2YTFA

Solution structure of the c2h2 type zinc finger (region 607-639) of human zinc finger protein 268
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPFECSECQKAFNTKSNLIVHQRTHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 268
publication title Solution structure of the C2H2 type zinc finger (region 607-639) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ytfA01
4R2QA 2EMHA 2EL6A 2WBUA 2ENHA 5KL6A 2GHFA 1YUJA 2EM2A 2EMCA 1A1JA 2HGHA 2EMLA 2CT1A 4F2JC 1X3CA 4R2RA 5KL7A 2EM7A 5KL3A 2EPCA 4WSGA 2CTDA 2DGCA 2YTQA 2EMXA 1A1HA 1X6FA 2EPXA 1DGCA 1UBDC 1X6EA 2YTOA 4IS1C 2EN2A 2EM8A 2JP9A 2EMIA 2EOYA 4F6MA 3MHHC 2DLKA 2LCEA 2J7JA 2LVHA 1ZR9A 4F6NA 2YTFA 3M99B 1X5WA 4R2PA 2ENAA 4R2SA 2WCC3 2EMWA 2YTGA 2EM9A 2YU8A 2M9AA 4R2EA 2WBTA 2EOMA 4GZNC 3EPHA 2EM5A 2EN7A 2EOZA 2YTIA 1AAYA 1A1IA 2EOFA 2EN1A 2EMBA 2EPPA 2EN6A 2CSHA 1A1GA 2EMZA 1KJKA 2EPAA 2MKNA 2EPRA 2EQ1A 2EMFA 3MHSC 5KL2A 2YTPA 2ADRA 1ZU1A 2EOEA 4IJDA 2D9HA 1NCSA 2EL5A 2MDGA 2EMKA 3EPKA 2ELZA 2DLQA 2EPUA 2RSIA 2EOQA 1YSAC 1TN9A 4M9VC 5KL4A 2EQ3A 3EPLA 2YRHA 2EN3A 1BBOA 2EQ0A 2VRDA 2JPAA 2LV2A 2EOJA 2YTDA 2LO3A 2PRTA 5KL5A 2EOSA 1YUIA 2YRMA 2DRPA 1JK2A 1RMDA 2EORA 1B69A 1G2FC 2GLIA 2YTNA 2EN4A 2R1FA 2YSOA 2EN8A 1UN6B 1Z1BA 2YU5A 1TF3A 2EOIA 4X9JA 4R2CA 2EMAA 1MEYC 2ENCA 1ZAAC 2EM6A 2EP3A 2I13A 2YRKA 1LLMC 2A25A 1WJPA 2EOXA 2EOHA 2EJ4A 2YSPA 3EPJA 2EMGA 2EM0A 2LT7A 1TF6A 2WBSA 2BB8A 2EPZA 1JK1A 2EL4A 2MKDA 2YTEA 4R2DA 1A1LA 3UK3C 4FK5C 2EM4A 2RPCA 2NABA 2DMIA 2EOOA 1A1KA 1A1FA 4R2AA 2EE8A 3VHTB 1G2DC 2E72A 2YTJA 1X6HA 1P47A 1BB8A 2ELYA 2EMYA 1F2IG 2EM3A
chains in the Genus database with same CATH superfamily
5LL6R 3JU0A 2EMHA 2EL6A 3JAMC 3K6QA 2RQLA 2ENHA 2EM2A 4Q28A 1A1JA 2V83A 2ODRD 1XNRE 4F2JC 1GQEA 5LMNE 2UUAE 2EPMX 5KL7A 4ZYEA 2EM7A 5KL3A 2DMYA 2LRSA 3P1XA 3THNA 4X66E 1UBDC 2EM8A 2M1SA 1AH5A 4O43A 1UILA 2J7JA 2LVHA 3OMLA 1ZR9A 1IQSA 1X5WA 2ENAA 4J8ZA 4R2SA 2EM9A 1WHNA 2I9IA 2WBTA 2EOMA 4GKKE 2EN7A 