2YTFA

Solution structure of the c2h2 type zinc finger (region 607-639) of human zinc finger protein 268
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPFECSECQKAFNTKSNLIVHQRTHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 607-639) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 268
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ytfA01
3VHTB 5KL7A 1RMDA 5KL5A 1WJPA 4IJDA 1ZU1A 3MHSC 2EOMA 2CT1A 1MEYC 2A25A 2YTOA 2HGHA 4M9VC 2YTQA 1TN9A 2ELZA 2EM8A 2WBSA 1LLMC 2EPPA 2LVHA 1X6HA 2YTEA 2EOSA 2D9HA 2EM3A 2EM9A 2EMBA 2EN8A 2EOQA 1Z1BA 1A1IA 2MKNA 4R2SA 2YTIA 2EOIA 2YTNA 2I13A 2YRHA 2GLIA 1BB8A 2EQ0A 2ADRA 2EOZA 2EMCA 3EPLA 2YTJA 3M99B 1A1GA 2EMYA 2MKDA 4R2AA 2EPCA 2EE8A 1JK1A 2EMXA 4R2CA 4IS1C 2GHFA 2J7JA 2ENCA 2LCEA 4F6NA 2EOXA 2EM5A 2EL5A 2JP9A 2EMKA 5KL4A 2EN1A 2ENAA 1P47A 2LV2A 1X6EA 1F2IG 1A1FA 1ZR9A 2EM4A 2RPCA 2EPRA 1B69A 2EMHA 1X5WA 3EPKA 2EL4A 1G2DC 2EPAA 2EMFA 2DLQA 2YSPA 5KL6A 1JK2A 1YUIA 2DRPA 2YTFA 2VRDA 4R2QA 1AAYA 2EOYA 2LT7A 2EM2A 2EPZA 4FK5C 2M9AA 1KJKA 1UN6B 2EQ3A 2EMGA 2YTDA 1YUJA 2LO3A 2NABA 2RSIA 2CTDA 2EN4A 2EMIA 1YSAC 1G2FC 2DMIA 2EJ4A 1A1JA 2EOJA 2R1FA 4R2PA 2E72A 5KL3A 2EMWA 2YRKA 2DGCA 1A1HA 4F2JC 2YU8A 2EOFA 4GZNC 2EMZA 2EORA 2PRTA 2EPXA 2EOEA 2EMAA 2EN3A 2EP3A 1X6FA 1ZAAC 2WBUA 3EPHA 2EQ1A 2EN6A 2JPAA 2EM6A 1A1LA 3MHHC 2YRMA 2EN2A 4F6MA 2MDGA 2YTPA 4R2EA 1A1KA 1DGCA 2EMLA 2EOHA 2YU5A 2BB8A 4WSGA 2YTGA 1TF3A 2EM0A 2DLKA 2YSOA 4R2RA 2WCC3 1NCSA 2WBTA 2ELYA 3EPJA 2CSHA 4X9JA 2EPUA 2EOOA 2ENHA 2EN7A 2EL6A 1UBDC 5KL2A 1BBOA 2EM7A 1X3CA 3UK3C 4R2DA 1TF6A
chains in the Genus database with same CATH superfamily
4WFTA 1FKAE 3AV0A 1X47A 1GTKA 5A6KA 2EPKX 4RHBB 5A6BA 1IBME 2EWLA 4M2ZA 4DUYE 2A25A 3MSWA 5TSEA 4WSPA 1WHNA 2ELZA 2MC6A 5A6BD 2L3JA 2UUBE 1LLMC 2LVHA 2VQEE 1EKZA 2YTEA 1T4OA 4P78A 4B3RE 4JI3E 1IMUA 3K6QA 4R2SA 4DMIA 4K0KE 2YTIA 2YTNA 2YRHA 3HXLA 2ADRA 2EOZA 4LF9E 4HEIA 3EPLA 2UU9E 2ENCA 4M30A 2B9DA 4O4KA 2EN1A 4DUZE 