2YTFA

Solution structure of the c2h2 type zinc finger (region 607-639) of human zinc finger protein 268
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPFECSECQKAFNTKSNLIVHQRTHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 268
publication title Solution structure of the C2H2 type zinc finger (region 607-639) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ytfA01
4GZNC 2EOIA 2EOMA 2ENHA 1X5WA 2EN7A 2EMBA 2RSIA 2E72A 2YTEA 2EOHA 2YTFA 2YTGA 3MHHC 2EOFA 2JP9A 2EL4A 2EN8A 1ZAAC 3UK3C 2DLKA 1YUIA 2YRHA 2RPCA 2EM5A 2EPRA 2EM0A 1X6FA 4R2DA 2EOSA 2YSPA 1A1FA 2YTQA 2YU5A 2EPAA 4FK5C 2PRTA 1BBOA 2EM4A 3EPKA 1YSAC 1RMDA 2EP3A 2EMAA 2GLIA 1JK1A 5KL4A 3VHTB 3EPJA 1TN9A 2LV2A 1NCSA 2ENAA 2WCC3 1A1KA 1UBDC 4R2RA 2EQ3A 2M9AA 1A1HA 2EMLA 2EORA 2EPPA 2WBSA 2EPZA 2EM3A 2J7JA 5KL2A 2EN3A 2DMIA 2EOQA 3EPLA 1MEYC 2EM6A 2YU8A 2YRMA 1BB8A 2LCEA 2ADRA 1ZU1A 2EPUA 2I13A 2WBUA 2DGCA 5KL5A 2HGHA 1KJKA 2MKDA 2A25A 3EPHA 2EOXA 2YTNA 2YTIA 4M9VC 1A1IA 2YRKA 2EMKA 1AAYA 1TF3A 2LT7A 4IS1C 1A1LA 1DGCA 5KL3A 2EOJA 4F6MA 2YTJA 2EOZA 2EM7A 1X3CA 2NABA 2JPAA 3M99B 2EQ0A 4X9JA 4R2SA 2DLQA 1B69A 2DRPA 2EJ4A 2YTOA 4R2AA 2EMGA 2VRDA 5KL6A 1JK2A 1LLMC 2YSOA 2LO3A 2ELYA 2EN4A 1TF6A 2EPXA 1ZR9A 2EMHA 2MKNA 2EMIA 1YUJA 1X6EA 1P47A 4R2CA 2EN2A 2EMYA 4R2PA 2R1FA 1Z1BA 1G2FC 2WBTA 2YTDA 2ELZA 2GHFA 4R2QA 1WJPA 2ENCA 2CSHA 4IJDA 2LVHA 2YTPA 4F2JC 1A1GA 4R2EA 2EOEA 2EE8A 2EMWA 2EPCA 1G2DC 2EN6A 1A1JA 1F2IG 2EMCA 2EL5A 1UN6B 2BB8A 2EM8A 2EMFA 2EMXA 5KL7A 2CT1A 2EOOA 4F6NA 2CTDA 2EN1A 2EM9A 2EMZA 3MHSC 2D9HA 2EOYA 1X6HA 2EQ1A 2MDGA 2EL6A 2EM2A 4WSGA
chains in the Genus database with same CATH superfamily
4N4RB 5LL6R 4GZNC 2NUFA 3J7AG 1X47A 2EN7A 2VF1A 2EMBA 2LUQA 4DV6E 3F6HA 2YTFA 1UHZA 4OX9E 3MHHC 4DUYE 4KWYA 4X8WA 5AE2A 3IWCA 1T4LB 5IWAE 3ADLA 1YUIA 2YRHA 3VYYA 2EM5A 2EPRA 3C4BA 2EM0A 1X6FA 4R2DA 4JI0E 4WSPA 4DV5E 4KZSA 2EPAA 4FK5C 2EM4A 3EPKA 2EP3A 1YFHA 1JK1A 2JOBA 2MDRA 4B3ME 3QG5C 2UXDE 4WX9A 