A;  1IBL E;  5F3W A;  4JI3 E;  2MKN A;  2WBU A;  1YUJ A;  4IS1 C;  1A1K A;  4FK5 C;  2EOQ A;  4F2J C;  4DR7 E;  2LTS A;  2EMA A;  1ZAA C;  2K4V A;  5A6B A;  4JI4 E;  4YHH E;  3M99 B;  2LCE A;  4NXM E;  2F8B A;  4KZS A;  4Q35 B;  1A1F A;  3LLH A;  1STU A;  2RS6 A;  4F9C B;  2EOR A;  1NEI A;  5AE1 A;  4DV0 E;  2LT7 A;  3IWC A;  2ZM6 E;  5AE2 A;  4DV6 E;  2ODR C;  3QG5 C;  4M2Z A;  1WJP A;  1IBK E;  4F54 A;  2YRK A;  2EPX A;  2EN2 A;  1X6F A;  3EPL A;  2GHF A;  3EPJ A;  1F2I G;  2V85 A;  2EM8 A;  1XNR E;  4J8Z A;  3AUZ A;  2L6M A;  1YYW A;  4R2R A;  2UXD E;  2JR1 A;  1P47 A;  1YUI A;  2RTX A;  4DV7 E;  2ENC A;  2EL4 A;  1N33 E;  1RQ0 A;  2L33 A;  4X66 E;  1HR0 E;  2KHX A;  2YRM A;  2LTR A;  4O5G A;  4TUG A;  5IWA E;  2YTG A;  1N36 E;  4WFT A;  4ZYG A;  1XNQ E;  4DR4 E;  4M30 A;  1YYK A;  1PJS A;  5IT9 C;  4GKJ E;  1O0W A;  1GQE A;  1GTK A;  2EM9 A;  1TN9 A;  3JTZ A;  3HXL A;  5A69 A;  2ENH A;  4JI7 E;  2VF1 A;  2WBT A;  4RH8 A;  3DF6 A;  2MDR A;  1L4S A;  4HEI A;  2EOH A;  4NHR A;  3J81 C;  2EM5 A;  3KWR A;  1G2F C;  3FIG A;  1X49 A;  2G7H A;  2F4V E;  5KL2 A;  2VQF E;  2VRD A;  3IWB A;  5KL4 A;  4P78 A;  2JWO A;  2BBG A;  4DUY E;  4R2P A;  1PJQ A;  2V86 A;  4BC9 A;  2EMC A;  1X3C A;  5AE3 A;  2UU9 E;  4LU9 A;  4JI6 E;  2V87 A;  4DR2 E;  2IHR 1;  1YYO A;  3MSW A;  4GZN C;  1WHN A;  3EQ1 A;  4LF8 E;  4DR1 E;  2EPL X;  2L2N A;  2LRS A;  2RSI A;  5LL6 R;  5T6J A;  1AAY A;  2JVA A;  3K6Q A;  4R03 A;  4DR6 E;  2B7V A;  3HTX A;  3T1H E;  1FJG E;  3JU0 A;  2EM6 A;  5A6A A;  3F6H A;  2YTQ A;  2EM4 A;  2LVH A;  4JI8 E;  3C4B A;  2CSH A;  2V8Q B;  3LML A;  2DB2 A;  2EMI A;  4M9V C;  2EZ6 A;  4F9B B;  2EML A;  1B69 A;  2EOM A;  2Q8U A;  2EPP A;  1FKA E;  4LFC E;  4X9J A;  1J5E E;  1QNT A;  4JI5 E;  3BGH A;  2L92 A;  2CTD A;  4WSG A;  2YPN A;  2JOB A;  2ENA A;  2EN6 A;  1RMD A;  2EPA A;  4LTY A;  1WRJ A;  2WZO A;  1X6H A;  4F9A B;  5KL6 A;  1TF3 A;  1TF6 A;  4ZYH A;  1JK2 A;  5A2Q C;  5AAS A;  1BBG A;  2LMZ A;  5CFF E;  2BB8 A;  4JV5 E;  3T1Y E;  1DI2 A;  1IQO A;  4OOG C;  1N34 E;  3VK6 A;  2JYA A;  2YT4 A;  2MC5 A;  4LF5 E;  2WCC 3;  4JYA E;  2EOJ A;  4MLV A;  5LMN E;  5BR8 E;  1SFE A;  4R2E A;  2YTE A;  2ELY A;  2L3J A;  1HNW E;  2GPI A;  3C6M A;  2LO3 A;  2EOO A;  1NCS A;  2L2M A;  4R8O A;  3HPZ A;  2EWL A;  2EM3 A;  1J26 A;  2EOX A;  2VQE E;  2EPR A;  2M4I A;  2EOI A;  2E72 A;  3VYX A;  4LFA E;  2M9A A;  1Z1B A;  2EPU A;  2CPN A;  3EPK A;  4GEQ B;  2EMH A;  4LF6 E;  2EQ1 A;  1GZ6 A;  