2LV2A 4DR2E 3LMLA 2EPRA 3IWBA 1G2DC 1YYOA 1X48A 1JK2A 2K7IA 1KYQA 4R2QA 2VRDA 1AAYA 4LF6E 2LT7A 1PKPA 2EM2A 5AC5A 2M9AA 1UN6B 2EQ3A 2EPNA 1XNRE 5FLXC 3THNA 2EPLX 2NABA 5IV8B 2CTDA 2L33A 1WXRA 5A2QC 4DR7E 2MC5A 2WZOA 2CPNA 4DR5E 1PJSA 3ZOQB 5KL3A 2EMWA 1HNZE 4DV6E 5A69A 2KHXA 5ADZA 2EMZA 1XMOE 2EOEA 2EMAA 1X6FA 2WBUA 2JPAA 1A1LA 1NEIA 3MHHC 2N8XA 2NUEA 2YWQA 2MDGA 4BBYA 1YPNA 4ZYDA 2K4VA 2LJHA 1HNWE 2JXPA 4WSGA 2BB8A 2YTGA 4JV5E 2IHR1 2NUGA 1BBGA 1NCSA 3EPJA 2LBSB 4X9JA 1N3GA 4BCAA 3OMLA 2V86A 2YPNA 1UHZA 5KL2A 1UBDC 2EZ6A 1IBKE 5LLQA 4R2DA 4HTGA 5AE1A 5AE2A 4R8OA 4GKKE 4IJDA 4TUGA 3JU0A 3H09A 1MEYC 4M9VC 2YTQA 2UUAE 1XMQE 1SR9A 5CFFE 1I94E 2N3GA 4LTYA 2N3HA 2EPPA 1UILA 2L2MA 4BMJA 1J5EE 3EQ1A 3ECRA 1ZBQA 2V85A 3KWRA 4JI1E 2LTRA 1PJTA 2EN8A 4N4RB 1FJGE 1SFEA 3JAMC 2F8BA 4ZYGA 5IT9C 5IWAE 2EQ0A 4F9AB 2MKDA 4DV1E 4O5GA 4LU9A 5BR8E 4DR3E 4AQYE 1ZBTA 4OOGC 1IBLE 1YYWA 1STUA 2NUFA 2JOXA 2ENAA 1X6EA 2G7HA 1A1FA 2B3TB 1B69A 2V83A 2EMHA 1X5WA 2LUPB 2EL4A 3ADLA 5IXMB 2RS7A 1N32E 2BBGA 2YSPA 3HTXA 2DRPA 3TQMA 2EOYA 3KZZA 4X62E 4RH8A 4JI5E 4R03A 2RQLA 2LRSA 1YUJA 2L8TA 5LL6R 2JYAA 5F3WA 4BC9A 1G2FC 3AUZA 1YZ9A 1A1JA 2EOJA 2R1FA 2RSMA 3BBGA 4O24A 4DR1E 4BC7A 1X49A 2DSYA 2DGCA 2UXCE 1EH7A 2HJJA 4GZNC 5A6JA 2VQFE 4Q28A 2E5LE 4JI8E 2DMYA 1WRJA 4JI4E 2EN2A 4F6MA 2JY9A 4R2EA 1AH5A 2YTPA 3C4TA 3ADJA 4ZYHA 5AE3A 3BGHA 4GKJE 4OX9E 3ADGA 2YU5A 3HPSA 2EM0A 4F9CB 2DLKA 2YSOA 4R2RA 4KWYA 2M7QA 2EOOA 2EPUA 2YZTA 3C6KA 1T4NA 3BIDA 3FIGA 2EPOA 2MDRA 3ADIA 1X3CA 3UK3C 4DR6E 4F9BB 1RQ0A 1RMDA 1ZU1A 2EOMA 2I9IA 2HGHA 2LUQA 1TN9A 5LMUE 2EM8A 3HQ1A 4WXCA 4JI6E 2WBSA 4LF7E 1X6HA 1MGTA 2L92A 4L8NA 5T6JA 2M4IA 3LLHA 2EMBA 1Z1BA 2EOQA 4JYAE 4KZSA 4KHPE 5LMNE 2R76A 2L2NA 3IWCA 1QU6A 4J8ZA 1BB8A 2JWOA 2EMCA 2LTSA 1N36E 1HNXE 2EMXA 4R2CA 4IS1C 2GHFA 4JI2E 1EH8A 5DNYA 3VK6A 2LCEA 2GPIA 4L5NC 2EOXA 2EL5A 4P7DA 2JP9A 4ZYEA 2KOUA 4DV4E 4NHRA 1P47A 1F2IG 1ZR9A 2HHHE 2FV4B 5AASA 3EPKA 4BS9A 2ZM6E 2EPMX 1DQ3A 