2YTFA

Solution structure of the c2h2 type zinc finger (region 607-639) of human zinc finger protein 268
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPFECSECQKAFNTKSNLIVHQRTHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 268
publication title Solution structure of the C2H2 type zinc finger (region 607-639) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ytfA01
2CSHA 2LCEA 2YTJA 1UN6B 4R2PA 1A1FA 2EN7A 2R1FA 2EM7A 5KL2A 5KL5A 2EN8A 2EM6A 2EMBA 2EPRA 1A1GA 2EL5A 3MHSC 1YUIA 1X6FA 2LV2A 2YTNA 2GLIA 3EPKA 2I13A 2EOXA 2EM3A 4R2QA 2EM5A 2YRKA 2EPCA 4WSGA 5KL7A 2M9AA 1YSAC 2LVHA 2YRMA 2EORA 2EMXA 1F2IG 2YTOA 2EN4A 1RMDA 1G2FC 1WJPA 2EOIA 4F6MA 2E72A 2EPAA 2EN3A 4R2RA 1JK2A 4IJDA 2ENHA 2EMZA 2EPZA 1TN9A 1YUJA 4M9VC 2EM9A 2YTGA 2VRDA 1ZAAC 2YTIA 2EOQA 1A1JA 2WBSA 2EOFA 2JP9A 2EN1A 3M99B 1A1KA 2EMKA 2EM0A 2YTDA 2PRTA 2EOJA 5KL6A 1NCSA 2YU8A 2EMYA 3EPHA 1KJKA 1BBOA 1Z1BA 2YTEA 2EOHA 2EPUA 3VHTB 1TF6A 2DLKA 4R2AA 2MDGA 2BB8A 2YSPA 2EOYA 2DLQA 3EPJA 1B69A 2YTFA 2A25A 2EE8A 1MEYC 2RPCA 2GHFA 4F6NA 2ELYA 2EL4A 2EM4A 4F2JC 2EOEA 4FK5C 1X6HA 2DMIA 2ENCA 2YTPA 2EN2A 2EMGA 1UBDC 1ZR9A 1LLMC 2RSIA 1X5WA 2EJ4A 3UK3C 2EM2A 4IS1C 1JK1A 2CTDA 3MHHC 4R2CA 1BB8A 2ADRA 1X6EA 2EMCA 2DRPA 2EOZA 2EPPA 2YRHA 1G2DC 2EL6A 2YTQA 2EMWA 2D9HA 2EMFA 2EMIA 1TF3A 2JPAA 2WBUA 1A1LA 2HGHA 1A1IA 4X9JA 2EMLA 2EOSA 2MKNA 3EPLA 2EQ3A 2EOOA 2EQ1A 5KL3A 2MKDA 2DGCA 4GZNC 2WCC3 1A1HA 2EOMA 2CT1A 5KL4A 2LT7A 1AAYA 2EP3A 2EM8A 2EMHA 2LO3A 1DGCA 4R2DA 4R2EA 2EPXA 2WBTA 4R2SA 2NABA 2ELZA 2YSOA 1P47A 2J7JA 2EN6A 2YU5A 2EQ0A 1X3CA 1ZU1A 2EMAA 2ENAA
chains in the Genus database with same CATH superfamily
2LCEA 2YTJA 1WHNA 3BF2A 5DNYA 2V89A 1EKZA 1IMUA 2NUGA 5KL2A 2YWQA 1WHQA 4BHCA 3J7AG 2V87A 1GZ6A 2EMBA 4F54A 1A1GA 3MHSC 3OMLA 1X6FA 2LV2A 2YTNA 3EPKA 2EOXA 3HQ1A 2DMYA 4R2QA 4Q28A 1ZBQA 1N36E 3LLHA 2M1SA 2EPCA 2L2MA 2M9AA 5T6JA 4DR3E 3HTXA 2BBGA 2E1MA 4F9CB 2KONA 1UHZA 2EOIA 2UUAE 4R2RA 4MLVA 2V8QB 