1JK1 A;  1DGC A;  4RHB B;  4BBY A;  4JI0 E;  2DLK A;  1IBM E;  2EOF A;  5A6K A;  2EN8 A;  1I94 E;  1PJT A;  2ODR D;  2RSM A;  4OX9 E;  4DV3 E;  2EE8 A;  2HJJ A;  2FTX B;  2YTN A;  2ELZ A;  2EMK A;  4M0V A;  1A1G A;  2EOE A;  2EMB A;  2EQ3 A;  1SR9 A;  2UXB E;  2NUE A;  2NAB A;  2YTI A;  4WX9 A;  1X48 A;  2EPM X;  2EMF A;  1YFH A;  1KJK A;  1AH5 A;  3MHS C;  1IQS A;  3RMP A;  1T4O A;  4F6M A;  2UUC E;  2JY9 A;  4X64 E;  2EMG A;  3JAM C;  4R2A A;  2WBS A;  2UUA E;  1ZBQ A;  2EN7 A;  2GLI A;  4LF9 E;  2EN1 A;  2M1S A;  1KYQ A;  4Q28 A;  2EMY A;  5IXM B;  4AQY E;  3AV0 A; 
#chains in the Genus database with same CATH homology
 4R2C A;  1WJP A;  5KL3 A;  2YRK A;  2EN4 A;  2EPX A;  2CTD A;  4WSG A;  2EN2 A;  2I13 A;  1X6F A;  3EPH A;  2YTJ A;  2YTP A;  2EM2 A;  2YSP A;  5KL7 A;  2ENA A;  2EN6 A;  1RMD A;  2EPA A;  2GHF A;  2D9H A;  2EPZ A;  3EPJ A;  2A25 A;  2ADR A;  1F2I G;  2EM8 A;  2YTD A;  1G2D C;  3UK3 C;  2RPC A;  2JPA A;  1X6H A;  4R2R A;  5KL6 A;  1TF3 A;  1TF6 A;  1JK2 A;  2DLQ A;  1P47 A;  1YUI A;  2EP3 A;  2BB8 A;  2ENC A;  2EN3 A;  2EL4 A;  4IJD A;  2EM7 A;  2EQ0 A;  2J7J A;  2YRM A;  1BBO A;  2YSO A;  2EL5 A;  2WCC 3;  2EOJ A;  2HGH A;  2YTG A;  2EOY A;  4R2E A;  2EMX A;  2EJ4 A;  2YTE A;  2MKD A;  2ELY A;  1TN9 A;  2EM9 A;  4R2S A;  2LO3 A;  2EOO A;  1NCS A;  2ENH A;  2EM3 A;  2EOX A;  1A1H A;  2EPR A;  2WBT A;  2EOI A;  2E72 A;  2YRH A;  2M9A A;  2YTF A;  1Z1B A;  4R2D A;  2EPC A;  2EOH A;  2EPU A;  3EPK A;  2CT1 A;  3VHT B;  2EM5 A;  2MDG A;  1G2F C;  2EMH A;  2PRT A;  2EOZ A;  2EQ1 A;  1JK1 A;  1MEY C;  1X5W A;  1DGC A;  1X6E A;  5KL2 A;  1UBD C;  1ZU1 A;  2VRD A;  2DLK A;  1LLM C;  2EOF A;  2EN8 A;  5KL4 A;  1YSA C;  4R2P A;  2LV2 A;  1ZR9 A;  2EMC A;  1X3C A;  2EE8 A;  2YU5 A;  2YTO A;  4GZN C;  2YTN A;  2ELZ A;  2EMK A;  1A1J A;  2DMI A;  1A1G A;  2EOE A;  2EMB A;  2EQ3 A;  2RSI A;  1AAY A;  1A1L A;  2EOS A;  2R1F A;  2EM0 A;  2NAB A;  2YTI A;  2DRP A;  2MKN A;  2WBU A;  1YUJ A;  4IS1 C;  1A1K A;  2EMW A;  4FK5 C;  2EM6 A;  1UN6 B;  2EMF A;  2EOQ A;  4F2J C;  1KJK A;  2EMA A;  1BB8 A;  2YTQ A;  3MHS C;  1ZAA C;  2EM4 A;  4F6M A;  2LVH A;  1A1I A;  2CSH A;  3M99 B;  2LCE A;  2EMG A;  3EPL A;  2EMZ A;  2EMI A;  5KL5 A;  4R2A A;  4F6N A;  4M9V C;  2WBS A;  2EML A;  4R2Q A;  1B69 A;  2EN7 A;  2EOM A;  1A1F A;  2DGC A;  2GLI A;  2EOR A;  3MHH C;  2EN1 A;  2JP9 A;  2EL6 A;  2EPP A;  2LT7 A;  4X9J A;  2EMY A;  2YU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...