4B3SE 2DLQA 4LFCE 2V88A 4YY3E 4BHBA 3J80C 2YTFA 1IQSA 2NA2A 3J81C 4FK5C 2V87A 4BHCA 1KJKA 4X65E 2EN4A 1YSAC 2JOBA 2EJ4A 4WYQB 4X66E 3VYYA 3THOB 3J7Yp 2B7TA 2E1MA 2ODRD 2F4VE 2EOFA 4DR4E 2PRTA 2EPXA 4X8WA 4B3TE 2EN3A 1IQOA 1T38A 2EP3A 3EPHA 1ZAAC 2EQ1A 2EN6A 4NXME 4DKKA 1QNTA 1YYKA 1T4LB 4JI0E 1A1KA 1DI2A 1DGCA 3F6HA 2EOHA 4GEQB 1N34E 3T1YE 2CSHA 2ENHA 1RC7A 2EN7A 2ODRC 4B3ME 2L6MA 1WHQA 3JTZA 4I8OA 4DV5E 2EM7A 2L2KB 1TF6A 4YHHE 3VHTB 5KL7A 4LFBE 2RTXA 5KL5A 4WX9A 4LF4E 1WJPA 3MHSC 4JI7E 2CT1A 3VYXA 3C4BA 1YFHA 4MLVA 2YTOA 4Q35B 2B7VA 4NZVA 2EOSA 2D9HA 2EM3A 2EM9A 2V8QB 1A1IA 1N33E 2MKNA 1HR0E 2YT4A 2EOIA 2UXBE 3RMPA 2I13A 2GLIA 3KZYA 3T1HE 5AC4A 2YTJA 1EH6A 3M99B 1A1GA 3DJWA 4TUIA 2EMYA 4R2AA 3C6MA 2EPCA 2EE8A 1JK1A 3DF6A 2J7JA 4MLQA 5A6AA 4F6NA 2EM5A 2EMKA 5KL4A 2RPCA 2EM4A 2EPAA 2EMFA 4O43A 3IWDA 1GQEA 2RS6A 5KL6A 2FGGA 1YUIA 2UUCE 1T39A 2UXDE 2EPZA 3F6GA 2L3CA 1PDAA 2EMGA 2LE2A 2YTDA 2DB2A 4DV2E 2LO3A 4LF5E 2RSIA 2EMIA 2FTXB 4DV3E 4DV7E 4LF8E 2DMIA 1GZ6A 1O0WA 2KONA 4R2PA 2E72A 2M1SA 4WXDA 2H36X 2YRKA 1PJQA 1A1HA 2LMZA 2YU8A 3P1XA 4F2JC 2VE7C 4M0VA 4WPYA 2EORA 2EM6A 2YRMA 3OTOE 4DV0E 2LJUA 3QG5C 3BF2A 2DIXA 4F54A 1XNQE 3HPZA 2EMLA 3J7AG 2JVAA 1TF3A 1J26A 4X64E 2WCC3 2WBTA 2ELYA 1L4SA 2VF1A 2EL6A 4LFAE 2JR1A 1BBOA 4NXNE 2Q8UA 3L00A 2V89A 2HC5A
chains in the Genus database with same CATH topology
3VHTB 5KL7A 1RMDA 5KL5A 1WJPA 4IJDA 1ZU1A 3MHSC 2EOMA 2CT1A 1MEYC 2A25A 2YTOA 2HGHA 4M9VC 2YTQA 1TN9A 2ELZA 2EM8A 2WBSA 1LLMC 2EPPA 2LVHA 1X6HA 2YTEA 2EOSA 2D9HA 2EM3A 2EM9A 2EMBA 2EN8A 2EOQA 1Z1BA 1A1IA 2MKNA 4R2SA 2YTIA 2EOIA 2YTNA 2I13A 2YRHA 2GLIA 1BB8A 2EQ0A 2ADRA 2EOZA 2EMCA 3EPLA 2YTJA 3M99B 1A1GA 2EMYA 2MKDA 4R2AA 2EPCA 2EE8A 1JK1A 2EMXA 4R2CA 4IS1C 2GHFA 2J7JA 2ENCA 2LCEA 4F6NA 2EOXA 2EM5A 2EL5A 2JP9A 2EMKA 5KL4A 2EN1A 2ENAA 1P47A 2LV2A 1X6EA 1F2IG 1A1FA 1ZR9A 2EM4A 2RPCA 2EPRA 1B69A 2EMHA 1X5WA 3EPKA 2EL4A 1G2DC 2EPAA 2EMFA 2DLQA 2YSPA 5KL6A 1JK2A 1YUIA 2DRPA 2YTFA 