2YT4A

Crystal structure of human dgcr8 core
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
213
structure length
196
Chain Sequence
b'GSHMSVQDKKEFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECENPSEPFGASVTIDGVTYGSGTASSKKLAKNKAARATLEILIPDFVKQSEELEYFNHISIEDSRVYELTSKAGLLSPYQILHECLKRNHGMGDTSIKFEQKSEYVMACGKHTVRGWCKNKRVGKQLASQKILQLLHPHVKNWGSLLRMYGRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein DGCR8
publication title Crystal structure of human DGCR8 core
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 52
structure length 196
sequence length 213
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2yt4A02
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2yt4A03
3.30.160.590 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2yt4A01
1PKPA 2UUAE 2LUPB 4DUYE 1RC7A 4JI8E 4LF5E 5IWAE 4B3ME 4DR6E 2L3JA 4NXME 2LUQA 1N33E 3ADGA 4JI0E 2B7TA 4X66E 2LBSB 1WHNA 4DV4E 1HNXE 3C4TA 3LLHA 4JI6E 1GQEA 1HNWE 1O0WA 1XMQE 1YYOA 1T4OA 1IBKE 1UILA 1IBME 2UUBE 2NUFA 1X47A 3ADIA 2RS7A 4X65E 2KHXA 4LF8E 2RS6A 3OTOE 3P1XA 2UU9E 2L2NA 2UXDE 2LTSA 4GKJE 4JI1E 4LFCE 3T1YE 1N34E 2NUGA 1X49A 4B3TE 3J7Yp 4JV5E 4DV3E 2LRSA 2CPNA 4JI5E 4X62E 1YYKA 1X48A 2L2MA 2JVAA 3C4BA 2B7VA 4YHHE 4DV7E 4AQYE 4JI2E 1UHZA 3VYXA 4DR7E 1I94E 2N3HA 2IHR1 2RSMA 2DMYA 5LMUE 4DV6E 4DR3E 4YY3E 3HTXA 2B3TB 2HHHE 1T4NA 4JI7E 2UUCE 1DI2A 5CFFE 1FJGE 2VQEE 4DV0E 2NA2A 4M30A 1IBLE 3VYYA 1STUA 2LJHA 2N3GA 2DB2A 4DV2E 4LFAE 4DKKA 4DR1E 2NUEA 1T4LB 4LF6E 1FKAE 2VQFE 3ADLA 2ZM6E 4DR4E 1N36E 2E5LE 1N32E 1J5EE 4B3RE 4DR5E 2UXCE 2MDRA 2F4VE 1J26A 1ZBTA 1EKZA 4K0KE 2UXBE 4JI3E 4WFTA 3T1HE 2DIXA 4X8WA 4DUZE 1YZ9A 4LF4E 2YT4A 1XMOE 4JYAE 2EZ6A 4DV1E 4NXNE 1XNRE 3ADJA 2RTXA 4M2ZA 4OX9E 1WHQA 4KHPE 4LF9E 4X64E 4B3SE 5LMNE 2L33A 4WYQB 2LTRA 4OOGC 4LFBE 2L3CA 1QU6A 4DR2E 4DV5E 4LF7E 4JI4E 1YYWA 4GKKE 1HR0E 1RQ0A 2JY9A 1XNQE 1HNZE 5BR8E 2L2KB