5AC4A 2EPZA 1TN9A 2YTGA 2YTIA 2EOQA 2EOFA 2JP9A 3H09A 1A1KA 2EMKA 2YTDA 1AH5A 5KL6A 1DI2A 3BGHA 1BBOA 2YTEA 2YPNA 5AE3A 1TF6A 2DLKA 4WXCA 2YSPA 3ADIA 2DLQA 3TQMA 5IXMB 4NXME 2RPCA 5A6JA 2ELYA 4O43A 4DMIA 1YYOA 2EOEA 2YTPA 2EMGA 4KZSA 2HC5A 4DR4E 2LJUA 1X5WA 4B3SE 5LLQA 4YY3E 4KHPE 2B3TB 4IS1C 4ZYDA 5A2QC 2YZTA 1WRJA 4R2CA 4WSPA 4F9AB 4YHHE 3BBGA 5LMUE 2EPNA 2EOZA 2ODRC 2EL6A 3IWBA 2YTQA 1XNQE 2EMWA 2D9HA 2EMFA 2WBUA 1EH8A 1A1LA 2UUBE 2HGHA 2MDRA 1A1IA 2H36X 5AE2A 2NA2A 5KL3A 2B9DA 5A6BD 1XMQE 2WCC3 4JI0E 1A1HA 1X48A 2V83A 4M30A 5KL4A 1AAYA 2LMZA 1HR0E 2EM8A 2E5LE 4P7DA 4K0KE 4R2SA 3T1HE 2R76A 2J7JA 3C6MA 2LTSA 2EN6A 1FKAE 3ECRA 2K4VA 1X3CA 2RQLA 2CSHA 4L8NA 4JI7E 2EN7A 2EM7A 2LUQA 1X47A 3AUZA 5KL5A 2V88A 2ODRD 1T4OA 1PJSA 2EPRA 2I13A 2EM3A 4X65E 4LTYA 4I8OA 3ZOQB 4WSGA 2LVHA 2YRMA 1GQEA 2RTXA 3ADGA 2YTOA 2G7HA 4F6MA 2E72A 1XNRE 2DB2A 1JK2A 2F8BA 4IJDA 2DIXA 2M4IA 5TSEA 1N3GA 4M9VC 2RS6A 2EM9A 2I9IA 2VRDA 4B3RE 2VQEE 3HPSA 4BCAA 4AQYE 4BS9A 2EN1A 2EM0A 4J8ZA 2EOJA 1GTKA 2YU8A 4R03A 1KJKA 4TUGA 4B3TE 1X49A 2V86A 3FIGA 4O4KA 4DUYE 3T1YE 4O5GA 3VHTB 4OX9E 4R2AA 4WFTA 2VF1A 4N4RB 2NUEA 4HTGA 2JXPA 3EPJA 1B69A 1J5EE 2A25A 4JI3E 2EL4A 3IWDA 2ENCA 4JI5E 4X66E 2HJJA 4DV6E 4L5NC 2RSIA 2EM2A 2CTDA 3MHHC 2ADRA 3HXLA 5IV8B 1X6EA 5IWAE 1EH6A 2EPPA 1PKPA 3KZZA 1HNWE 2VQFE 2EMLA 2EOSA 2MKNA 2EQ3A 3K6QA 4DV0E 2MKDA 1RC7A 1STUA 4GZNC 3OTOE 3ADJA 5A6BA 2LT7A 2EP3A 2KOUA 2EMHA 2EPMX 2JWOA 4JI2E 2LO3A 2UXCE 2WBTA 4JI8E 2FV4B 4DR6E 2YU5A 2EMAA 2ENAA 2L6MA 2JVAA 5A6AA 4DR5E 1A1FA 3JTZA 4RHBB 4WYQB 2FGGA 2L3JA 2EN8A 4B3ME 3C4BA 2EL5A 2L2NA 3P1XA 3F6HA 1YUIA 2GLIA 4DR2E 4LF9E 2DSYA 2L33A 4LF6E 1YSAC 1IBME 4DV3E 4JI1E 4LU9A 2NUFA 2EN4A 3THOB 1RMDA 2LBSB 3KWRA 4DR7E 1WJPA 4Q35B 3AV0A 2JY9A 4DV2E 2EN3A 2ENHA 4LF4E 2WZOA 3F6GA 4KWYA 1YUJA 5ADZA 4MLQA 1ZAAC 1YPNA 2N8XA 4NHRA 2EPOA 3M99B 1PJQA 2PRTA 4HEIA 2M7QA 1NCSA 3EPHA 2EMYA 4DUZE 1Z1BA 4X64E 3J80C 2EPUA 5BR8E 4DV5E 1HNXE 1IQOA 4X8WA 4GKJE 2V85A 