1ZBQA 1A1IA 3IWDA 1HNWE 2EPAA 2YTPA 2ADRA 2L92A 4ZYGA 3L00A 1ZU1A 4IJDA 2L3JA 1QU6A 2EL5A 4WFTA 5BR8E 1EH7A 2NA2A 4JI6E 2ELZA 2EPUA 2RSIA 4LFAE 2BBGA 3C4TA 1YSAC 4KZSA 2YWQA 3J7AG 2FV4B 2EQ0A 3VK6A 2V87A 4JYAE 1NEIA 2EOJA 2YTDA 2EOSA 2B7TA 1YUIA 2DRPA 5A6KA 4DV1E 1B69A 1G2FC 4GKJE 1L4SA 2EN4A 2R1FA 2KHXA 4BS9A 4WPYA 2EOIA 4X64E 4X9JA 3T1HE 4R2CA 1MEYC 4WXCA 1ZBTA 4LF4E 2YPNA 5A2QC 3BGHA 1PJQA 2I13A 1LLMC 1WJPA 4BCAA 2WZOA 1XNQE 2BB8A 4F54A 1JK1A 1FJGE 2YTEA 4R2DA 4JI2E 3UK3C 4DUYE 2FTXB 2RPCA 2VF1A 4YY3E 1A1KA 5TSEA 2DSYA 2E72A 2GPIA 1G2DC 4LF8E 1X6HA 2RTXA 1MGTA 4X62E 2EM3A 3J80C 4JI1E 2N3HA 1EKZA 2L3CA 2GHFA 3LLHA 4BMJA 1T4OA 2L6MA 2EMCA 2HGHA 4DR7E 2EPCA 2CTDA 2DGCA 2EMXA 1A1HA 1X6FA 2LBSB 2YTOA 2JP9A 1IBME 2L2MA 2EOYA 2EPNA 2V88A 2LCEA 2LTRA 4F6NA 2EPKX 3M99B 1WHQA 4R2PA 3FIGA 2WCC3 4YHHE 2LUQA 2YU8A 1DQ3A 1EH8A 4R2EA 1YYWA 4OX9E 2EPLX 1HNZE 4DV0E 2EOZA 2YTIA 2MC5A 4RHBB 4F9AB 5IV8B 3VYYA 2EN1A 1YZ9A 2EN6A 3IWCA 2EMZA 4Q35B 2LUPB 2EPRA 3MHSC 3DJWA 4DR6E 3QG5C 1DI2A 4F9BB 2EOEA 3H09A 2L2KB 2CPNA 2EOQA 1WXRA 1TN9A 4M9VC 5KL4A 3T1YE 2JVAA 4JI4E 2EN3A 2LTSA 2JY9A 4N4RB 5AE3A 2M4IA 2JPAA 4TUIA 4B3TE 2ODRC 3JTZA 2PRTA 5KL5A 4DV5E 4RH8A 3ADGA 5IXMB 2NUEA 4LF9E 2YRMA 1T4LB 4DR4E 1RMDA 1HR0E 4LF5E 1KYQA 2YSOA 2EN8A 4JI7E 3MSWA 5IT9C 1IBKE 2YU5A 1TF3A 1EH6A 4MLVA 1X47A 2EMAA 4DV6E 5LMUE 2ENCA 1YYKA 4TUGA 4ZYHA 3BF2A 5AE2A 4MLQA 2EJ4A 3EPJA 5IWAE 1T4NA 2HHHE 4M2ZA 2MKDA 5AE1A 4HTGA 3VYXA 1WRJA 2F4VE 2NABA 2DMIA 4NXME 3THOB 3C6MA 1P47A 2R76A 2M7QA 1A1GA 4R2QA 4R8OA 3F6GA 2WBUA 1XMQE 1T39A 3OTOE 2EMLA 2UU9E 1J26A 1X3CA 4R2RA 4DUZE 2EPOA 4BC7A 4WSGA 2YTQA 1YYOA 2LMZA 1X6EA 2EN2A 2E5LE 2EMIA 4DKKA 2HC5A 2ZM6E 4WSPA 4F6MA 4BHBA 3MHHC 2DLKA 3J81C 2MDRA 4BHCA 4DV2E 2E1MA 2K7IA 4LF6E 1RQ0A 2M9AA 3HQ1A 4DV3E 1STUA 3LMLA 4L8NA 1XMOE 1N34E 4JI0E 4L5NC 1N33E 3IWBA 4P7DA 2EOFA 4AQYE 2EPPA 1KJKA 3KZZA 2MKNA 2EQ1A 2EMFA 4DR2E 2UXBE 5AC5A 5AC4A 2NUGA 2MDGA 5A6JA 2EMKA 3ECRA 1PKPA 1GZ6A 2N8XA 