5F3WA 4DV2E 2YZTA 5FLXC 4M0VA 2DMIA 2EOQA 1MEYC 3BBGA 4JI5E 5BR8E 2L92A 2DIXA 2YU8A 2YRMA 2LRSA 2BBGA 4NXNE 1YYKA 2V85A 1NEIA 5A6AA 2WZOA 1GZ6A 4NHRA 4ZYHA 2L2MA 5ADZA 2JYAA 1MGTA 1FKAE 1A1IA 1AAYA 1DI2A 1A1LA 1DGCA 5KL3A 4F6MA 2YTJA 4DR5E 5T6JA 2V8QB 4HEIA 4R2SA 2DRPA 2EJ4A 3T1HE 1GTKA 2VRDA 4TUIA 1JK2A 3BF2A 1T4OA 1J26A 3T1YE 2YSOA 4BCAA 2EN4A 1HR0E 1TF6A 2EPXA 2ZM6E 1ZR9A 2EPMX 2L2NA 4O5GA 4RHBB 4BC9A 2EN2A 2Q8UA 1EKZA 2DB2A 1IBLE 2GHFA 1ZBTA 1WJPA 2FGGA 4DUZE 2LTRA 2YTPA 4TUGA 4F2JC 2DSYA 4BHBA 2EWLA 4ZYEA 5DNYA 1STUA 1G2DC 2EN6A 4JI1E 4LF4E 2N3HA 2EL5A 1XMOE 4X64E 1N32E 3P1XA 2EN1A 4AQYE 4DR7E 1T39A 3DJWA 3ZOQB 2NA2A 2RTXA 1PDAA 3KZYA 2EM2A 4WSGA 1ZBQA 2DMYA 1HNWE 3OMLA 2EOMA 2ENHA 4R03A 1X5WA 3KZZA 4NXME 2LE2A 4BHCA 2HHHE 2V87A 2KHXA 2JP9A 2EL4A 4F9BB 4O24A 2RPCA 4B3RE 4BS9A 2YSPA 1IQOA 3HQ1A 1WRJA 2YTQA 1A1FA 2YU5A 1L4SA 2PRTA 1RMDA 5AE3A 3EPJA 1TN9A 1N33E 2LV2A 3DF6A 1HNZE 1X49A 2ENAA 2WCC3 2RS7A 1UBDC 1XMQE 2M9AA 2ODRD 4L5NC 5AC4A 2EMLA 2EORA 3JTZA 4OOGC 2WBSA 2RS6A 2M7QA 3EPLA 2ADRA 2N8XA 4JI3E 1ZU1A 2F8BA 4B3TE 2EPNA 2WBUA 2M4IA 3EPHA 2YTNA 2YTIA 4M2ZA 4DR6E 1TF3A 3BGHA 2UUBE 4LF8E 4WFTA 2EOJA 4Q28A 4M30A 1YZ9A 2EM7A 2NABA 4MLVA 4BMJA 3JU0A 3HTXA 2LJHA 2V86A 2YTOA 5A69A 1LLMC 1DQ3A 3ADIA 2ELYA 2ODRC 1PJTA 2RQLA 2LBSB 4ZYDA 4R2CA 4BBYA 1N34E 2EMYA 2E1MA 2WBTA 5A6BA 3OTOE 2YTDA 1X48A 2YT4A 4R2QA 2CSHA 3AUZA 3J80C 5CFFE 4DR3E 4JI4E 1PJQA 2EPCA 4LTYA 4LF9E 2EMCA 1RQ0A 3J81C 1IMUA 2CT1A 4DR4E 4KHPE 2EM9A 2EMZA 3MHSC 2YWQA 2D9HA 2EOYA 4L8NA 1I94E 2EQ1A 4X62E 1GQEA 2EL6A 2L8TA 5IV8B 3C6KA 2EPLX 4DV0E 2E72A 2YTEA 2JR1A 4Q35B 2EOHA 4WXDA 2EOFA 2UUCE 1PJSA 2JOXA 4WXCA 3UK3C 4GKKE 2DLKA 4JI7E 1BBGA 3EQ1A 2EOSA 4X65E 1EH8A 2V83A 1FJGE 1WHNA 2GLIA 3AV0A 4BC7A 5KL4A 3VHTB 4O4KA 4JI2E 1QNTA 1A1KA 2LMZA 3IWDA 2EQ3A 2I9IA 1A1HA 2EZ6A 4LFAE 2G7HA 5AE1A 3C6MA 3J7Yp 2VE7C 2J7JA 3VYXA 1BB8A 4LF6E 2EPUA 2M1SA 1KJKA 5KL5A 4P7DA 3C4TA 4GEQB 2KONA 1WHQA 2A25A 1T4NA 1O0WA 4LU9A 4LFBE 