2YTFA

Solution structure of the c2h2 type zinc finger (region 607-639) of human zinc finger protein 268
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPFECSECQKAFNTKSNLIVHQRTHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 607-639) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 268
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ytfA01
2VRDA 1BBOA 4R2QA 2EMKA 2WBTA 2EN2A 2EQ0A 2EMWA 2YTFA 2LVHA 2E72A 2EMCA 1B69A 5KL6A 5KL2A 2YTJA 4IJDA 2YTDA 1P47A 2YRHA 3UK3C 4GZNC 1ZAAC 2EN3A 2EPZA 4R2DA 2YRKA 2ENHA 2MKNA 2CSHA 2EM4A 4R2CA 2ENCA 1RMDA 1WJPA 2A25A 2GLIA 2EN7A 2EE8A 2JP9A 2EMXA 3EPJA 2EQ3A 1X6HA 2EOYA 2YTOA 2JPAA 2YRMA 2LCEA 2YTNA 2EJ4A 2EM6A 2M9AA 1JK1A 2EPUA 2EM5A 1X3CA 1YSAC 5KL7A 2EPXA 1AAYA 2ADRA 2EN4A 4M9VC 4F2JC 2EP3A 2EM3A 1JK2A 2ELYA 1A1FA 1MEYC 2LO3A 2MDGA 4R2SA 2WBUA 2ELZA 2EOHA 4FK5C 3EPLA 2DGCA 2R1FA 1G2DC 3EPHA 2EPAA 1YUIA 2EMBA 2EPPA 2YTIA 4F6NA 2EOIA 1BB8A 3MHSC 2EQ1A 2LV2A 1A1KA 2EM9A 4X9JA 1A1HA 1TF3A 2PRTA 1A1JA 2GHFA 2EOJA 1G2FC 2EMGA 2EPRA 5KL3A 2DLKA 2EN8A 2EMAA 2EL5A 4R2EA 1TF6A 1UBDC 2HGHA 2EMZA 2YTGA 3MHHC 2LT7A 3EPKA 1A1LA 1F2IG 2WCC3 4R2AA 5KL4A 2EOQA 1ZR9A 5KL5A 4R2PA 2NABA 2EMFA 4IS1C 2EMYA 1NCSA 2ENAA 3M99B 1TN9A 1UN6B 2YSOA 2CT1A 2EPCA 2EN1A 1Z1BA 2CTDA 2EL6A 2EM7A 1X5WA 2YTQA 1ZU1A 2EORA 1A1IA 2EMHA 1YUJA 2EOMA 2RPCA 2EOSA 4WSGA 2YU8A 2EOOA 2DMIA 2EM0A 1X6EA 2DRPA 2J7JA 2EMIA 2WBSA 1X6FA 2EN6A 2EOFA 2RSIA 2DLQA 2EMLA 3VHTB 2YTEA 2EOXA 2YSPA 2YTPA 2EL4A 1KJKA 2BB8A 2YU5A 4F6MA 2D9HA 1A1GA 1DGCA 4R2RA 2EOEA 1LLMC 2EM8A 2EM2A 2EOZA 2I13A 2MKDA
chains in the Genus database with same CATH superfamily
2I9IA 1BBOA 4R2QA 2VF1A 2RS6A 5A6BD 3TQMA 2JVAA 3F6GA 2EQ0A 4ZYGA 2YTFA 2LVHA 1HNXE 4DMIA 3JAMC 2VE7C 4JI8E 5BR8E 5A6AA 1P47A 2E1MA 3J7AG 4R2DA 2ENHA 3HPZA 2CSHA 4KWYA 1WRJA 1N3GA 3FIGA 4R2CA 2ENCA 3ADIA 2M7QA 2EQ3A 1FKAE 4DV6E 4OX9E 2LRSA 2JPAA 4JI0E 1XMQE 2YRMA 2YTNA 2EM6A 2EPUA 3C6KA 1BBGA 3BF2A 2EM5A 1YSAC 2UXCE 