2EOYA 3THNA 2GPIA 2CPNA 2YTFA 2IHR1 4WPYA 1MEYC 4F6NA 1NEIA 2EM4A 4FK5C 4P78A 2EN2A 2LUPB 1UBDC 1ZR9A 4NZVA 1LLMC 2EJ4A 3L00A 2L2KB 1JK1A 2L92A 1BB8A 1YYKA 2N3HA 2N3GA 2EMCA 2B7TA 2DRPA 5FLXC 1SR9A 1XMOE 1ZBTA 2JR1A 2EMIA 5CFFE 1KYQA 2RSMA 2JPAA 4ZYHA 4GKKE 2FTXB 4BC9A 2MC5A 1DQ3A 3VYYA 5A6KA 4DR1E 3LMLA 5IT9C 2JYAA 5AC5A 2YT4A 4ZYGA 5F3WA 2CT1A 4O24A 4LF7E 2K7IA 2VE7C 2UXDE 1YZ9A 1O0WA 1J26A 3MSWA 1DGCA 4R2DA 1PJTA 5LMNE 2ELZA 3C6KA 2JOBA 3VK6A 3EQ1A 1N33E 4R8OA 1UN6B 1YYWA 4R2PA 2EPLX 4BC7A 4DKKA 1RQ0A 2R1FA 4WX9A 5AASA 4WXDA 1T4LB 3BIDA 1EH7A 4JI4E 2EM6A 4BBYA 2KHXA 4DV1E 1HNZE 4JI6E 1IBLE 3QG5C 1IBKE 2EM5A 4LF5E 3KZYA 2YRKA 2EPKX 2LE2A 5AE1A 1BBGA 5KL7A 1T38A 2EORA 1N34E 2EMXA 2F4VE 1F2IG 4LFCE 2UUCE 1G2FC 3JU0A 2B7VA 3RMPA 2EPAA 1QNTA 2UXBE 1PDAA 3VYXA 2EMZA 2Q8UA 4DV4E 1SFEA 1YFHA 2LJHA 1WXRA 1A1JA 2L8TA 2WBSA 4NXNE 2LTRA 3DJWA 2EWLA 4OOGC 2EOHA 5LL6R 3IWCA 5A69A 2MDGA 2LRSA 2BB8A 2HHHE 2ZM6E 4BHBA 2RS7A 4JYAE 2EE8A 1FJGE 1T39A 2GHFA 4F2JC 1X6HA 2DMIA 1QU6A 1L4SA 2L3CA 2EZ6A 3UK3C 4DV7E 4LF8E 1UILA 4TUIA 4GEQB 2YRHA 1G2DC 1I94E 4LFAE 3J7Yp 1TF3A 1MGTA 4BMJA 2MC6A 4M0VA 4X9JA 2UU9E 4M2ZA 1IQSA 3EPLA 4LFBE 2EOOA 2EQ1A 3JAMC 2DGCA 4X62E 2JOXA 1N32E 1T4NA 2EOMA 3J81C 3ADLA 3C4TA 4F9BB 4ZYEA 4R2EA 4RH8A 2EPXA 3HPZA 2NABA 3DF6A 2YSOA 1P47A 2EQ0A 4JV5E 1ZU1A
chains in the Genus database with same CATH topology
2CSHA 2LCEA 2YTJA 1UN6B 4R2PA 1A1FA 2EN7A 2R1FA 2EM7A 5KL2A 5KL5A 2EN8A 2EM6A 2EMBA 2EPRA 1A1GA 2EL5A 3MHSC 1YUIA 1X6FA 2LV2A 2YTNA 2GLIA 3EPKA 2I13A 2EOXA 2EM3A 4R2QA 2EM5A 2YRKA 2EPCA 4WSGA 5KL7A 2M9AA 1YSAC 2LVHA 2YRMA 2EORA 2EMXA 1F2IG 2YTOA 2EN4A 1RMDA 1G2FC 1WJPA 2EOIA 4F6MA 2E72A 2EPAA 2EN3A 4R2RA 1JK2A 4IJDA 2ENHA 2EMZA 2EPZA 1TN9A 1YUJA 4M9VC 2EM9A 2YTGA 2VRDA 1ZAAC 2YTIA 2EOQA 1A1JA 2WBSA 2EOFA 2JP9A 2EN1A 3M99B 1A1KA 2EMKA 2EM0A 2YTDA 2PRTA 2EOJA 5KL6A 1NCSA 2YU8A 2EMYA 3EPHA 1KJKA 1BBOA 1Z1BA 2YTEA 2EOHA 2EPUA 3VHTB 1TF6A 2DLKA 4R2AA 2MDGA 2BB8A 2YSPA 