2L6MA 2CPNA 2LT7A 4IS1C 4LFCE 4F9CB 1X3CA 2NUGA 1IBKE 2EQ0A 2E5LE 2DLQA 2LO3A 2V89A 2MKNA 3HPZA 1YUJA 1X6EA 1KYQA 4R2PA 4ZYGA 2R1FA 1G2FC 2F4VE 2ELZA 3F6GA 1EH7A 4O43A 2ENCA 5A2QC 2MC5A 1A1GA 3IWBA 2L2KB 4R2EA 2KOUA 2EOEA 2EE8A 3HPSA 1XNQE 5A6KA 2EMWA 2L3JA 5AASA 4R8OA 1UN6B 1N3GA 2EM8A 2EMFA 3JAMC 5KL7A 2EOOA 5A6JA 2CTDA 2GPIA 4DV4E 4DR2E 4LF7E 2MC6A 2UXCE 1RC7A 1SR9A 5LMUE 2K7IA 1XNRE 3TQMA 3THOB 2JY9A 5TSEA 2LUPB 2RSMA 4GKJE 2L33A 2EOIA 2RSIA 1YPNA 3FIGA 2YTGA 2UU9E 2EN8A 1QU6A 1ZAAC 3KWRA 2H36X 2IHR1 3L00A 4JV5E 4DV7E 2L3CA 3ECRA 1BBOA 1YSAC 2EMAA 2NUEA 1YYOA 2UXBE 2JWOA 1NCSA 2UUAE 2B7VA 1SFEA 2EPOA 3ADJA 4R2RA 3MSWA 4YY3E 2EPPA 3HXLA 1IBME 2VQFE 2EPZA 2EM3A 5KL2A 2EN3A 2JXPA 2EM6A 4WYQB 2LCEA 2B9DA 3ADGA 4DV3E 4NZVA 2I13A 2DGCA 2HGHA 5A6BD 2MKDA 2V88A 2EPKX 2EOXA 4HTGA 4I8OA 4M9VC 2K4VA 2LJUA 2EMKA 2YRKA 2FTXB 2B7TA 2HC5A 5IT9C 2JVAA 4MLQA 4RH8A 2EOZA 3RMPA 2JPAA 4LF5E 3M99B 4YHHE 4X9JA 1YYWA 1B69A 4DKKA 4R2AA 2EMGA 1T38A 5KL6A 4J8ZA 4JI8E 1J5EE 5IXMB 4K0KE 2EMHA 3BIDA 4X66E 2EMIA 4B3SE 1P47A 1UILA 3LMLA 2VQEE 4DR1E 2HJJA 1WXRA 3THNA 1Z1BA 1N36E 4F9AB 5LMNE 4DV1E 4IJDA 2LVHA 5AC5A 1IQSA 1EH6A 3LLHA 4WPYA 2B3TB 1AH5A 1A1JA 2LTSA 1F2IG 3VK6A 1HNXE 2BB8A 2EMXA 4P78A 2R76A 4F6NA 2FV4B 2YPNA 1PKPA 5LLQA 4F54A 4DMIA 3H09A 1X6HA 2N3GA 3K6QA 2MDGA 4JYAE 4JI6E
chains in the Genus database with same CATH topology
4GZNC 2EOIA 2EOMA 2ENHA 1X5WA 2EN7A 2EMBA 2RSIA 2E72A 2YTEA 2EOHA 2YTFA 2YTGA 3MHHC 2EOFA 2JP9A 2EL4A 2EN8A 1ZAAC 3UK3C 2DLKA 1YUIA 2YRHA 2RPCA 2EM5A 2EPRA 2EM0A 1X6FA 4R2DA 2EOSA 2YSPA 1A1FA 2YTQA 2YU5A 2EPAA 4FK5C 2PRTA 1BBOA 2EM4A 3EPKA 1YSAC 1RMDA 2EP3A 2EMAA 2GLIA 1JK1A 5KL4A 3VHTB 3EPJA 1TN9A 2LV2A 1NCSA 2ENAA 2WCC3 1A1KA 1UBDC 4R2RA 2EQ3A 2M9AA 1A1HA 2EMLA 2EORA 2EPPA 2WBSA 2EPZA 2EM3A 2J7JA 5KL2A 2EN3A 2DMIA 2EOQA 3EPLA 1MEYC 2EM6A 2YU8A 2YRMA 1BB8A 2LCEA 2ADRA 1ZU1A 2EPUA 2I13A 2WBUA 2DGCA 5KL5A 2HGHA 1KJKA 2MKDA 2A25A 3EPHA 2EOXA 2YTNA 2YTIA 4M9VC 1A1IA 