1AAYA 2V88A 1KYQA 4DR6E 2ELYA 1A1FA 1MEYC 3ADLA 5DNYA 2MDGA 4R2SA 5IXMB 2WBUA 2EOHA 3J7Yp 3EPLA 4JV5E 2UXDE 2R1FA 2L92A 3EPHA 2EPAA 1YUIA 1EH6A 4Q35B 2EPOA 2RS7A 1BB8A 2EQ1A 2IHR1 4X9JA 4KZSA 1GZ6A 2PRTA 1A1JA 1G2FC 2EPRA 5KL3A 2R76A 2L8TA 1STUA 2UU9E 1FJGE 1N32E 3MHHC 3LMLA 1N33E 2FV4B 3EPKA 4LFCE 1A1LA 1F2IG 2M4IA 5KL4A 4LFAE 4LTYA 4F9AB 2NA2A 4JI2E 3M99B 2YSOA 2EWLA 2EPCA 2EN1A 2EL6A 2EM7A 4X66E 1ZU1A 1YUJA 2EOMA 4GEQB 1IMUA 2RSMA 1YZ9A 1X6EA 4BHCA 2EMIA 2ODRD 2RSIA 1IQOA 2YSPA 1X48A 2YTPA 1DGCA 1HNZE 4RHBB 4M30A 2BBGA 2EOEA 4F9BB 4HTGA 3AV0A 4N4RB 2LBSB 2I13A 4LU9A 2LTRA 2EMKA 2V8QB 2WBTA 3OTOE 2EN2A 2MDRA 1EH7A 4BHBA 2JWOA 2E72A 2EMCA 3T1YE 5F3WA 2KONA 4LF5E 2DMYA 2YRHA 1N36E 4GZNC 2EPLX 4DV3E 3EQ1A 4O43A 2YRKA 2MKNA 4BCAA 2EM4A 2HHHE 4DR1E 1WXRA 3EPJA 3H09A 2B9DA 1YPNA 1X6HA 2EOYA 1DI2A 2LCEA 2L2NA 4NZVA 1PKPA 2UXBE 1X3CA 4WFTA 4JI4E 4GKKE 5KL7A 5LLQA 1PJQA 2EN4A 4M9VC 2LE2A 4MLVA 4F2JC 4NXME 2ODRC 3VYXA 4HEIA 1XNQE 4O5GA 3C4TA 2N3HA 4B3RE 2DGCA 4WPYA 2EMBA 4DV4E 3ECRA 4F6NA 2EOIA 5A6BA 3MHSC 3IWCA 5CFFE 2N8XA 3J80C 5FLXC 2G7HA 1A1HA 1TF3A 1EH8A 4ZYEA 2DLKA 2EN8A 4M2ZA 1PJSA 1QNTA 2EL5A 4JI1E 4GKJE 1TF6A 3LLHA 4DR2E 1UBDC 4KHPE 2EMZA 2LT7A 2VQFE 2MC6A 3BBGA 4BBYA 4M0VA 2WCC3 4R2AA 5KL5A 1EKZA 2EMFA 4I8OA 4DUZE 3HTXA 1NCSA 1YYOA 1TN9A 2CTDA 5A69A 2K7IA 5LMUE 5IWAE 1QU6A 4YHHE 2EOSA 5A6JA 2YU8A 2YWQA 2DMIA 4ZYHA 3THOB 4WYQB 5AE3A 1T38A 2WBSA 1J26A 2EOFA 5A6KA 1UHZA 2DLQA 3VHTB 1X47A 2GPIA 4B3ME 4MLQA 2V86A 2EL4A 1KJKA 3F6HA 5IT9C 4OOGC 4BMJA 2RTXA 4LF9E 1LLMC 2L2KB 2EM8A 1YYKA 3HXLA 1IBLE 4DKKA 4DR5E 2M1SA 3DF6A 3C4BA 2FGGA 2JXPA 2EMWA 2KOUA 5T6JA 4R03A 4R8OA 3DJWA 2YPNA 5KL2A 5AASA 3UK3C 2B3TB 2NUGA 4ZYDA 3KWRA 4DV1E 4WX9A 5AC5A 1T4NA 1WHQA 2HJJA 4X62E 4TUGA 1WJPA 3AUZA 2GLIA 2JP9A 2EMXA 1T39A 2LUQA 3QG5C 1SFEA 4YY3E 2LTSA 2N3GA 2YTOA 3THNA 1IBME 2EJ4A 2M9AA 1JK1A 1I94E 2V87A 4AQYE 4L8NA 4X65E 2ADRA 1J5EE 2RQLA 4F54A 2EP3A 2EM3A 4LF4E 1JK2A 2DSYA 2E5LE 2YT4A 