2EOYA 2DLQA 3EPJA 1B69A 2YTFA 2A25A 2EE8A 1MEYC 2RPCA 2GHFA 4F6NA 2ELYA 2EL4A 2EM4A 4F2JC 2EOEA 4FK5C 1X6HA 2DMIA 2ENCA 2YTPA 2EN2A 2EMGA 1UBDC 1ZR9A 1LLMC 2RSIA 1X5WA 2EJ4A 3UK3C 2EM2A 4IS1C 1JK1A 2CTDA 3MHHC 4R2CA 1BB8A 2ADRA 1X6EA 2EMCA 2DRPA 2EOZA 2EPPA 2YRHA 1G2DC 2EL6A 2YTQA 2EMWA 2D9HA 2EMFA 2EMIA 1TF3A 2JPAA 2WBUA 1A1LA 2HGHA 1A1IA 4X9JA 2EMLA 2EOSA 2MKNA 3EPLA 2EQ3A 2EOOA 2EQ1A 5KL3A 2MKDA 2DGCA 4GZNC 2WCC3 1A1HA 2EOMA 2CT1A 5KL4A 2LT7A 1AAYA 2EP3A 2EM8A 2EMHA 2LO3A 1DGCA 4R2DA 4R2EA 2EPXA 2WBTA 4R2SA 2NABA 2ELZA 2YSOA 1P47A 2J7JA 2EN6A 2YU5A 2EQ0A 1X3CA 1ZU1A 2EMAA 2ENAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CSH A;  2LCE A;  2YTJ A;  1UN6 B;  4R2P A;  1A1F A;  2EN7 A;  2R1F A;  2EM7 A;  5KL2 A;  5KL5 A;  2EN8 A;  2EM6 A;  2EMB A;  2EPR A;  1A1G A;  2EL5 A;  3MHS C;  1YUI A;  1X6F A;  2LV2 A;  2YTN A;  2GLI A;  3EPK A;  2I13 A;  2EOX A;  2EM3 A;  4R2Q A;  2EM5 A;  2YRK A;  2EPC A;  4WSG A;  5KL7 A;  2M9A A;  1YSA C;  2LVH A;  2YRM A;  2EOR A;  2EMX A;  1F2I G;  2YTO A;  2EN4 A;  1RMD A;  1G2F C;  1WJP A;  2EOI A;  4F6M A;  2E72 A;  2EPA A;  2EN3 A;  4R2R A;  1JK2 A;  4IJD A;  2ENH A;  2EMZ A;  2EPZ A;  1TN9 A;  1YUJ A;  4M9V C;  2EM9 A;  2YTG A;  2VRD A;  1ZAA C;  2YTI A;  2EOQ A;  1A1J A;  2WBS A;  2EOF A;  2JP9 A;  2EN1 A;  3M99 B;  1A1K A;  2EMK A;  2EM0 A;  2YTD A;  2PRT A;  2EOJ A;  5KL6 A;  1NCS A;  2YU8 A;  2EMY A;  3EPH A;  1KJK A;  1BBO A;  1Z1B A;  2YTE A;  2EOH A;  2EPU A;  3VHT B;  1TF6 A;  2DLK A;  4R2A A;  2MDG A;  2BB8 A;  2YSP A;  2EOY A;  2DLQ A;  3EPJ A;  1B69 A;  2YTF A;  2A25 A;  2EE8 A;  1MEY C;  2RPC A;  2GHF A;  4F6N A;  2ELY A;  2EL4 A;  2EM4 A;  4F2J C;  2EOE A;  4FK5 C;  1X6H A;  2DMI A;  2ENC A;  2YTP A;  2EN2 A;  2EMG A;  1UBD C;  1ZR9 A;  1LLM C;  2RSI A;  1X5W A;  2EJ4 A;  3UK3 C;  2EM2 A;  4IS1 C;  1JK1 A;  2CTD A;  3MHH C;  4R2C A;  1BB8 A;  2ADR A;  1X6E A;  2EMC A;  2DRP A;  2EOZ A;  2EPP A;  2YRH A;  1G2D C;  