2YRKA 2EMKA 1AAYA 1TF3A 2LT7A 4IS1C 1A1LA 1DGCA 5KL3A 2EOJA 4F6MA 2YTJA 2EOZA 2EM7A 1X3CA 2NABA 2JPAA 3M99B 2EQ0A 4X9JA 4R2SA 2DLQA 1B69A 2DRPA 2EJ4A 2YTOA 4R2AA 2EMGA 2VRDA 5KL6A 1JK2A 1LLMC 2YSOA 2LO3A 2ELYA 2EN4A 1TF6A 2EPXA 1ZR9A 2EMHA 2MKNA 2EMIA 1YUJA 1X6EA 1P47A 4R2CA 2EN2A 2EMYA 4R2PA 2R1FA 1Z1BA 1G2FC 2WBTA 2YTDA 2ELZA 2GHFA 4R2QA 1WJPA 2ENCA 2CSHA 4IJDA 2LVHA 2YTPA 4F2JC 1A1GA 4R2EA 2EOEA 2EE8A 2EMWA 2EPCA 1G2DC 2EN6A 1A1JA 1F2IG 2EMCA 2EL5A 1UN6B 2BB8A 2EM8A 2EMFA 2EMXA 5KL7A 2CT1A 2EOOA 4F6NA 2CTDA 2EN1A 2EM9A 2EMZA 3MHSC 2D9HA 2EOYA 1X6HA 2EQ1A 2MDGA 2EL6A 2EM2A 4WSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GZN C;  2EOI A;  2EOM A;  2ENH A;  1X5W A;  2EN7 A;  2EMB A;  2RSI A;  2E72 A;  2YTE A;  2EOH A;  2YTF A;  2YTG A;  3MHH C;  2EOF A;  2JP9 A;  2EL4 A;  2EN8 A;  1ZAA C;  3UK3 C;  2DLK A;  1YUI A;  2YRH A;  2RPC A;  2EM5 A;  2EPR A;  2EM0 A;  1X6F A;  4R2D A;  2EOS A;  2YSP A;  1A1F A;  2YTQ A;  2YU5 A;  2EPA A;  4FK5 C;  2PRT A;  1BBO A;  2EM4 A;  3EPK A;  1YSA C;  1RMD A;  2EP3 A;  2EMA A;  2GLI A;  1JK1 A;  5KL4 A;  3VHT B;  3EPJ A;  1TN9 A;  2LV2 A;  1NCS A;  2ENA A;  2WCC 3;  1A1K A;  1UBD C;  4R2R A;  2EQ3 A;  2M9A A;  1A1H A;  2EML A;  2EOR A;  2EPP A;  2WBS A;  2EPZ A;  2EM3 A;  2J7J A;  5KL2 A;  2EN3 A;  2DMI A;  2EOQ A;  3EPL A;  1MEY C;  2EM6 A;  2YU8 A;  2YRM A;  1BB8 A;  2LCE A;  2ADR A;  1ZU1 A;  2EPU A;  2I13 A;  2WBU A;  2DGC A;  5KL5 A;  2HGH A;  1KJK A;  2MKD A;  2A25 A;  3EPH A;  2EOX A;  2YTN A;  2YTI A;  4M9V C;  1A1I A;  2YRK A;  2EMK A;  1AAY A;  1TF3 A;  2LT7 A;  4IS1 C;  1A1L A;  1DGC A;  5KL3 A;  2EOJ A;  4F6M A;  2YTJ A;  2EOZ A;  2EM7 A;  1X3C A;  2NAB A;  2JPA A;  3M99 B;  2EQ0 A;  4X9J A;  4R2S A;  2DLQ A;  1B69 A;  2DRP A;  2EJ4 A;  2YTO A;  4R2A A;  2EMG A;  2VRD A;  5KL6 A;  1JK2 A;  1LLM C;  2YSO A;  2LO3 A;  2ELY A;  2EN4 A;  1TF6 A;  2EPX A;  1ZR9 A;  2EMH A;  2MKN A;  2EMI A;  1YUJ A;  1X6E A;  1P47 A;  