2VRDA 4R2QA 1AAYA 2EOYA 2LT7A 2EM2A 2EPZA 4FK5C 2M9AA 1KJKA 1UN6B 2EQ3A 2EMGA 2YTDA 1YUJA 2LO3A 2NABA 2RSIA 2CTDA 2EN4A 2EMIA 1YSAC 1G2FC 2DMIA 2EJ4A 1A1JA 2EOJA 2R1FA 4R2PA 2E72A 5KL3A 2EMWA 2YRKA 2DGCA 1A1HA 4F2JC 2YU8A 2EOFA 4GZNC 2EMZA 2EORA 2PRTA 2EPXA 2EOEA 2EMAA 2EN3A 2EP3A 1X6FA 1ZAAC 2WBUA 3EPHA 2EQ1A 2EN6A 2JPAA 2EM6A 1A1LA 3MHHC 2YRMA 2EN2A 4F6MA 2MDGA 2YTPA 4R2EA 1A1KA 1DGCA 2EMLA 2EOHA 2YU5A 2BB8A 4WSGA 2YTGA 1TF3A 2EM0A 2DLKA 2YSOA 4R2RA 2WCC3 1NCSA 2WBTA 2ELYA 3EPJA 2CSHA 4X9JA 2EPUA 2EOOA 2ENHA 2EN7A 2EL6A 1UBDC 5KL2A 1BBOA 2EM7A 1X3CA 3UK3C 4R2DA 1TF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VHT B;  5KL7 A;  1RMD A;  5KL5 A;  1WJP A;  4IJD A;  1ZU1 A;  3MHS C;  2EOM A;  2CT1 A;  1MEY C;  2A25 A;  2YTO A;  2HGH A;  4M9V C;  2YTQ A;  1TN9 A;  2ELZ A;  2EM8 A;  2WBS A;  1LLM C;  2EPP A;  2LVH A;  1X6H A;  2YTE A;  2EOS A;  2D9H A;  2EM3 A;  2EM9 A;  2EMB A;  2EN8 A;  2EOQ A;  1Z1B A;  1A1I A;  2MKN A;  4R2S A;  2YTI A;  2EOI A;  2YTN A;  2I13 A;  2YRH A;  2GLI A;  1BB8 A;  2EQ0 A;  2ADR A;  2EOZ A;  2EMC A;  3EPL A;  2YTJ A;  3M99 B;  1A1G A;  2EMY A;  2MKD A;  4R2A A;  2EPC A;  2EE8 A;  1JK1 A;  2EMX A;  4R2C A;  4IS1 C;  2GHF A;  2J7J A;  2ENC A;  2LCE A;  4F6N A;  2EOX A;  2EM5 A;  2EL5 A;  2JP9 A;  2EMK A;  5KL4 A;  2EN1 A;  2ENA A;  1P47 A;  2LV2 A;  1X6E A;  1F2I G;  1A1F A;  1ZR9 A;  2EM4 A;  2RPC A;  2EPR A;  1B69 A;  2EMH A;  1X5W A;  3EPK A;  2EL4 A;  1G2D C;  2EPA A;  2EMF A;  2DLQ A;  2YSP A;  5KL6 A;  1JK2 A;  1YUI A;  2DRP A;  2YTF A;  2VRD A;  4R2Q A;  1AAY A;  2EOY A;  2LT7 A;  2EM2 A;  2EPZ A;  4FK5 C;  2M9A A;  1KJK A;  1UN6 B;  2EQ3 A;  2EMG A;  2YTD A;  1YUJ A;  2LO3 A;  2NAB A;  2RSI A;  2CTD A;  2EN4 A;  2EMI A;  1YSA C;  1G2F C;  2DMI A;  2EJ4 A;  1A1J A;  2EOJ A;  2R1F A;  4R2P A;  2E72 A;  5KL3 A;  2EMW A;  2YRK A;  2DGC A;  1A1H A;  4F2J C;  2YU8 A;  2EOF A;  4GZN C;  2EMZ A;  2EOR A;  2PRT A;  2EPX A;  2EOE A;  