2ELZA 4FK5C 1PJTA 3VK6A 4BC9A 4J8ZA 1ZBQA 4DR4E 4WSPA 2Q8UA 2CPNA 4BC7A 2LJUA 3IWDA 4NHRA 2EMGA 2V89A 2ZM6E 2EMAA 4WXDA 3C6MA 3J81C 4R2EA 2HGHA 4LFBE 4BS9A 2K4VA 2YTGA 1HR0E 4Q28A 4JYAE 2L3JA 4L5NC 3JU0A 2UUCE 4JI6E 2L33A 1L4SA 2EOQA 1ZR9A 4R2PA 4IS1C 2MC5A 4JI3E 3VYYA 4DR3E 2CT1A 3ZOQB 2YTQA 1X5WA 4P7DA 4DV2E 2EORA 5AC4A 4DV7E 2EMHA 1IBKE 2RPCA 4WSGA 2EOOA 2EM0A 1AH5A 2DRPA 4DV0E 1YYWA 1X6FA 2EN6A 2B7VA 5ADZA 2YU5A 2WZOA 4LF7E 4R2RA 4DUYE 1T4LB 2EOZA 2KHXA 3P1XA 3JTZA 2V85A 2MKDA 2VRDA 3L00A 4RH8A 4O4KA 3ADGA 5AE1A 1B69A 5KL6A 1PDAA 2YTJA 4B3SE 2JYAA 4DR7E 2EPNA 2YTDA 4IJDA 1ZAAC 2EN3A 2EPZA 1YFHA 3OMLA 2NUFA 2LMZA 2L2MA 4K0KE 1RMDA 4O24A 3RMPA 2A25A 4JI5E 1GQEA 2EN7A 2EE8A 2JOXA 5A2QC 1WHNA 2NUEA 3KZYA 3KZZA 3K6QA 2EPXA 2DB2A 1XMOE 2F4VE 2F8BA 2LO3A 3IWBA 2YZTA 3MSWA 1G2DC 2VQEE 5IV8B 1XNRE 4P78A 4F9CB 2V83A 1T4OA 2EPPA 2YTIA 2LV2A 4LF8E 1A1KA 2EM9A 2H36X 1O0WA 2GHFA 2EOJA 4LF6E 5TSEA 2EPMX 4X8WA 3T1HE 1N34E 4TUIA 3HPSA 3BGHA 1RC7A 1IQSA 1SR9A 5LL6R 2B7TA 2EPKX 1MGTA 2JR1A 3HQ1A 1HNWE 2NABA 2UUBE 2HC5A 3BIDA 5LMNE 1DQ3A 2EMYA 4WXCA 2EZ6A 2ENAA 4X64E 1UN6B 4NXNE 1Z1BA 1GTKA 2UUAE 1A1IA 2LJHA 2FTXB 2L6MA 2L3CA 1X49A 2J7JA 2JOBA 4DV5E 1ZBTA 1UILA 2EMLA 2YTEA 2EOXA 4JI7E 2DIXA 4B3TE 2BB8A 4F6MA 2D9HA 1A1GA 1NEIA 1RQ0A 5AE2A 3ADJA 2EM2A 2JY9A 2LUPB
chains in the Genus database with same CATH topology
2VRDA 1BBOA 4R2QA 2EMKA 2WBTA 2EN2A 2EQ0A 2EMWA 2YTFA 2LVHA 2E72A 2EMCA 1B69A 5KL6A 5KL2A 2YTJA 4IJDA 2YTDA 1P47A 2YRHA 3UK3C 4GZNC 1ZAAC 2EN3A 2EPZA 4R2DA 2YRKA 2ENHA 2MKNA 2CSHA 2EM4A 4R2CA 2ENCA 1RMDA 1WJPA 2A25A 2GLIA 2EN7A 2EE8A 2JP9A 2EMXA 3EPJA 2EQ3A 1X6HA 2EOYA 2YTOA 2JPAA 2YRMA 2LCEA 2YTNA 2EJ4A 2EM6A 2M9AA 1JK1A 2EPUA 2EM5A 1X3CA 1YSAC 5KL7A 2EPXA 1AAYA 2ADRA 2EN4A 4M9VC 4F2JC 2EP3A 2EM3A 1JK2A 2ELYA 1A1FA 1MEYC 2LO3A 2MDGA 4R2SA 2WBUA 2ELZA 2EOHA 4FK5C 3EPLA 2DGCA 2R1FA 1G2DC 3EPHA 2EPAA 1YUIA 2EMBA 2EPPA 2YTIA 4F6NA 2EOIA 1BB8A 3MHSC 2EQ1A 2LV2A 1A1KA 2EM9A 4X9JA 