4R2C A;  2EN2 A;  2EMY A;  4R2P A;  2R1F A;  1Z1B A;  1G2F C;  2WBT A;  2YTD A;  2ELZ A;  2GHF A;  4R2Q A;  1WJP A;  2ENC A;  2CSH A;  4IJD A;  2LVH A;  2YTP A;  4F2J C;  1A1G A;  4R2E A;  2EOE A;  2EE8 A;  2EMW A;  2EPC A;  1G2D C;  2EN6 A;  1A1J A;  1F2I G;  2EMC A;  2EL5 A;  1UN6 B;  2BB8 A;  2EM8 A;  2EMF A;  2EMX A;  5KL7 A;  2CT1 A;  2EOO A;  4F6N A;  2CTD A;  2EN1 A;  2EM9 A;  2EMZ A;  3MHS C;  2D9H A;  2EOY A;  1X6H A;  2EQ1 A;  2MDG A;  2EL6 A;  2EM2 A;  4WSG A; 
#chains in the Genus database with same CATH topology
 4N4R B;  5LL6 R;  4GZN C;  2NUF A;  3J7A G;  1X47 A;  2EN7 A;  2VF1 A;  2EMB A;  2LUQ A;  4DV6 E;  3F6H A;  2YTF A;  1UHZ A;  4OX9 E;  3MHH C;  4DUY E;  4KWY A;  4X8W A;  5AE2 A;  3IWC A;  1T4L B;  5IWA E;  3ADL A;  1YUI A;  2YRH A;  3VYY A;  2EM5 A;  2EPR A;  3C4B A;  2EM0 A;  1X6F A;  4R2D A;  4JI0 E;  4WSP A;  4DV5 E;  4KZS A;  2EPA A;  4FK5 C;  2EM4 A;  3EPK A;  2EP3 A;  1YFH A;  1JK1 A;  2JOB A;  2MDR A;  4B3M E;  3QG5 C;  2UXD E;  4WX9 A;  5F3W A;  4DV2 E;  2YZT A;  5FLX C;  4M0V A;  2DMI A;  2EOQ A;  1MEY C;  3BBG A;  4JI5 E;  5BR8 E;  2L92 A;  2DIX A;  2YU8 A;  2YRM A;  2LRS A;  2BBG A;  4NXN E;  1YYK A;  2V85 A;  1NEI A;  5A6A A;  2WZO A;  1GZ6 A;  4NHR A;  4ZYH A;  2L2M A;  5ADZ A;  2JYA A;  1MGT A;  1FKA E;  1A1I A;  1AAY A;  1DI2 A;  1A1L A;  1DGC A;  5KL3 A;  4F6M A;  2YTJ A;  4DR5 E;  5T6J A;  2V8Q B;  4HEI A;  4R2S A;  2DRP A;  2EJ4 A;  3T1H E;  1GTK A;  2VRD A;  4TUI A;  1JK2 A;  3BF2 A;  1T4O A;  1J26 A;  3T1Y E;  2YSO A;  4BCA A;  2EN4 A;  1HR0 E;  1TF6 A;  2EPX A;  2ZM6 E;  1ZR9 A;  2EPM X;  2L2N A;  4O5G A;  4RHB B;  4BC9 A;  2EN2 A;  2Q8U A;  1EKZ A;  2DB2 A;  1IBL E;  2GHF A;  1ZBT A;  1WJP A;  2FGG A;  4DUZ E;  2LTR A;  2YTP A;  4TUG A;  4F2J C;  2DSY A;  4BHB A;  2EWL A;  4ZYE A;  5DNY A;  1STU A;  1G2D C;  2EN6 A;  4JI1 E;  4LF4 E;  2N3H A;  2EL5 A;  1XMO E;  4X64 E;  1N32 E;  3P1X A;  2EN1 A;  4AQY E;  4DR7 E;  1T39 