2EL6 A;  2YTQ A;  2EMW A;  2D9H A;  2EMF A;  2EMI A;  1TF3 A;  2JPA A;  2WBU A;  1A1L A;  2HGH A;  1A1I A;  4X9J A;  2EML A;  2EOS A;  2MKN A;  3EPL A;  2EQ3 A;  2EOO A;  2EQ1 A;  5KL3 A;  2MKD A;  2DGC A;  4GZN C;  2WCC 3;  1A1H A;  2EOM A;  2CT1 A;  5KL4 A;  2LT7 A;  1AAY A;  2EP3 A;  2EM8 A;  2EMH A;  2LO3 A;  1DGC A;  4R2D A;  4R2E A;  2EPX A;  2WBT A;  4R2S A;  2NAB A;  2ELZ A;  2YSO A;  1P47 A;  2J7J A;  2EN6 A;  2YU5 A;  2EQ0 A;  1X3C A;  1ZU1 A;  2EMA A;  2ENA A; 
#chains in the Genus database with same CATH topology
 2LCE A;  2YTJ A;  1WHN A;  3BF2 A;  5DNY A;  2V89 A;  1EKZ A;  1IMU A;  2NUG A;  5KL2 A;  2YWQ A;  1WHQ A;  4BHC A;  3J7A G;  2V87 A;  1GZ6 A;  2EMB A;  4F54 A;  1A1G A;  3MHS C;  3OML A;  1X6F A;  2LV2 A;  2YTN A;  3EPK A;  2EOX A;  3HQ1 A;  2DMY A;  4R2Q A;  4Q28 A;  1ZBQ A;  1N36 E;  3LLH A;  2M1S A;  2EPC A;  2L2M A;  2M9A A;  5T6J A;  4DR3 E;  3HTX A;  2BBG A;  2E1M A;  4F9C B;  2KON A;  1UHZ A;  2EOI A;  2UUA E;  4R2R A;  4MLV A;  2V8Q B;  5AC4 A;  2EPZ A;  1TN9 A;  2YTG A;  2YTI A;  2EOQ A;  2EOF A;  2JP9 A;  3H09 A;  1A1K A;  2EMK A;  2YTD A;  1AH5 A;  5KL6 A;  1DI2 A;  3BGH A;  1BBO A;  2YTE A;  2YPN A;  5AE3 A;  1TF6 A;  2DLK A;  4WXC A;  2YSP A;  3ADI A;  2DLQ A;  3TQM A;  5IXM B;  4NXM E;  2RPC A;  5A6J A;  2ELY A;  4O43 A;  4DMI A;  1YYO A;  2EOE A;  2YTP A;  2EMG A;  4KZS A;  2HC5 A;  4DR4 E;  2LJU A;  1X5W A;  4B3S E;  5LLQ A;  4YY3 E;  4KHP E;  2B3T B;  4IS1 C;  4ZYD A;  5A2Q C;  2YZT A;  1WRJ A;  4R2C A;  4WSP A;  4F9A B;  4YHH E;  3BBG A;  5LMU E;  2EPN A;  2EOZ A;  2ODR C;  2EL6 A;  3IWB A;  2YTQ A;  1XNQ E;  2EMW A;  2D9H A;  2EMF A;  2WBU A;  1EH8 A;  1A1L A;  2UUB E;  2HGH A;  2MDR A;  1A1I A;  2H36 X;  5AE2 A;  2NA2 A;  5KL3 A;  2B9D A;  5A6B D;  1XMQ E;  2WCC 3;  4JI0 E;  1A1H A;  1X48 A;  2V83 A;  4M30 A;  5KL4 A;  1AAY A;  2LMZ A;  1HR0 E;  2EM8 A;  2E5L E;  4P7D A;  4K0K E;  4R2S A;  3T1H E;  2R76 A;  2J7J A;  3C6M