chains in the Genus database with same CATH superfamily
4R2EA 4WXDA 3VK6A 2LUPB 4MLQA 1RC7A 2EPCA 4LF5E 4BMJA 2EM8A 2LV2A 1AH5A 2YTQA 2ELYA 2MKDA 4TUIA 2V89A 2LUQA 1AAYA 4RH8A 1ZR9A 1A1GA 4X66E 1UBDC 2LBSB 2D9HA 3TQMA 1ZBQA 3C4TA 2YTOA 3LLHA 1UN6B 5A6AA 1O0WA 1IBME 2JYAA 4R2SA 4DMIA 3J80C 2JP9A 3ADIA 2KHXA 2YTIA 1PJSA 5AE1A 5KL5A 4R2RA 2EE8A 4R2QA 2WBTA 2LTSA 2YSPA 4JI1E 1A1FA 3T1YE 1N34E 2NUGA 2DLKA 1X49A 5AC5A 4JV5E 4DV3E 1GZ6A 2N8XA 1X6HA 2EM4A 2MC6A 4Q28A 4X62E 1YYKA 1MGTA 1X48A 4AQYE 4YHHE 4ZYGA 5A6BD 2EMAA 1YUJA 2EN4A 4DV6E 1N3GA 2L8TA 3BIDA 4O5GA 1EH7A 2DRPA 4N4RB 2EPLX 2HGHA 4R03A 4JI7E 2VQEE 3DJWA 2DLQA 2ELZA 2LJUA 2DGCA 3F6HA 2EMKA 2DB2A 4DV2E 1KJKA 2EMHA 1BB8A 3JAMC 2JXPA 4P7DA 2VF1A 2EOXA 2EM3A 2E5LE 2V88A 3EPJA 1J5EE 2EMGA 1DQ3A 2EPPA 3DF6A 2EM6A 5IV8B 4BHBA 2YTGA 4IJDA 3QG5C 2UXBE 1KYQA 3HPSA 1YZ9A 1XMOE 4JYAE 2EZ6A 4NXNE 2LMZA 1G2DC 2RTXA 1IQOA 4LF9E 2EQ3A 1YSAC 2EJ4A 2EMYA 1QU6A 2L3CA 5IT9C 2EOIA 1WXRA 2G7HA 4GKKE 2GLIA 2DSYA 2JY9A 1HNZE 2F8BA 4J8ZA 1PKPA 2UUAE 4X9JA 2V87A 1TF3A 2EOOA 4BBYA 1X6EA 2EL6A 2EOFA 2YTNA 4F54A 4NXME 2EN7A 1N33E 4JI0E 2B7TA 4IS1C 1WHNA 2EN1A 4TUGA 4NHRA 2LE2A 4GZNC 2EN8A 2I13A 4JI6E 1GQEA 2FV4B 2YRMA 3BGHA 1IBKE 2E72A 2RSIA 1BBGA 2EM7A 1DGCA 2EMIA 3EQ1A 2YZTA 4LF8E 3EPHA 2ADRA 2MDGA 4LU9A 4B3TE 2EMBA 3J7Yp 5AE3A 2EPNA 4O43A 2EOYA 2E1MA 5F3WA 1BBOA 1UHZA 2ENCA 4DR7E 2L6MA 2R1FA 1I94E 3THOB 5FLXC 2EL5A 4F9CB 2EMLA 3ZOQB 2HJJA 1JK2A 1ZU1A 3KZYA 5A69A 3HPZA 4WX9A 2B3TB 2EORA 4HEIA 1T4NA 2FTXB 2LO3A 2UUCE 2YU5A 3LMLA 5CFFE 4DV0E 4M30A 1IBLE 1STUA 4LTYA 2LJHA 3VHTB 4DKKA 2NUEA 2EMCA 1T4LB 2I9IA 3M99B 4F6MA 2JPAA 5ADZA 3HQ1A 2JOXA 2ZM6E 4WSPA 1N36E 1N32E 3IWBA 4B3RE 1T39A 2JWOA 1ZBTA 4JI3E 2Q8UA 