3BIDA 1PDAA 4HEIA 2VQEE 1BBOA 2RSMA 4NZVA 4JI3E 2VRDA 3ADJA 4O5GA 4I8OA 3C4BA 4DR3E 2NUFA 2LV2A 1YPNA 2Q8UA 1YFHA 2JXPA 4WYQB 4B3ME 4B3RE 1JK2A 2B3TB 4NHRA 2LJHA 2VE7C 2YTNA 4WXDA 2VQFE 3RMPA 3KZYA 5LLQA 5F3WA 1N32E 4DV4E 4NXNE 4O4KA 1N3GA 4BC9A 1ZAAC 2EM6A 1PJSA 2EP3A 2YRKA 2DIXA 1GTKA 2YSPA 2EOHA 1TF6A 2EMGA 2EM0A 2WBSA 4WX9A 2F8BA 2EM4A 1A1FA 2EE8A 3VHTB 3J7Yp 2RS6A 1T38A 3EQ1A 1BB8A 1X48A 2EMYA 5A6BD 1IQOA 1BBGA 4F9CB 1RC7A 1J5EE 4GEQB 2H36X 2RS7A 5KL6A 1YUJA 5CFFE 2B9DA 5DNYA 5FLXC 1O0WA 2CT1A 3C6KA 4LFBE 2UXDE 4M0VA 2EPXA 4X8WA 1DGCA 3ADIA 4IS1C 4K0KE 3F6HA 1SR9A 4KWYA 4ZYDA 4B3SE 2JOBA 2DB2A 3AUZA 2UUCE 1X49A 2L8TA 2YTFA 4M30A 2G7HA 2V86A 4X65E 2EMWA 2YTGA 2EWLA 2KOUA 2UUBE 4GZNC 3EPHA 2EM5A 1I94E 3HXLA 3DF6A 1SFEA 1AAYA 1UHZA 1IMUA 3BBGA 2YZTA 2EMBA 4LFCE 2CSHA 2FGGA 2JYAA 5KL2A 4LF7E 2JWOA 2HJJA 1PJTA 2D9HA 1NCSA 5A6BA 3EPKA 4LU9A 3ADLA 2DLQA 3ZOQB 2N3GA 4JI8E 2EQ3A 3EPLA 2YRHA 3HPSA 2K4VA 4O24A 4P78A 5A6AA 2LJUA 4JV5E 1N36E 2V85A 3HTXA 4JI5E 2LO3A 4DMIA 4OOGC 1HNXE 2EZ6A 1QNTA 4BBYA 2EORA 2GLIA 5AASA 1IBLE 2KONA 2MC6A 1UN6B 2L33A 1Z1BA 2YT4A 3AV0A 5T6JA 2JOXA 4DR1E 3KWRA 2IHR1 2A25A 2EOXA 4LTYA 2LT7A 1FKAE 4DR5E 2EPZA 4KHPE 2EL4A 5ADZA 1A1LA 2B7VA 2V89A 2UXCE 4FK5C 2LE2A 2EOOA 2L2NA 4R03A 4R2AA 4DV7E 3TQMA 2V8QB 2YTJA 3HPZA 2JR1A 2ELYA 1F2IG 5A69A
chains in the Genus database with same CATH topology
4R2QA 2EMHA 2EL6A 2WBUA 2ENHA 5KL6A 2GHFA 1YUJA 2EM2A 2EMCA 1A1JA 2HGHA 2EMLA 2CT1A 4F2JC 1X3CA 4R2RA 5KL7A 2EM7A 5KL3A 2EPCA 4WSGA 2CTDA 2DGCA 2YTQA 2EMXA 1A1HA 1X6FA 2EPXA 1DGCA 1UBDC 1X6EA 2YTOA 4IS1C 2EN2A 2EM8A 2JP9A 2EMIA 2EOYA 4F6MA 3MHHC 2DLKA 2LCEA 2J7JA 2LVHA 1ZR9A 4F6NA 2YTFA 3M99B 1X5WA 4R2PA 2ENAA 4R2SA 2WCC3 2EMWA 2YTGA 2EM9A 2YU8A 2M9AA 4R2EA 2WBTA 2EOMA 4GZNC 3EPHA 2EM5A 2EN7A 2EOZA 2YTIA 1AAYA 1A1IA 2EOFA 2EN1A 2EMBA 2EPPA 2EN6A 2CSHA 1A1GA 2EMZA 1KJKA 2EPAA 2MKNA 2EPRA 2EQ1A 2EMFA 3MHSC 5KL2A 2YTPA 2ADRA 1ZU1A 2EOEA 4IJDA 2D9HA 1NCSA 2EL5A 2MDGA 