A;  2LTS A;  2EN6 A;  1FKA E;  3ECR A;  2K4V A;  1X3C A;  2RQL A;  2CSH A;  4L8N A;  4JI7 E;  2EN7 A;  2EM7 A;  2LUQ A;  1X47 A;  3AUZ A;  5KL5 A;  2V88 A;  2ODR D;  1T4O A;  1PJS A;  2EPR A;  2I13 A;  2EM3 A;  4X65 E;  4LTY A;  4I8O A;  3ZOQ B;  4WSG A;  2LVH A;  2YRM A;  1GQE A;  2RTX A;  3ADG A;  2YTO A;  2G7H A;  4F6M A;  2E72 A;  1XNR E;  2DB2 A;  1JK2 A;  2F8B A;  4IJD A;  2DIX A;  2M4I A;  5TSE A;  1N3G A;  4M9V C;  2RS6 A;  2EM9 A;  2I9I A;  2VRD A;  4B3R E;  2VQE E;  3HPS A;  4BCA A;  4AQY E;  4BS9 A;  2EN1 A;  2EM0 A;  4J8Z A;  2EOJ A;  1GTK A;  2YU8 A;  4R03 A;  1KJK A;  4TUG A;  4B3T E;  1X49 A;  2V86 A;  3FIG A;  4O4K A;  4DUY E;  3T1Y E;  4O5G A;  3VHT B;  4OX9 E;  4R2A A;  4WFT A;  2VF1 A;  4N4R B;  2NUE A;  4HTG A;  2JXP A;  3EPJ A;  1B69 A;  1J5E E;  2A25 A;  4JI3 E;  2EL4 A;  3IWD A;  2ENC A;  4JI5 E;  4X66 E;  2HJJ A;  4DV6 E;  4L5N C;  2RSI A;  2EM2 A;  2CTD A;  3MHH C;  2ADR A;  3HXL A;  5IV8 B;  1X6E A;  5IWA E;  1EH6 A;  2EPP A;  1PKP A;  3KZZ A;  1HNW E;  2VQF E;  2EML A;  2EOS A;  2MKN A;  2EQ3 A;  3K6Q A;  4DV0 E;  2MKD A;  1RC7 A;  1STU A;  4GZN C;  3OTO E;  3ADJ A;  5A6B A;  2LT7 A;  2EP3 A;  2KOU A;  2EMH A;  2EPM X;  2JWO A;  4JI2 E;  2LO3 A;  2UXC E;  2WBT A;  4JI8 E;  2FV4 B;  4DR6 E;  2YU5 A;  2EMA A;  2ENA A;  2L6M A;  2JVA A;  5A6A A;  4DR5 E;  1A1F A;  3JTZ A;  4RHB B;  4WYQ B;  2FGG A;  2L3J A;  2EN8 A;  4B3M E;  3C4B A;  2EL5 A;  2L2N A;  3P1X A;  3F6H A;  1YUI A;  2GLI A;  4DR2 E;  4LF9 E;  2DSY A;  2L33 A;  4LF6 E;  1YSA C;  1IBM E;  4DV3 E;  4JI1 E;  4LU9 A;  2NUF A;  2EN4 A;  3THO B;  1RMD A;  2LBS B;  3KWR A;  4DR7 E;  1WJP A;  4Q35 B;  3AV0 A;  2JY9 A;  4DV2 E;  2EN3 A;  2ENH A;  4LF4 E;  2WZO A;  3F6G A;  4KWY A;  1YUJ A;  5ADZ A;  4MLQ A;  1ZAA C;  1YPN A;  2N8X A;  4NHR A;  2EPO A;  3M99 B;  1PJQ A;  2PRT A;  4HEI A;  2M7Q A;  1NCS A;  3EPH A;  2EMY A;  4DUZ E;  1Z1B A;  4X64 E;  3J80 C;  2EPU A;  5BR8 E;  4DV5 E;  1HNX