2EMA A;  2EN3 A;  2EP3 A;  1X6F A;  1ZAA C;  2WBU A;  3EPH A;  2EQ1 A;  2EN6 A;  2JPA A;  2EM6 A;  1A1L A;  3MHH C;  2YRM A;  2EN2 A;  4F6M A;  2MDG A;  2YTP A;  4R2E A;  1A1K A;  1DGC A;  2EML A;  2EOH A;  2YU5 A;  2BB8 A;  4WSG A;  2YTG A;  1TF3 A;  2EM0 A;  2DLK A;  2YSO A;  4R2R A;  2WCC 3;  1NCS A;  2WBT A;  2ELY A;  3EPJ A;  2CSH A;  4X9J A;  2EPU A;  2EOO A;  2ENH A;  2EN7 A;  2EL6 A;  1UBD C;  5KL2 A;  1BBO A;  2EM7 A;  1X3C A;  3UK3 C;  4R2D A;  1TF6 A; 
#chains in the Genus database with same CATH topology
 4WFT A;  1FKA E;  3AV0 A;  1X47 A;  1GTK A;  5A6K A;  2EPK X;  4RHB B;  5A6B A;  1IBM E;  2EWL A;  4M2Z A;  4DUY E;  2A25 A;  3MSW A;  5TSE A;  4WSP A;  1WHN A;  2ELZ A;  2MC6 A;  5A6B D;  2L3J A;  2UUB E;  1LLM C;  2LVH A;  2VQE E;  1EKZ A;  2YTE A;  1T4O A;  4P78 A;  4B3R E;  4JI3 E;  1IMU A;  3K6Q A;  4R2S A;  4DMI A;  4K0K E;  2YTI A;  2YTN A;  2YRH A;  3HXL A;  2ADR A;  2EOZ A;  4LF9 E;  4HEI A;  3EPL A;  2UU9 E;  2ENC A;  4M30 A;  2B9D A;  4O4K A;  2EN1 A;  4DUZ E;  2LV2 A;  4DR2 E;  3LML A;  2EPR A;  3IWB A;  1G2D C;  1YYO A;  1X48 A;  1JK2 A;  2K7I A;  1KYQ A;  4R2Q A;  2VRD A;  1AAY A;  4LF6 E;  2LT7 A;  1PKP A;  2EM2 A;  5AC5 A;  2M9A A;  1UN6 B;  2EQ3 A;  2EPN A;  1XNR E;  5FLX C;  3THN A;  2EPL X;  2NAB A;  5IV8 B;  2CTD A;  2L33 A;  1WXR A;  5A2Q C;  4DR7 E;  2MC5 A;  2WZO A;  2CPN A;  4DR5 E;  1PJS A;  3ZOQ B;  5KL3 A;  2EMW A;  1HNZ E;  4DV6 E;  5A69 A;  2KHX A;  5ADZ A;  2EMZ A;  1XMO E;  2EOE A;  2EMA A;  1X6F A;  2WBU A;  2JPA A;  1A1L A;  1NEI A;  3MHH C;  2N8X A;  2NUE A;  2YWQ A;  2MDG A;  4BBY A;  1YPN A;  4ZYD A;  2K4V A;  2LJH A;  1HNW E;  2JXP A;  4WSG A;  2BB8 A;  2YTG A;  4JV5 E;  2IHR 1;  2NUG A;  1BBG A;  1NCS A;  3EPJ A;  2LBS B;  4X9J A;  1N3G A;  4BCA A;  3OML A;  2V86 A;  2YPN A;  1UHZ A;  5KL2 A;  1UBD C;  2EZ6 A;  1IBK E;  5LLQ A;  4R2D A;  4HTG A;  5AE1 A;  5AE2 A;  4R8O A;  4GKK E;  4IJD A;  4TUG A;  3JU0 A;  3H09 