2EMKA 3EPKA 2ELZA 2DLQA 2EPUA 2RSIA 2EOQA 1YSAC 1TN9A 4M9VC 5KL4A 2EQ3A 3EPLA 2YRHA 2EN3A 1BBOA 2EQ0A 2VRDA 2JPAA 2LV2A 2EOJA 2YTDA 2LO3A 2PRTA 5KL5A 2EOSA 1YUIA 2YRMA 2DRPA 1JK2A 1RMDA 2EORA 1B69A 1G2FC 2GLIA 2YTNA 2EN4A 2R1FA 2YSOA 2EN8A 1UN6B 1Z1BA 2YU5A 1TF3A 2EOIA 4X9JA 4R2CA 2EMAA 1MEYC 2ENCA 1ZAAC 2EM6A 2EP3A 2I13A 2YRKA 1LLMC 2A25A 1WJPA 2EOXA 2EOHA 2EJ4A 2YSPA 3EPJA 2EMGA 2EM0A 2LT7A 1TF6A 2WBSA 2BB8A 2EPZA 1JK1A 2EL4A 2MKDA 2YTEA 4R2DA 1A1LA 3UK3C 4FK5C 2EM4A 2RPCA 2NABA 2DMIA 2EOOA 1A1KA 1A1FA 4R2AA 2EE8A 3VHTB 1G2DC 2E72A 2YTJA 1X6HA 1P47A 1BB8A 2ELYA 2EMYA 1F2IG 2EM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R2Q A;  2EMH A;  2EL6 A;  2WBU A;  2ENH A;  5KL6 A;  2GHF A;  1YUJ A;  2EM2 A;  2EMC A;  1A1J A;  2HGH A;  2EML A;  2CT1 A;  4F2J C;  1X3C A;  4R2R A;  5KL7 A;  2EM7 A;  5KL3 A;  2EPC A;  4WSG A;  2CTD A;  2DGC A;  2YTQ A;  2EMX A;  1A1H A;  1X6F A;  2EPX A;  1DGC A;  1UBD C;  1X6E A;  2YTO A;  4IS1 C;  2EN2 A;  2EM8 A;  2JP9 A;  2EMI A;  2EOY A;  4F6M A;  3MHH C;  2DLK A;  2LCE A;  2J7J A;  2LVH A;  1ZR9 A;  4F6N A;  2YTF A;  3M99 B;  1X5W A;  4R2P A;  2ENA A;  4R2S A;  2WCC 3;  2EMW A;  2YTG A;  2EM9 A;  2YU8 A;  2M9A A;  4R2E A;  2WBT A;  2EOM A;  4GZN C;  3EPH A;  2EM5 A;  2EN7 A;  2EOZ A;  2YTI A;  1AAY A;  1A1I A;  2EOF A;  2EN1 A;  2EMB A;  2EPP A;  2EN6 A;  2CSH A;  1A1G A;  2EMZ A;  1KJK A;  2EPA A;  2MKN A;  2EPR A;  2EQ1 A;  2EMF A;  3MHS C;  5KL2 A;  2YTP A;  2ADR A;  1ZU1 A;  2EOE A;  4IJD A;  2D9H A;  1NCS A;  2EL5 A;  2MDG A;  2EMK A;  3EPK A;  2ELZ A;  2DLQ A;  2EPU A;  2RSI A;  2EOQ A;  1YSA C;  1TN9 A;  4M9V C;  5KL4 A;  2EQ3 A;  3EPL A;  2YRH A;  2EN3 A;  1BBO A;  2EQ0 A;  2VRD A;  2JPA A;  2LV2 A;  2EOJ A;  2YTD A;  2LO3 A;  2PRT A;  5KL5 A;  2EOS A;  1YUI A;  2YRM A;  2DRP A;  1JK2 A;  1RMD A;  2EOR A;  1B69 A;  1G2F C;  2GLI A;  2YTN A;  2EN4 A;  2R1F A;  2YSO A;  2EN8 A;  1UN6 B;  1Z1B A;  2YU5 A;  1TF3 A;  2EOI A;  