A;  3DJW A;  3ZOQ B;  2NA2 A;  2RTX A;  1PDA A;  3KZY A;  2EM2 A;  4WSG A;  1ZBQ A;  2DMY A;  1HNW E;  3OML A;  2EOM A;  2ENH A;  4R03 A;  1X5W A;  3KZZ A;  4NXM E;  2LE2 A;  4BHC A;  2HHH E;  2V87 A;  2KHX A;  2JP9 A;  2EL4 A;  4F9B B;  4O24 A;  2RPC A;  4B3R E;  4BS9 A;  2YSP A;  1IQO A;  3HQ1 A;  1WRJ A;  2YTQ A;  1A1F A;  2YU5 A;  1L4S A;  2PRT A;  1RMD A;  5AE3 A;  3EPJ A;  1TN9 A;  1N33 E;  2LV2 A;  3DF6 A;  1HNZ E;  1X49 A;  2ENA A;  2WCC 3;  2RS7 A;  1UBD C;  1XMQ E;  2M9A A;  2ODR D;  4L5N C;  5AC4 A;  2EML A;  2EOR A;  3JTZ A;  4OOG C;  2WBS A;  2RS6 A;  2M7Q A;  3EPL A;  2ADR A;  2N8X A;  4JI3 E;  1ZU1 A;  2F8B A;  4B3T E;  2EPN A;  2WBU A;  2M4I A;  3EPH A;  2YTN A;  2YTI A;  4M2Z A;  4DR6 E;  1TF3 A;  3BGH A;  2UUB E;  4LF8 E;  4WFT A;  2EOJ A;  4Q28 A;  4M30 A;  1YZ9 A;  2EM7 A;  2NAB A;  4MLV A;  4BMJ A;  3JU0 A;  3HTX A;  2LJH A;  2V86 A;  2YTO A;  5A69 A;  1LLM C;  1DQ3 A;  3ADI A;  2ELY A;  2ODR C;  1PJT A;  2RQL A;  2LBS B;  4ZYD A;  4R2C A;  4BBY A;  1N34 E;  2EMY A;  2E1M A;  2WBT A;  5A6B A;  3OTO E;  2YTD A;  1X48 A;  2YT4 A;  4R2Q A;  2CSH A;  3AUZ A;  3J80 C;  5CFF E;  4DR3 E;  4JI4 E;  1PJQ A;  2EPC A;  4LTY A;  4LF9 E;  2EMC A;  1RQ0 A;  3J81 C;  1IMU A;  2CT1 A;  4DR4 E;  4KHP E;  2EM9 A;  2EMZ A;  3MHS C;  2YWQ A;  2D9H A;  2EOY A;  4L8N A;  1I94 E;  2EQ1 A;  4X62 E;  1GQE A;  2EL6 A;  2L8T A;  5IV8 B;  3C6K A;  2EPL X;  4DV0 E;  2E72 A;  2YTE A;  2JR1 A;  4Q35 B;  2EOH A;  4WXD A;  2EOF A;  2UUC E;  1PJS A;  2JOX A;  4WXC A;  3UK3 C;  4GKK E;  2DLK A;  4JI7 E;  1BBG A;  3EQ1 A;  2EOS A;  4X65 E;  1EH8 A;  2V83 A;  1FJG E;  1WHN A;  2GLI A;  3AV0 A;  4BC7 A;  5KL4 A;  3VHT B;  4O4K A;  4JI2 E;  1QNT A;  1A1K A;  2LMZ A;  3IWD A;  2EQ3 A;  2I9I A;  1A1H A;  2EZ6 A;  4LFA E;  2G7H A;  5AE1 A;  3C6M A;  3J7Y p;  2VE7 C;  2J7J A;  3VYX A;  1BB8 A;  4LF6 E;  2EPU A;  2M1S A;  1KJK A;  5KL5 A;  4P7D A;  3C4T A;  4GEQ B;  2KON A;  1WHQ A;  2A25 