1A1HA 1TF3A 2PRTA 1A1JA 2GHFA 2EOJA 1G2FC 2EMGA 2EPRA 5KL3A 2DLKA 2EN8A 2EMAA 2EL5A 4R2EA 1TF6A 1UBDC 2HGHA 2EMZA 2YTGA 3MHHC 2LT7A 3EPKA 1A1LA 1F2IG 2WCC3 4R2AA 5KL4A 2EOQA 1ZR9A 5KL5A 4R2PA 2NABA 2EMFA 4IS1C 2EMYA 1NCSA 2ENAA 3M99B 1TN9A 1UN6B 2YSOA 2CT1A 2EPCA 2EN1A 1Z1BA 2CTDA 2EL6A 2EM7A 1X5WA 2YTQA 1ZU1A 2EORA 1A1IA 2EMHA 1YUJA 2EOMA 2RPCA 2EOSA 4WSGA 2YU8A 2EOOA 2DMIA 2EM0A 1X6EA 2DRPA 2J7JA 2EMIA 2WBSA 1X6FA 2EN6A 2EOFA 2RSIA 2DLQA 2EMLA 3VHTB 2YTEA 2EOXA 2YSPA 2YTPA 2EL4A 1KJKA 2BB8A 2YU5A 4F6MA 2D9HA 1A1GA 1DGCA 4R2RA 2EOEA 1LLMC 2EM8A 2EM2A 2EOZA 2I13A 2MKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VRD A;  1BBO A;  4R2Q A;  2EMK A;  2WBT A;  2EN2 A;  2EQ0 A;  2EMW A;  2YTF A;  2LVH A;  2E72 A;  2EMC A;  1B69 A;  5KL6 A;  5KL2 A;  2YTJ A;  4IJD A;  2YTD A;  1P47 A;  2YRH A;  3UK3 C;  4GZN C;  1ZAA C;  2EN3 A;  2EPZ A;  4R2D A;  2YRK A;  2ENH A;  2MKN A;  2CSH A;  2EM4 A;  4R2C A;  2ENC A;  1RMD A;  1WJP A;  2A25 A;  2GLI A;  2EN7 A;  2EE8 A;  2JP9 A;  2EMX A;  3EPJ A;  2EQ3 A;  1X6H A;  2EOY A;  2YTO A;  2JPA A;  2YRM A;  2LCE A;  2YTN A;  2EJ4 A;  2EM6 A;  2M9A A;  1JK1 A;  2EPU A;  2EM5 A;  1X3C A;  1YSA C;  5KL7 A;  2EPX A;  1AAY A;  2ADR A;  2EN4 A;  4M9V C;  4F2J C;  2EP3 A;  2EM3 A;  1JK2 A;  2ELY A;  1A1F A;  1MEY C;  2LO3 A;  2MDG A;  4R2S A;  2WBU A;  2ELZ A;  2EOH A;  4FK5 C;  3EPL A;  2DGC A;  2R1F A;  1G2D C;  3EPH A;  2EPA A;  1YUI A;  2EMB A;  2EPP A;  2YTI A;  4F6N A;  2EOI A;  1BB8 A;  3MHS C;  2EQ1 A;  2LV2 A;  1A1K A;  2EM9 A;  4X9J A;  1A1H A;  1TF3 A;  2PRT A;  1A1J A;  2GHF A;  2EOJ A;  1G2F C;  2EMG A;  2EPR A;  5KL3 A;  2DLK A;  2EN8 A;  2EMA A;  2EL5 A;  4R2E A;  1TF6 A;  1UBD C;  2HGH A;  2EMZ A;  2YTG A;  3MHH C;  2LT7 A;  3EPK A;  1A1L A;  1F2I G;  2WCC 3;  4R2A A;  5KL4 A;  2EOQ A;  1ZR9 A;  5KL5 A;  4R2P A;  2NAB A;  2EMF A;  4IS1 C;  2EMY A;  1NCS A;  2ENA A;  3M99 B;  1TN9 A;  1UN6 B;  2YSO A;  2CT1 A;  2EPC A;  