A;  1MEY C;  4M9V C;  2YTQ A;  2UUA E;  1XMQ E;  1SR9 A;  5CFF E;  1I94 E;  2N3G A;  4LTY A;  2N3H A;  2EPP A;  1UIL A;  2L2M A;  4BMJ A;  1J5E E;  3EQ1 A;  3ECR A;  1ZBQ A;  2V85 A;  3KWR A;  4JI1 E;  2LTR A;  1PJT A;  2EN8 A;  4N4R B;  1FJG E;  1SFE A;  3JAM C;  2F8B A;  4ZYG A;  5IT9 C;  5IWA E;  2EQ0 A;  4F9A B;  2MKD A;  4DV1 E;  4O5G A;  4LU9 A;  5BR8 E;  4DR3 E;  4AQY E;  1ZBT A;  4OOG C;  1IBL E;  1YYW A;  1STU A;  2NUF A;  2JOX A;  2ENA A;  1X6E A;  2G7H A;  1A1F A;  2B3T B;  1B69 A;  2V83 A;  2EMH A;  1X5W A;  2LUP B;  2EL4 A;  3ADL A;  5IXM B;  2RS7 A;  1N32 E;  2BBG A;  2YSP A;  3HTX A;  2DRP A;  3TQM A;  2EOY A;  3KZZ A;  4X62 E;  4RH8 A;  4JI5 E;  4R03 A;  2RQL A;  2LRS A;  1YUJ A;  2L8T A;  5LL6 R;  2JYA A;  5F3W A;  4BC9 A;  1G2F C;  3AUZ A;  1YZ9 A;  1A1J A;  2EOJ A;  2R1F A;  2RSM A;  3BBG A;  4O24 A;  4DR1 E;  4BC7 A;  1X49 A;  2DSY A;  2DGC A;  2UXC E;  1EH7 A;  2HJJ A;  4GZN C;  5A6J A;  2VQF E;  4Q28 A;  2E5L E;  4JI8 E;  2DMY A;  1WRJ A;  4JI4 E;  2EN2 A;  4F6M A;  2JY9 A;  4R2E A;  1AH5 A;  2YTP A;  3C4T A;  3ADJ A;  4ZYH A;  5AE3 A;  3BGH A;  4GKJ E;  4OX9 E;  3ADG A;  2YU5 A;  3HPS A;  2EM0 A;  4F9C B;  2DLK A;  2YSO A;  4R2R A;  4KWY A;  2M7Q A;  2EOO A;  2EPU A;  2YZT A;  3C6K A;  1T4N A;  3BID A;  3FIG A;  2EPO A;  2MDR A;  3ADI A;  1X3C A;  3UK3 C;  4DR6 E;  4F9B B;  1RQ0 A;  1RMD A;  1ZU1 A;  2EOM A;  2I9I A;  2HGH A;  2LUQ A;  1TN9 A;  5LMU E;  2EM8 A;  3HQ1 A;  4WXC A;  4JI6 E;  2WBS A;  4LF7 E;  1X6H A;  1MGT A;  2L92 A;  4L8N A;  5T6J A;  2M4I A;  3LLH A;  2EMB A;  1Z1B A;  2EOQ A;  4JYA E;  4KZS A;  4KHP E;  5LMN E;  2R76 A;  2L2N A;  3IWC A;  1QU6 A;  4J8Z A;  1BB8 A;  2JWO A;  2EMC A;  2LTS A;  1N36 E;  1HNX E;  2EMX A;  4R2C A;  4IS1 C;  2GHF A;  4JI2 E;  1EH8 A;  5DNY A;  3VK6 A;  2LCE A;  2GPI A;  4L5N C;  2EOX A;  2EL5 A;  4P7D A;  2JP9 A;  4ZYE A;  2KOU A;  4DV4 E;  4NHR A;  1P47 A;  1F2I G;  1ZR9 A;  2HHH E;  2FV4 B;  