E;  1IQO A;  4X8W A;  4GKJ E;  2V85 A;  2EOY A;  3THN A;  2GPI A;  2CPN A;  2YTF A;  2IHR 1;  4WPY A;  1MEY C;  4F6N A;  1NEI A;  2EM4 A;  4FK5 C;  4P78 A;  2EN2 A;  2LUP B;  1UBD C;  1ZR9 A;  4NZV A;  1LLM C;  2EJ4 A;  3L00 A;  2L2K B;  1JK1 A;  2L92 A;  1BB8 A;  1YYK A;  2N3H A;  2N3G A;  2EMC A;  2B7T A;  2DRP A;  5FLX C;  1SR9 A;  1XMO E;  1ZBT A;  2JR1 A;  2EMI A;  5CFF E;  1KYQ A;  2RSM A;  2JPA A;  4ZYH A;  4GKK E;  2FTX B;  4BC9 A;  2MC5 A;  1DQ3 A;  3VYY A;  5A6K A;  4DR1 E;  3LML A;  5IT9 C;  2JYA A;  5AC5 A;  2YT4 A;  4ZYG A;  5F3W A;  2CT1 A;  4O24 A;  4LF7 E;  2K7I A;  2VE7 C;  2UXD E;  1YZ9 A;  1O0W A;  1J26 A;  3MSW A;  1DGC A;  4R2D A;  1PJT A;  5LMN E;  2ELZ A;  3C6K A;  2JOB A;  3VK6 A;  3EQ1 A;  1N33 E;  4R8O A;  1UN6 B;  1YYW A;  4R2P A;  2EPL X;  4BC7 A;  4DKK A;  1RQ0 A;  2R1F A;  4WX9 A;  5AAS A;  4WXD A;  1T4L B;  3BID A;  1EH7 A;  4JI4 E;  2EM6 A;  4BBY A;  2KHX A;  4DV1 E;  1HNZ E;  4JI6 E;  1IBL E;  3QG5 C;  1IBK E;  2EM5 A;  4LF5 E;  3KZY A;  2YRK A;  2EPK X;  2LE2 A;  5AE1 A;  1BBG A;  5KL7 A;  1T38 A;  2EOR A;  1N34 E;  2EMX A;  2F4V E;  1F2I G;  4LFC E;  2UUC E;  1G2F C;  3JU0 A;  2B7V A;  3RMP A;  2EPA A;  1QNT A;  2UXB E;  1PDA A;  3VYX A;  2EMZ A;  2Q8U A;  4DV4 E;  1SFE A;  1YFH A;  2LJH A;  1WXR A;  1A1J A;  2L8T A;  2WBS A;  4NXN E;  2LTR A;  3DJW A;  2EWL A;  4OOG C;  2EOH A;  5LL6 R;  3IWC A;  5A69 A;  2MDG A;  2LRS A;  2BB8 A;  2HHH E;  2ZM6 E;  4BHB A;  2RS7 A;  4JYA E;  2EE8 A;  1FJG E;  1T39 A;  2GHF A;  4F2J C;  1X6H A;  2DMI A;  1QU6 A;  1L4S A;  2L3C A;  2EZ6 A;  3UK3 C;  4DV7 E;  4LF8 E;  1UIL A;  4TUI A;  4GEQ B;  2YRH A;  1G2D C;  1I94 E;  4LFA E;  3J7Y p;  1TF3 A;  1MGT A;  4BMJ A;  2MC6 A;  4M0V A;  4X9J A;  2UU9 E;  4M2Z A;  1IQS A;  3EPL A;  4LFB E;  2EOO A;  2EQ1 A;  3JAM C;  2DGC A;  4X62 E;  2JOX A;  1N32 E;  1T4N A;  2EOM A;  3J81 C;  3ADL A;  3C4T A;  4F9B B;  4ZYE A;  4R2E A;  4RH8 A;  2EPX A;  3HPZ A;  2NAB A;  3DF6 A;  2YSO A;  1P47 A;  2EQ0 A;  4JV5 E;  1ZU1 A; 