2EN1 A;  1Z1B A;  2CTD A;  2EL6 A;  2EM7 A;  1X5W A;  2YTQ A;  1ZU1 A;  2EOR A;  1A1I A;  2EMH A;  1YUJ A;  2EOM A;  2RPC A;  2EOS A;  4WSG A;  2YU8 A;  2EOO A;  2DMI A;  2EM0 A;  1X6E A;  2DRP A;  2J7J A;  2EMI A;  2WBS A;  1X6F A;  2EN6 A;  2EOF A;  2RSI A;  2DLQ A;  2EML A;  3VHT B;  2YTE A;  2EOX A;  2YSP A;  2YTP A;  2EL4 A;  1KJK A;  2BB8 A;  2YU5 A;  4F6M A;  2D9H A;  1A1G A;  1DGC A;  4R2R A;  2EOE A;  1LLM C;  2EM8 A;  2EM2 A;  2EOZ A;  2I13 A;  2MKD A; 
#chains in the Genus database with same CATH topology
 2I9I A;  1BBO A;  4R2Q A;  2VF1 A;  2RS6 A;  5A6B D;  3TQM A;  2JVA A;  3F6G A;  2EQ0 A;  4ZYG A;  2YTF A;  2LVH A;  1HNX E;  4DMI A;  3JAM C;  2VE7 C;  4JI8 E;  5BR8 E;  5A6A A;  1P47 A;  2E1M A;  3J7A G;  4R2D A;  2ENH A;  3HPZ A;  2CSH A;  4KWY A;  1WRJ A;  1N3G A;  3FIG A;  4R2C A;  2ENC A;  3ADI A;  2M7Q A;  2EQ3 A;  1FKA E;  4DV6 E;  4OX9 E;  2LRS A;  2JPA A;  4JI0 E;  1XMQ E;  2YRM A;  2YTN A;  2EM6 A;  2EPU A;  3C6K A;  1BBG A;  3BF2 A;  2EM5 A;  1YSA C;  2UXC E;  1AAY A;  2V88 A;  1KYQ A;  4DR6 E;  2ELY A;  1A1F A;  1MEY C;  3ADL A;  5DNY A;  2MDG A;  4R2S A;  5IXM B;  2WBU A;  2EOH A;  3J7Y p;  3EPL A;  4JV5 E;  2UXD E;  2R1F A;  2L92 A;  3EPH A;  2EPA A;  1YUI A;  1EH6 A;  4Q35 B;  2EPO A;  2RS7 A;  1BB8 A;  2EQ1 A;  2IHR 1;  4X9J A;  4KZS A;  1GZ6 A;  2PRT A;  1A1J A;  1G2F C;  2EPR A;  5KL3 A;  2R76 A;  2L8T A;  1STU A;  2UU9 E;  1FJG E;  1N32 E;  3MHH C;  3LML A;  1N33 E;  2FV4 B;  3EPK A;  4LFC E;  1A1L A;  1F2I G;  2M4I A;  5KL4 A;  4LFA E;  4LTY A;  4F9A B;  2NA2 A;  4JI2 E;  3M99 B;  2YSO A;  2EWL A;  2EPC A;  2EN1 A;  2EL6 A;  2EM7 A;  4X66 E;  1ZU1 A;  1YUJ A;  2EOM A;  4GEQ B;  1IMU A;  2RSM A;  1YZ9 A;  1X6E A;  4BHC A;  2EMI A;  2ODR D;  2RSI A;  1IQO A;  2YSP A;  1X48 A;  2YTP A;  1DGC A;  1HNZ E;  4RHB B;  4M30 A;  2BBG A;  2EOE A;  4F9B B;  4HTG A;  3AV0 A;  4N4R B;  2LBS B;  2I13 A;  4LU9 A;  2LTR A;  2EMK A;  2V8Q B;  2WBT