4X9J A;  4R2C A;  2EMA A;  1MEY C;  2ENC A;  1ZAA C;  2EM6 A;  2EP3 A;  2I13 A;  2YRK A;  1LLM C;  2A25 A;  1WJP A;  2EOX A;  2EOH A;  2EJ4 A;  2YSP A;  3EPJ A;  2EMG A;  2EM0 A;  2LT7 A;  1TF6 A;  2WBS A;  2BB8 A;  2EPZ A;  1JK1 A;  2EL4 A;  2MKD A;  2YTE A;  4R2D A;  1A1L A;  3UK3 C;  4FK5 C;  2EM4 A;  2RPC A;  2NAB A;  2DMI A;  2EOO A;  1A1K A;  1A1F A;  4R2A A;  2EE8 A;  3VHT B;  1G2D C;  2E72 A;  2YTJ A;  1X6H A;  1P47 A;  1BB8 A;  2ELY A;  2EMY A;  1F2I G;  2EM3 A; 
#chains in the Genus database with same CATH topology
 5LL6 R;  3JU0 A;  2EMH A;  2EL6 A;  3JAM C;  3K6Q A;  2RQL A;  2ENH A;  2EM2 A;  4Q28 A;  1A1J A;  2V83 A;  2ODR D;  1XNR E;  4F2J C;  1GQE A;  5LMN E;  2UUA E;  2EPM X;  5KL7 A;  4ZYE A;  2EM7 A;  5KL3 A;  2DMY A;  2LRS A;  3P1X A;  3THN A;  4X66 E;  1UBD C;  2EM8 A;  2M1S A;  1AH5 A;  4O43 A;  1UIL A;  2J7J A;  2LVH A;  3OML A;  1ZR9 A;  1IQS A;  1X5W A;  2ENA A;  4J8Z A;  4R2S A;  2EM9 A;  1WHN A;  2I9I A;  2WBT A;  2EOM A;  4GKK E;  2EN7 A;  1ZBQ A;  1A1I A;  3IWD A;  1HNW E;  2EPA A;  2YTP A;  2ADR A;  2L92 A;  4ZYG A;  3L00 A;  1ZU1 A;  4IJD A;  2L3J A;  1QU6 A;  2EL5 A;  4WFT A;  5BR8 E;  1EH7 A;  2NA2 A;  4JI6 E;  2ELZ A;  2EPU A;  2RSI A;  4LFA E;  2BBG A;  3C4T A;  1YSA C;  4KZS A;  2YWQ A;  3J7A G;  2FV4 B;  2EQ0 A;  3VK6 A;  2V87 A;  4JYA E;  1NEI A;  2EOJ A;  2YTD A;  2EOS A;  2B7T A;  1YUI A;  2DRP A;  5A6K A;  4DV1 E;  1B69 A;  1G2F C;  4GKJ E;  1L4S A;  2EN4 A;  2R1F A;  2KHX A;  4BS9 A;  4WPY A;  2EOI A;  4X64 E;  4X9J A;  3T1H E;  4R2C A;  1MEY C;  4WXC A;  1ZBT A;  4LF4 E;  2YPN A;  5A2Q C;  3BGH A;  1PJQ A;  2I13 A;  1LLM C;  1WJP A;  4BCA A;  2WZO A;  1XNQ E;  2BB8 A;  4F54 A;  1JK1 A;  1FJG E;  2YTE A;  4R2D A;  4JI2 E;  3UK3 C;  4DUY E;  2FTX B;  2RPC A;  2VF1 A;  4YY3 E;  1A1K A;  5TSE A;  2DSY A;  2E72 A;  2GPI A;  1G2D C;  4LF8 E;  1X6H A;  2RTX A;  1MGT A;  4X62 E;  2EM3 A;  3J80 C;  4JI1 E;  2N3H A;  1EKZ A;  2L3C