A;  1T4N A;  1O0W A;  4LU9 A;  4LFB E;  2L6M A;  2CPN A;  2LT7 A;  4IS1 C;  4LFC E;  4F9C B;  1X3C A;  2NUG A;  1IBK E;  2EQ0 A;  2E5L E;  2DLQ A;  2LO3 A;  2V89 A;  2MKN A;  3HPZ A;  1YUJ A;  1X6E A;  1KYQ A;  4R2P A;  4ZYG A;  2R1F A;  1G2F C;  2F4V E;  2ELZ A;  3F6G A;  1EH7 A;  4O43 A;  2ENC A;  5A2Q C;  2MC5 A;  1A1G A;  3IWB A;  2L2K B;  4R2E A;  2KOU A;  2EOE A;  2EE8 A;  3HPS A;  1XNQ E;  5A6K A;  2EMW A;  2L3J A;  5AAS A;  4R8O A;  1UN6 B;  1N3G A;  2EM8 A;  2EMF A;  3JAM C;  5KL7 A;  2EOO A;  5A6J A;  2CTD A;  2GPI A;  4DV4 E;  4DR2 E;  4LF7 E;  2MC6 A;  2UXC E;  1RC7 A;  1SR9 A;  5LMU E;  2K7I A;  1XNR E;  3TQM A;  3THO B;  2JY9 A;  5TSE A;  2LUP B;  2RSM A;  4GKJ E;  2L33 A;  2EOI A;  2RSI A;  1YPN A;  3FIG A;  2YTG A;  2UU9 E;  2EN8 A;  1QU6 A;  1ZAA C;  3KWR A;  2H36 X;  2IHR 1;  3L00 A;  4JV5 E;  4DV7 E;  2L3C A;  3ECR A;  1BBO A;  1YSA C;  2EMA A;  2NUE A;  1YYO A;  2UXB E;  2JWO A;  1NCS A;  2UUA E;  2B7V A;  1SFE A;  2EPO A;  3ADJ A;  4R2R A;  3MSW A;  4YY3 E;  2EPP A;  3HXL A;  1IBM E;  2VQF E;  2EPZ A;  2EM3 A;  5KL2 A;  2EN3 A;  2JXP A;  2EM6 A;  4WYQ B;  2LCE A;  2B9D A;  3ADG A;  4DV3 E;  4NZV A;  2I13 A;  2DGC A;  2HGH A;  5A6B D;  2MKD A;  2V88 A;  2EPK X;  2EOX A;  4HTG A;  4I8O A;  4M9V C;  2K4V A;  2LJU A;  2EMK A;  2YRK A;  2FTX B;  2B7T A;  2HC5 A;  5IT9 C;  2JVA A;  4MLQ A;  4RH8 A;  2EOZ A;  3RMP A;  2JPA A;  4LF5 E;  3M99 B;  4YHH E;  4X9J A;  1YYW A;  1B69 A;  4DKK A;  4R2A A;  2EMG A;  1T38 A;  5KL6 A;  4J8Z A;  4JI8 E;  1J5E E;  5IXM B;  4K0K E;  2EMH A;  3BID A;  4X66 E;  2EMI A;  4B3S E;  1P47 A;  1UIL A;  3LML A;  2VQE E;  4DR1 E;  2HJJ A;  1WXR A;  3THN A;  1Z1B A;  1N36 E;  4F9A B;  5LMN E;  4DV1 E;  4IJD A;  2LVH A;  5AC5 A;  1IQS A;  1EH6 A;  3LLH A;  4WPY A;  2B3T B;  1AH5 A;  1A1J A;  2LTS A;  1F2I G;  3VK6 A;  1HNX E;  2BB8 A;  2EMX A;  4P78 A;  2R76 A;  4F6N A;  2FV4 B;  2YPN A;  1PKP A;  5LLQ A;  4F54 A;  4DMI A;  3H09 A;  1X6H A;  2N3G A;  3K6Q A;  2MDG A;  4JYA E;  4JI6 E; 