A;  3OTO E;  2EN2 A;  2MDR A;  1EH7 A;  4BHB A;  2JWO A;  2E72 A;  2EMC A;  3T1Y E;  5F3W A;  2KON A;  4LF5 E;  2DMY A;  2YRH A;  1N36 E;  4GZN C;  2EPL X;  4DV3 E;  3EQ1 A;  4O43 A;  2YRK A;  2MKN A;  4BCA A;  2EM4 A;  2HHH E;  4DR1 E;  1WXR A;  3EPJ A;  3H09 A;  2B9D A;  1YPN A;  1X6H A;  2EOY A;  1DI2 A;  2LCE A;  2L2N A;  4NZV A;  1PKP A;  2UXB E;  1X3C A;  4WFT A;  4JI4 E;  4GKK E;  5KL7 A;  5LLQ A;  1PJQ A;  2EN4 A;  4M9V C;  2LE2 A;  4MLV A;  4F2J C;  4NXM E;  2ODR C;  3VYX A;  4HEI A;  1XNQ E;  4O5G A;  3C4T A;  2N3H A;  4B3R E;  2DGC A;  4WPY A;  2EMB A;  4DV4 E;  3ECR A;  4F6N A;  2EOI A;  5A6B A;  3MHS C;  3IWC A;  5CFF E;  2N8X A;  3J80 C;  5FLX C;  2G7H A;  1A1H A;  1TF3 A;  1EH8 A;  4ZYE A;  2DLK A;  2EN8 A;  4M2Z A;  1PJS A;  1QNT A;  2EL5 A;  4JI1 E;  4GKJ E;  1TF6 A;  3LLH A;  4DR2 E;  1UBD C;  4KHP E;  2EMZ A;  2LT7 A;  2VQF E;  2MC6 A;  3BBG A;  4BBY A;  4M0V A;  2WCC 3;  4R2A A;  5KL5 A;  1EKZ A;  2EMF A;  4I8O A;  4DUZ E;  3HTX A;  1NCS A;  1YYO A;  1TN9 A;  2CTD A;  5A69 A;  2K7I A;  5LMU E;  5IWA E;  1QU6 A;  4YHH E;  2EOS A;  5A6J A;  2YU8 A;  2YWQ A;  2DMI A;  4ZYH A;  3THO B;  4WYQ B;  5AE3 A;  1T38 A;  2WBS A;  1J26 A;  2EOF A;  5A6K A;  1UHZ A;  2DLQ A;  3VHT B;  1X47 A;  2GPI A;  4B3M E;  4MLQ A;  2V86 A;  2EL4 A;  1KJK A;  3F6H A;  5IT9 C;  4OOG C;  4BMJ A;  2RTX A;  4LF9 E;  1LLM C;  2L2K B;  2EM8 A;  1YYK A;  3HXL A;  1IBL E;  4DKK A;  4DR5 E;  2M1S A;  3DF6 A;  3C4B A;  2FGG A;  2JXP A;  2EMW A;  2KOU A;  5T6J A;  4R03 A;  4R8O A;  3DJW A;  2YPN A;  5KL2 A;  5AAS A;  3UK3 C;  2B3T B;  2NUG A;  4ZYD A;  3KWR A;  4DV1 E;  4WX9 A;  5AC5 A;  1T4N A;  1WHQ A;  2HJJ A;  4X62 E;  4TUG A;  1WJP A;  3AUZ A;  2GLI A;  2JP9 A;  2EMX A;  1T39 A;  2LUQ A;  3QG5 C;  1SFE A;  4YY3 E;  2LTS A;  2N3G A;  2YTO A;  3THN A;  1IBM E;  2EJ4 A;  2M9A A;  1JK1 A;  1I94 E;  2V87 A;  4AQY E;  4L8N A;  4X65 E;  2ADR A;  1J5E E;  2RQL A;  4F54 A;  2EP3 A;  