A;  2GHF A;  3LLH A;  4BMJ A;  1T4O A;  2L6M A;  2EMC A;  2HGH A;  4DR7 E;  2EPC A;  2CTD A;  2DGC A;  2EMX A;  1A1H A;  1X6F A;  2LBS B;  2YTO A;  2JP9 A;  1IBM E;  2L2M A;  2EOY A;  2EPN A;  2V88 A;  2LCE A;  2LTR A;  4F6N A;  2EPK X;  3M99 B;  1WHQ A;  4R2P A;  3FIG A;  2WCC 3;  4YHH E;  2LUQ A;  2YU8 A;  1DQ3 A;  1EH8 A;  4R2E A;  1YYW A;  4OX9 E;  2EPL X;  1HNZ E;  4DV0 E;  2EOZ A;  2YTI A;  2MC5 A;  4RHB B;  4F9A B;  5IV8 B;  3VYY A;  2EN1 A;  1YZ9 A;  2EN6 A;  3IWC A;  2EMZ A;  4Q35 B;  2LUP B;  2EPR A;  3MHS C;  3DJW A;  4DR6 E;  3QG5 C;  1DI2 A;  4F9B B;  2EOE A;  3H09 A;  2L2K B;  2CPN A;  2EOQ A;  1WXR A;  1TN9 A;  4M9V C;  5KL4 A;  3T1Y E;  2JVA A;  4JI4 E;  2EN3 A;  2LTS A;  2JY9 A;  4N4R B;  5AE3 A;  2M4I A;  2JPA A;  4TUI A;  4B3T E;  2ODR C;  3JTZ A;  2PRT A;  5KL5 A;  4DV5 E;  4RH8 A;  3ADG A;  5IXM B;  2NUE A;  4LF9 E;  2YRM A;  1T4L B;  4DR4 E;  1RMD A;  1HR0 E;  4LF5 E;  1KYQ A;  2YSO A;  2EN8 A;  4JI7 E;  3MSW A;  5IT9 C;  1IBK E;  2YU5 A;  1TF3 A;  1EH6 A;  4MLV A;  1X47 A;  2EMA A;  4DV6 E;  5LMU E;  2ENC A;  1YYK A;  4TUG A;  4ZYH A;  3BF2 A;  5AE2 A;  4MLQ A;  2EJ4 A;  3EPJ A;  5IWA E;  1T4N A;  2HHH E;  4M2Z A;  2MKD A;  5AE1 A;  4HTG A;  3VYX A;  1WRJ A;  2F4V E;  2NAB A;  2DMI A;  4NXM E;  3THO B;  3C6M A;  1P47 A;  2R76 A;  2M7Q A;  1A1G A;  4R2Q A;  4R8O A;  3F6G A;  2WBU A;  1XMQ E;  1T39 A;  3OTO E;  2EML A;  2UU9 E;  1J26 A;  1X3C A;  4R2R A;  4DUZ E;  2EPO A;  4BC7 A;  4WSG A;  2YTQ A;  1YYO A;  2LMZ A;  1X6E A;  2EN2 A;  2E5L E;  2EMI A;  4DKK A;  2HC5 A;  2ZM6 E;  4WSP A;  4F6M A;  4BHB A;  3MHH C;  2DLK A;  3J81 C;  2MDR A;  4BHC A;  4DV2 E;  2E1M A;  2K7I A;  4LF6 E;  1RQ0 A;  2M9A A;  3HQ1 A;  4DV3 E;  1STU A;  3LML A;  4L8N A;  1XMO E;  1N34 E;  4JI0 E;  4L5N C;  1N33 E;  3IWB A;  4P7D A;  2EOF A;  4AQY E;  2EPP A;  1KJK A;  3KZZ A;  2MKN A;  2EQ1 A;  2EMF A;  4DR2 E;  2UXB E;  5AC5 A;  5AC4 A;  2NUG A;  2MDG A;  5A6J A;  2EMK