5AAS A;  3EPK A;  4BS9 A;  2ZM6 E;  2EPM X;  1DQ3 A;  4B3S E;  2DLQ A;  4LFC E;  2V88 A;  4YY3 E;  4BHB A;  3J80 C;  2YTF A;  1IQS A;  2NA2 A;  3J81 C;  4FK5 C;  2V87 A;  4BHC A;  1KJK A;  4X65 E;  2EN4 A;  1YSA C;  2JOB A;  2EJ4 A;  4WYQ B;  4X66 E;  3VYY A;  3THO B;  3J7Y p;  2B7T A;  2E1M A;  2ODR D;  2F4V E;  2EOF A;  4DR4 E;  2PRT A;  2EPX A;  4X8W A;  4B3T E;  2EN3 A;  1IQO A;  1T38 A;  2EP3 A;  3EPH A;  1ZAA C;  2EQ1 A;  2EN6 A;  4NXM E;  4DKK A;  1QNT A;  1YYK A;  1T4L B;  4JI0 E;  1A1K A;  1DI2 A;  1DGC A;  3F6H A;  2EOH A;  4GEQ B;  1N34 E;  3T1Y E;  2CSH A;  2ENH A;  1RC7 A;  2EN7 A;  2ODR C;  4B3M E;  2L6M A;  1WHQ A;  3JTZ A;  4I8O A;  4DV5 E;  2EM7 A;  2L2K B;  1TF6 A;  4YHH E;  3VHT B;  5KL7 A;  4LFB E;  2RTX A;  5KL5 A;  4WX9 A;  4LF4 E;  1WJP A;  3MHS C;  4JI7 E;  2CT1 A;  3VYX A;  3C4B A;  1YFH A;  4MLV A;  2YTO A;  4Q35 B;  2B7V A;  4NZV A;  2EOS A;  2D9H A;  2EM3 A;  2EM9 A;  2V8Q B;  1A1I A;  1N33 E;  2MKN A;  1HR0 E;  2YT4 A;  2EOI A;  2UXB E;  3RMP A;  2I13 A;  2GLI A;  3KZY A;  3T1H E;  5AC4 A;  2YTJ A;  1EH6 A;  3M99 B;  1A1G A;  3DJW A;  4TUI A;  2EMY A;  4R2A A;  3C6M A;  2EPC A;  2EE8 A;  1JK1 A;  3DF6 A;  2J7J A;  4MLQ A;  5A6A A;  4F6N A;  2EM5 A;  2EMK A;  5KL4 A;  2RPC A;  2EM4 A;  2EPA A;  2EMF A;  4O43 A;  3IWD A;  1GQE A;  2RS6 A;  5KL6 A;  2FGG A;  1YUI A;  2UUC E;  1T39 A;  2UXD E;  2EPZ A;  3F6G A;  2L3C A;  1PDA A;  2EMG A;  2LE2 A;  2YTD A;  2DB2 A;  4DV2 E;  2LO3 A;  4LF5 E;  2RSI A;  2EMI A;  2FTX B;  4DV3 E;  4DV7 E;  4LF8 E;  2DMI A;  1GZ6 A;  1O0W A;  2KON A;  4R2P A;  2E72 A;  2M1S A;  4WXD A;  2H36 X;  2YRK A;  1PJQ A;  1A1H A;  2LMZ A;  2YU8 A;  3P1X A;  4F2J C;  2VE7 C;  4M0V A;  4WPY A;  2EOR A;  2EM6 A;  2YRM A;  3OTO E;  4DV0 E;  2LJU A;  3QG5 C;  3BF2 A;  2DIX A;  4F54 A;  1XNQ E;  3HPZ A;  2EML A;  3J7A G;  2JVA A;  1TF3 A;  1J26 A;  4X64 E;  2WCC 3;  2WBT A;  2ELY A;  1L4S A;  2VF1 A;  2EL6 A;  4LFA E;  2JR1 A;  1BBO A;  4NXN E;  2Q8U A;  3L00 A;  2V89 A;  2HC5 A; 