2EM3 A;  4LF4 E;  1JK2 A;  2DSY A;  2E5L E;  2YT4 A;  2ELZ A;  4FK5 C;  1PJT A;  3VK6 A;  4BC9 A;  4J8Z A;  1ZBQ A;  4DR4 E;  4WSP A;  2Q8U A;  2CPN A;  4BC7 A;  2LJU A;  3IWD A;  4NHR A;  2EMG A;  2V89 A;  2ZM6 E;  2EMA A;  4WXD A;  3C6M A;  3J81 C;  4R2E A;  2HGH A;  4LFB E;  4BS9 A;  2K4V A;  2YTG A;  1HR0 E;  4Q28 A;  4JYA E;  2L3J A;  4L5N C;  3JU0 A;  2UUC E;  4JI6 E;  2L33 A;  1L4S A;  2EOQ A;  1ZR9 A;  4R2P A;  4IS1 C;  2MC5 A;  4JI3 E;  3VYY A;  4DR3 E;  2CT1 A;  3ZOQ B;  2YTQ A;  1X5W A;  4P7D A;  4DV2 E;  2EOR A;  5AC4 A;  4DV7 E;  2EMH A;  1IBK E;  2RPC A;  4WSG A;  2EOO A;  2EM0 A;  1AH5 A;  2DRP A;  4DV0 E;  1YYW A;  1X6F A;  2EN6 A;  2B7V A;  5ADZ A;  2YU5 A;  2WZO A;  4LF7 E;  4R2R A;  4DUY E;  1T4L B;  2EOZ A;  2KHX A;  3P1X A;  3JTZ A;  2V85 A;  2MKD A;  2VRD A;  3L00 A;  4RH8 A;  4O4K A;  3ADG A;  5AE1 A;  1B69 A;  5KL6 A;  1PDA A;  2YTJ A;  4B3S E;  2JYA A;  4DR7 E;  2EPN A;  2YTD A;  4IJD A;  1ZAA C;  2EN3 A;  2EPZ A;  1YFH A;  3OML A;  2NUF A;  2LMZ A;  2L2M A;  4K0K E;  1RMD A;  4O24 A;  3RMP A;  2A25 A;  4JI5 E;  1GQE A;  2EN7 A;  2EE8 A;  2JOX A;  5A2Q C;  1WHN A;  2NUE A;  3KZY A;  3KZZ A;  3K6Q A;  2EPX A;  2DB2 A;  1XMO E;  2F4V E;  2F8B A;  2LO3 A;  3IWB A;  2YZT A;  3MSW A;  1G2D C;  2VQE E;  5IV8 B;  1XNR E;  4P78 A;  4F9C B;  2V83 A;  1T4O A;  2EPP A;  2YTI A;  2LV2 A;  4LF8 E;  1A1K A;  2EM9 A;  2H36 X;  1O0W A;  2GHF A;  2EOJ A;  4LF6 E;  5TSE A;  2EPM X;  4X8W A;  3T1H E;  1N34 E;  4TUI A;  3HPS A;  3BGH A;  1RC7 A;  1IQS A;  1SR9 A;  5LL6 R;  2B7T A;  2EPK X;  1MGT A;  2JR1 A;  3HQ1 A;  1HNW E;  2NAB A;  2UUB E;  2HC5 A;  3BID A;  5LMN E;  1DQ3 A;  2EMY A;  4WXC A;  2EZ6 A;  2ENA A;  4X64 E;  1UN6 B;  4NXN E;  1Z1B A;  1GTK A;  2UUA E;  1A1I A;  2LJH A;  2FTX B;  2L6M A;  2L3C A;  1X49 A;  2J7J A;  2JOB A;  4DV5 E;  1ZBT A;  1UIL A;  2EML A;  2YTE A;  2EOX A;  4JI7 E;  2DIX A;  4B3T E;  2BB8 A;  4F6M A;  2D9H A;  1A1G A;  1NEI A;  1RQ0 A;  5AE2 A;  3ADJ A;  2EM2 A;  2JY9 A;  2LUP B; 