A;  3ECR A;  1PKP A;  1GZ6 A;  2N8X A;  3BID A;  1PDA A;  4HEI A;  2VQE E;  1BBO A;  2RSM A;  4NZV A;  4JI3 E;  2VRD A;  3ADJ A;  4O5G A;  4I8O A;  3C4B A;  4DR3 E;  2NUF A;  2LV2 A;  1YPN A;  2Q8U A;  1YFH A;  2JXP A;  4WYQ B;  4B3M E;  4B3R E;  1JK2 A;  2B3T B;  4NHR A;  2LJH A;  2VE7 C;  2YTN A;  4WXD A;  2VQF E;  3RMP A;  3KZY A;  5LLQ A;  5F3W A;  1N32 E;  4DV4 E;  4NXN E;  4O4K A;  1N3G A;  4BC9 A;  1ZAA C;  2EM6 A;  1PJS A;  2EP3 A;  2YRK A;  2DIX A;  1GTK A;  2YSP A;  2EOH A;  1TF6 A;  2EMG A;  2EM0 A;  2WBS A;  4WX9 A;  2F8B A;  2EM4 A;  1A1F A;  2EE8 A;  3VHT B;  3J7Y p;  2RS6 A;  1T38 A;  3EQ1 A;  1BB8 A;  1X48 A;  2EMY A;  5A6B D;  1IQO A;  1BBG A;  4F9C B;  1RC7 A;  1J5E E;  4GEQ B;  2H36 X;  2RS7 A;  5KL6 A;  1YUJ A;  5CFF E;  2B9D A;  5DNY A;  5FLX C;  1O0W A;  2CT1 A;  3C6K A;  4LFB E;  2UXD E;  4M0V A;  2EPX A;  4X8W A;  1DGC A;  3ADI A;  4IS1 C;  4K0K E;  3F6H A;  1SR9 A;  4KWY A;  4ZYD A;  4B3S E;  2JOB A;  2DB2 A;  3AUZ A;  2UUC E;  1X49 A;  2L8T A;  2YTF A;  4M30 A;  2G7H A;  2V86 A;  4X65 E;  2EMW A;  2YTG A;  2EWL A;  2KOU A;  2UUB E;  4GZN C;  3EPH A;  2EM5 A;  1I94 E;  3HXL A;  3DF6 A;  1SFE A;  1AAY A;  1UHZ A;  1IMU A;  3BBG A;  2YZT A;  2EMB A;  4LFC E;  2CSH A;  2FGG A;  2JYA A;  5KL2 A;  4LF7 E;  2JWO A;  2HJJ A;  1PJT A;  2D9H A;  1NCS A;  5A6B A;  3EPK A;  4LU9 A;  3ADL A;  2DLQ A;  3ZOQ B;  2N3G A;  4JI8 E;  2EQ3 A;  3EPL A;  2YRH A;  3HPS A;  2K4V A;  4O24 A;  4P78 A;  5A6A A;  2LJU A;  4JV5 E;  1N36 E;  2V85 A;  3HTX A;  4JI5 E;  2LO3 A;  4DMI A;  4OOG C;  1HNX E;  2EZ6 A;  1QNT A;  4BBY A;  2EOR A;  2GLI A;  5AAS A;  1IBL E;  2KON A;  2MC6 A;  1UN6 B;  2L33 A;  1Z1B A;  2YT4 A;  3AV0 A;  5T6J A;  2JOX A;  4DR1 E;  3KWR A;  2IHR 1;  2A25 A;  2EOX A;  4LTY A;  2LT7 A;  1FKA E;  4DR5 E;  2EPZ A;  4KHP E;  2EL4 A;  5ADZ A;  1A1L A;  2B7V A;  2V89 A;  2UXC E;  4FK5 C;  2LE2 A;  2EOO A;  2L2N A;  4R03 A;  4R2A A;  4DV7 E;  3TQM A;  2V8Q B;  2YTJ A;  3HPZ A;  2JR1 A;  2ELY A;  1F2I G;  5A69 A; 