#chains in the Genus database with same CATH homology
 2CSH A;  2LCE A;  2YTJ A;  1UN6 B;  4R2P A;  1A1F A;  2EN7 A;  2R1F A;  2EM7 A;  5KL2 A;  5KL5 A;  2EN8 A;  2EM6 A;  2EMB A;  2EPR A;  1A1G A;  2EL5 A;  3MHS C;  1YUI A;  1X6F A;  2LV2 A;  2YTN A;  2GLI A;  3EPK A;  2I13 A;  2EOX A;  2EM3 A;  4R2Q A;  2EM5 A;  2YRK A;  2EPC A;  4WSG A;  5KL7 A;  2M9A A;  1YSA C;  2LVH A;  2YRM A;  2EOR A;  2EMX A;  1F2I G;  2YTO A;  2EN4 A;  1RMD A;  1G2F C;  1WJP A;  2EOI A;  4F6M A;  2E72 A;  2EPA A;  2EN3 A;  4R2R A;  1JK2 A;  4IJD A;  2ENH A;  2EMZ A;  2EPZ A;  1TN9 A;  1YUJ A;  4M9V C;  2EM9 A;  2YTG A;  2VRD A;  1ZAA C;  2YTI A;  2EOQ A;  1A1J A;  2WBS A;  2EOF A;  2JP9 A;  2EN1 A;  3M99 B;  1A1K A;  2EMK A;  2EM0 A;  2YTD A;  2PRT A;  2EOJ A;  5KL6 A;  1NCS A;  2YU8 A;  2EMY A;  3EPH A;  1KJK A;  1BBO A;  1Z1B A;  2YTE A;  2EOH A;  2EPU A;  3VHT B;  1TF6 A;  2DLK A;  4R2A A;  2MDG A;  2BB8 A;  2YSP A;  2EOY A;  2DLQ A;  3EPJ A;  1B69 A;  2YTF A;  2A25 A;  2EE8 A;  1MEY C;  2RPC A;  2GHF A;  4F6N A;  2ELY A;  2EL4 A;  2EM4 A;  4F2J C;  2EOE A;  4FK5 C;  1X6H A;  2DMI A;  2ENC A;  2YTP A;  2EN2 A;  2EMG A;  1UBD C;  1ZR9 A;  1LLM C;  2RSI A;  1X5W A;  2EJ4 A;  3UK3 C;  2EM2 A;  4IS1 C;  1JK1 A;  2CTD A;  3MHH C;  4R2C A;  1BB8 A;  2ADR A;  1X6E A;  2EMC A;  2DRP A;  2EOZ A;  2EPP A;  2YRH A;  1G2D C;  2EL6 A;  2YTQ A;  2EMW A;  2D9H A;  2EMF A;  2EMI A;  1TF3 A;  2JPA A;  2WBU A;  1A1L A;  2HGH A;  1A1I A;  4X9J A;  2EML A;  2EOS A;  2MKN A;  3EPL A;  2EQ3 A;  2EOO A;  2EQ1 A;  5KL3 A;  2MKD A;  2DGC A;  4GZN C;  2WCC 3;  1A1H A;  2EOM A;  2CT1 A;  5KL4 A;  2LT7 A;  1AAY A;  2EP3 A;  2EM8 A;  2EMH A;  2LO3 A;  1DGC A;  4R2D A;  4R2E A;  2EPX A;  2WBT A;  4R2S A;  2NAB A;  2ELZ A;  2YSO A;  1P47 A;  2J7J A;  2EN6 A;  2YU5 A;  2EQ0 A;  1X3C A;  1ZU1 A;  2EMA A;  2ENA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...