#chains in the Genus database with same CATH homology
 2VRD A;  1BBO A;  4R2Q A;  2EMK A;  2WBT A;  2EN2 A;  2EQ0 A;  2EMW A;  2YTF A;  2LVH A;  2E72 A;  2EMC A;  1B69 A;  5KL6 A;  5KL2 A;  2YTJ A;  4IJD A;  2YTD A;  1P47 A;  2YRH A;  3UK3 C;  4GZN C;  1ZAA C;  2EN3 A;  2EPZ A;  4R2D A;  2YRK A;  2ENH A;  2MKN A;  2CSH A;  2EM4 A;  4R2C A;  2ENC A;  1RMD A;  1WJP A;  2A25 A;  2GLI A;  2EN7 A;  2EE8 A;  2JP9 A;  2EMX A;  3EPJ A;  2EQ3 A;  1X6H A;  2EOY A;  2YTO A;  2JPA A;  2YRM A;  2LCE A;  2YTN A;  2EJ4 A;  2EM6 A;  2M9A A;  1JK1 A;  2EPU A;  2EM5 A;  1X3C A;  1YSA C;  5KL7 A;  2EPX A;  1AAY A;  2ADR A;  2EN4 A;  4M9V C;  4F2J C;  2EP3 A;  2EM3 A;  1JK2 A;  2ELY A;  1A1F A;  1MEY C;  2LO3 A;  2MDG A;  4R2S A;  2WBU A;  2ELZ A;  2EOH A;  4FK5 C;  3EPL A;  2DGC A;  2R1F A;  1G2D C;  3EPH A;  2EPA A;  1YUI A;  2EMB A;  2EPP A;  2YTI A;  4F6N A;  2EOI A;  1BB8 A;  3MHS C;  2EQ1 A;  2LV2 A;  1A1K A;  2EM9 A;  4X9J A;  1A1H A;  1TF3 A;  2PRT A;  1A1J A;  2GHF A;  2EOJ A;  1G2F C;  2EMG A;  2EPR A;  5KL3 A;  2DLK A;  2EN8 A;  2EMA A;  2EL5 A;  4R2E A;  1TF6 A;  1UBD C;  2HGH A;  2EMZ A;  2YTG A;  3MHH C;  2LT7 A;  3EPK A;  1A1L A;  1F2I G;  2WCC 3;  4R2A A;  5KL4 A;  2EOQ A;  1ZR9 A;  5KL5 A;  4R2P A;  2NAB A;  2EMF A;  4IS1 C;  2EMY A;  1NCS A;  2ENA A;  3M99 B;  1TN9 A;  1UN6 B;  2YSO A;  2CT1 A;  2EPC A;  2EN1 A;  1Z1B A;  2CTD A;  2EL6 A;  2EM7 A;  1X5W A;  2YTQ A;  1ZU1 A;  2EOR A;  1A1I A;  2EMH A;  1YUJ A;  2EOM A;  2RPC A;  2EOS A;  4WSG A;  2YU8 A;  2EOO A;  2DMI A;  2EM0 A;  1X6E A;  2DRP A;  2J7J A;  2EMI A;  2WBS A;  1X6F A;  2EN6 A;  2EOF A;  2RSI A;  2DLQ A;  2EML A;  3VHT B;  2YTE A;  2EOX A;  2YSP A;  2YTP A;  2EL4 A;  1KJK A;  2BB8 A;  2YU5 A;  4F6M A;  2D9H A;  1A1G A;  1DGC A;  4R2R A;  2EOE A;  1LLM C;  2EM8 A;  2EM2 A;  2EOZ A;  2I13 A;  2MKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...