#chains in the Genus database with same CATH homology
 4R2Q A;  2EMH A;  2EL6 A;  2WBU A;  2ENH A;  5KL6 A;  2GHF A;  1YUJ A;  2EM2 A;  2EMC A;  1A1J A;  2HGH A;  2EML A;  2CT1 A;  4F2J C;  1X3C A;  4R2R A;  5KL7 A;  2EM7 A;  5KL3 A;  2EPC A;  4WSG A;  2CTD A;  2DGC A;  2YTQ A;  2EMX A;  1A1H A;  1X6F A;  2EPX A;  1DGC A;  1UBD C;  1X6E A;  2YTO A;  4IS1 C;  2EN2 A;  2EM8 A;  2JP9 A;  2EMI A;  2EOY A;  4F6M A;  3MHH C;  2DLK A;  2LCE A;  2J7J A;  2LVH A;  1ZR9 A;  4F6N A;  2YTF A;  3M99 B;  1X5W A;  4R2P A;  2ENA A;  4R2S A;  2WCC 3;  2EMW A;  2YTG A;  2EM9 A;  2YU8 A;  2M9A A;  4R2E A;  2WBT A;  2EOM A;  4GZN C;  3EPH A;  2EM5 A;  2EN7 A;  2EOZ A;  2YTI A;  1AAY A;  1A1I A;  2EOF A;  2EN1 A;  2EMB A;  2EPP A;  2EN6 A;  2CSH A;  1A1G A;  2EMZ A;  1KJK A;  2EPA A;  2MKN A;  2EPR A;  2EQ1 A;  2EMF A;  3MHS C;  5KL2 A;  2YTP A;  2ADR A;  1ZU1 A;  2EOE A;  4IJD A;  2D9H A;  1NCS A;  2EL5 A;  2MDG A;  2EMK A;  3EPK A;  2ELZ A;  2DLQ A;  2EPU A;  2RSI A;  2EOQ A;  1YSA C;  1TN9 A;  4M9V C;  5KL4 A;  2EQ3 A;  3EPL A;  2YRH A;  2EN3 A;  1BBO A;  2EQ0 A;  2VRD A;  2JPA A;  2LV2 A;  2EOJ A;  2YTD A;  2LO3 A;  2PRT A;  5KL5 A;  2EOS A;  1YUI A;  2YRM A;  2DRP A;  1JK2 A;  1RMD A;  2EOR A;  1B69 A;  1G2F C;  2GLI A;  2YTN A;  2EN4 A;  2R1F A;  2YSO A;  2EN8 A;  1UN6 B;  1Z1B A;  2YU5 A;  1TF3 A;  2EOI A;  4X9J A;  4R2C A;  2EMA A;  1MEY C;  2ENC A;  1ZAA C;  2EM6 A;  2EP3 A;  2I13 A;  2YRK A;  1LLM C;  2A25 A;  1WJP A;  2EOX A;  2EOH A;  2EJ4 A;  2YSP A;  3EPJ A;  2EMG A;  2EM0 A;  2LT7 A;  1TF6 A;  2WBS A;  2BB8 A;  2EPZ A;  1JK1 A;  2EL4 A;  2MKD A;  2YTE A;  4R2D A;  1A1L A;  3UK3 C;  4FK5 C;  2EM4 A;  2RPC A;  2NAB A;  2DMI A;  2EOO A;  1A1K A;  1A1F A;  4R2A A;  2EE8 A;  3VHT B;  1G2D C;  2E72 A;  2YTJ A;  1X6H A;  1P47 A;  1BB8 A;  2ELY A;  2EMY A;  1F2I G;  2EM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...