#chains in the Genus database with same CATH homology
 3VHT B;  5KL7 A;  1RMD A;  5KL5 A;  1WJP A;  4IJD A;  1ZU1 A;  3MHS C;  2EOM A;  2CT1 A;  1MEY C;  2A25 A;  2YTO A;  2HGH A;  4M9V C;  2YTQ A;  1TN9 A;  2ELZ A;  2EM8 A;  2WBS A;  1LLM C;  2EPP A;  2LVH A;  1X6H A;  2YTE A;  2EOS A;  2D9H A;  2EM3 A;  2EM9 A;  2EMB A;  2EN8 A;  2EOQ A;  1Z1B A;  1A1I A;  2MKN A;  4R2S A;  2YTI A;  2EOI A;  2YTN A;  2I13 A;  2YRH A;  2GLI A;  1BB8 A;  2EQ0 A;  2ADR A;  2EOZ A;  2EMC A;  3EPL A;  2YTJ A;  3M99 B;  1A1G A;  2EMY A;  2MKD A;  4R2A A;  2EPC A;  2EE8 A;  1JK1 A;  2EMX A;  4R2C A;  4IS1 C;  2GHF A;  2J7J A;  2ENC A;  2LCE A;  4F6N A;  2EOX A;  2EM5 A;  2EL5 A;  2JP9 A;  2EMK A;  5KL4 A;  2EN1 A;  2ENA A;  1P47 A;  2LV2 A;  1X6E A;  1F2I G;  1A1F A;  1ZR9 A;  2EM4 A;  2RPC A;  2EPR A;  1B69 A;  2EMH A;  1X5W A;  3EPK A;  2EL4 A;  1G2D C;  2EPA A;  2EMF A;  2DLQ A;  2YSP A;  5KL6 A;  1JK2 A;  1YUI A;  2DRP A;  2YTF A;  2VRD A;  4R2Q A;  1AAY A;  2EOY A;  2LT7 A;  2EM2 A;  2EPZ A;  4FK5 C;  2M9A A;  1KJK A;  1UN6 B;  2EQ3 A;  2EMG A;  2YTD A;  1YUJ A;  2LO3 A;  2NAB A;  2RSI A;  2CTD A;  2EN4 A;  2EMI A;  1YSA C;  1G2F C;  2DMI A;  2EJ4 A;  1A1J A;  2EOJ A;  2R1F A;  4R2P A;  2E72 A;  5KL3 A;  2EMW A;  2YRK A;  2DGC A;  1A1H A;  4F2J C;  2YU8 A;  2EOF A;  4GZN C;  2EMZ A;  2EOR A;  2PRT A;  2EPX A;  2EOE A;  2EMA A;  2EN3 A;  2EP3 A;  1X6F A;  1ZAA C;  2WBU A;  3EPH A;  2EQ1 A;  2EN6 A;  2JPA A;  2EM6 A;  1A1L A;  3MHH C;  2YRM A;  2EN2 A;  4F6M A;  2MDG A;  2YTP A;  4R2E A;  1A1K A;  1DGC A;  2EML A;  2EOH A;  2YU5 A;  2BB8 A;  4WSG A;  2YTG A;  1TF3 A;  2EM0 A;  2DLK A;  2YSO A;  4R2R A;  2WCC 3;  1NCS A;  2WBT A;  2ELY A;  3EPJ A;  2CSH A;  4X9J A;  2EPU A;  2EOO A;  2ENH A;  2EN7 A;  2EL6 A;  1UBD C;  5KL2 A;  1BBO A;  2EM7 A;  1X3C A;  3UK3 C;  4R2D A;  1TF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...