#chains in the Genus database with same CATH homology
 4GZN C;  2EOI A;  2EOM A;  2ENH A;  1X5W A;  2EN7 A;  2EMB A;  2RSI A;  2E72 A;  2YTE A;  2EOH A;  2YTF A;  2YTG A;  3MHH C;  2EOF A;  2JP9 A;  2EL4 A;  2EN8 A;  1ZAA C;  3UK3 C;  2DLK A;  1YUI A;  2YRH A;  2RPC A;  2EM5 A;  2EPR A;  2EM0 A;  1X6F A;  4R2D A;  2EOS A;  2YSP A;  1A1F A;  2YTQ A;  2YU5 A;  2EPA A;  4FK5 C;  2PRT A;  1BBO A;  2EM4 A;  3EPK A;  1YSA C;  1RMD A;  2EP3 A;  2EMA A;  2GLI A;  1JK1 A;  5KL4 A;  3VHT B;  3EPJ A;  1TN9 A;  2LV2 A;  1NCS A;  2ENA A;  2WCC 3;  1A1K A;  1UBD C;  4R2R A;  2EQ3 A;  2M9A A;  1A1H A;  2EML A;  2EOR A;  2EPP A;  2WBS A;  2EPZ A;  2EM3 A;  2J7J A;  5KL2 A;  2EN3 A;  2DMI A;  2EOQ A;  3EPL A;  1MEY C;  2EM6 A;  2YU8 A;  2YRM A;  1BB8 A;  2LCE A;  2ADR A;  1ZU1 A;  2EPU A;  2I13 A;  2WBU A;  2DGC A;  5KL5 A;  2HGH A;  1KJK A;  2MKD A;  2A25 A;  3EPH A;  2EOX A;  2YTN A;  2YTI A;  4M9V C;  1A1I A;  2YRK A;  2EMK A;  1AAY A;  1TF3 A;  2LT7 A;  4IS1 C;  1A1L A;  1DGC A;  5KL3 A;  2EOJ A;  4F6M A;  2YTJ A;  2EOZ A;  2EM7 A;  1X3C A;  2NAB A;  2JPA A;  3M99 B;  2EQ0 A;  4X9J A;  4R2S A;  2DLQ A;  1B69 A;  2DRP A;  2EJ4 A;  2YTO A;  4R2A A;  2EMG A;  2VRD A;  5KL6 A;  1JK2 A;  1LLM C;  2YSO A;  2LO3 A;  2ELY A;  2EN4 A;  1TF6 A;  2EPX A;  1ZR9 A;  2EMH A;  2MKN A;  2EMI A;  1YUJ A;  1X6E A;  1P47 A;  4R2C A;  2EN2 A;  2EMY A;  4R2P A;  2R1F A;  1Z1B A;  1G2F C;  2WBT A;  2YTD A;  2ELZ A;  2GHF A;  4R2Q A;  1WJP A;  2ENC A;  2CSH A;  4IJD A;  2LVH A;  2YTP A;  4F2J C;  1A1G A;  4R2E A;  2EOE A;  2EE8 A;  2EMW A;  2EPC A;  1G2D C;  2EN6 A;  1A1J A;  1F2I G;  2EMC A;  2EL5 A;  1UN6 B;  2BB8 A;  2EM8 A;  2EMF A;  2EMX A;  5KL7 A;  2CT1 A;  2EOO A;  4F6N A;  2CTD A;  2EN1 A;  2EM9 A;  2EMZ A;  3MHS C;  2D9H A;  2EOY A;  1X6H A;  2EQ1 A;  2MDG A;  2EL6 A;  2EM2 A;  4WSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...