2V85A 4DUZE 2RQLA 4DV1E 1XNRE 4M2ZA 4OX9E 2M4IA 2J7JA 2EN2A 2B9DA 2EMWA 2EMZA 3EPLA 2LTRA 4LFBE 4R2DA 2EPXA 2EOMA 1ZAAC 2V86A 1YUIA 2YRKA 4JI4E 3MSWA 5A2QC 2WBUA 2K7IA 2K4VA 1XNQE 2L92A 4R2PA 1EH8A 1NEIA 5IXMB 5A6BA 2M7QA 3L00A 4BCAA 2EOHA 4B3ME 3FIGA 5AE2A 1GTKA 2EL4A 4DR6E 2L3JA 2EM9A 1A1IA 2EPZA 2BBGA 1WRJA 3RMPA 4DV4E 3ECRA 2EM5A 5TSEA 2EWLA 3AV0A 2GHFA 2ODRC 2M9AA 1T4OA 4ZYHA 1UILA 2UUBE 4MLVA 2RS7A 4X65E 1G2FC 2FGGA 2YTJA 2YRHA 1TF6A 2RS6A 2EQ1A 3P1XA 2LVHA 3MHSC 2UU9E 5KL2A 2YTDA 5DNYA 2EPRA 5AASA 3IWCA 4R8OA 1P47A 2CPNA 2LCEA 2VRDA 3HXLA 2L2MA 2JVAA 3AUZA 2B7VA 3C4BA 4DV7E 2YSOA 1X5WA 2N3HA 1SFEA 4NZVA 3H09A 2NABA 4YY3E 2EPAA 5T6JA 4R2CA 5KL7A 2V83A 3HTXA 2RPCA 3BF2A 1IQSA 2WCC3 2EM0A 3C6MA 1FJGE 2DMIA 2NA2A 4RHBB 5LLQA 4WSGA 2N3GA 1PJQA 4KWYA 4F9BB 1SR9A 2EMXA 2H36X 4BC7A 2JR1A 3IWDA 4LF6E 4L8NA 2VQFE 3ADLA 2CSHA 4DR5E 2UXCE 2F4VE 1J26A 1A1LA 3J7AG 4HTGA 4K0KE 1RMDA 2EOJA 2DIXA 4I8OA 1PDAA 5KL3A 2YT4A 4FK5C 2EPKX 1QNTA 4F2JC 2MC5A 2CT1A 4KHPE 4B3SE 5LMNE 2L33A 4WYQB 2YTPA 1Z1BA 2M1SA 4OOGC 2BB8A 2ODRD 4DR2E 1A1KA 1HR0E 1WJPA 3T1HE 2L2KB 3THNA 1X6FA 4KZSA 4DUYE 4JI8E 1YPNA 2A25A 2EPMX 2WZOA 5A6KA 2YWQA 3F6GA 5IWAE 2EN6A 2EOQA 2PRTA 1MEYC 5AC4A 2EOZA 3KZZA 3ADGA 2JOBA 3JTZA 1HNXE 2EMFA 3K6QA 2ENAA 1HNWE 2EPUA 1XMQE 1YYOA 2EQ0A 2VE7C 3OMLA 3UK3C 2NUFA 1X3CA 1X47A 5KL4A 1JK1A 1PJTA 2YU8A 2EPOA 4F9AB 2EOSA 3OTOE 1LLMC 2R76A 4BS9A 2L2NA 2UXDE 4GKJE 4L5NC 4LFCE 2KOUA 3KWRA 3C6KA 2LRSA 4O4KA 4JI5E 1NCSA 4JI2E 3VYXA 2IHR1 2RSMA 3BBGA 2LT7A 1T38A 2DMYA 1A1HA 5LMUE 1EH6A 4DR3E 4M0VA 2EOEA 2HHHE 4R2AA 1DI2A 5LL6R 5KL6A 4M9VC 3VYYA 4Q35B 2V8QB 4LFAE 4DR1E 2YTEA 3MHHC 2ENHA 4ZYEA 1IMUA 4GEQB 4BHCA 1FKAE 2WBSA 4DR4E 3J81C 1B69A 2MDRA 1TN9A 1F2IG 4F6NA 1EKZA 4P78A 2EM2A 2HC5A 4WFTA 2GPIA 4X8WA 4LF4E 2KONA 4ZYDA 4WPYA 1L4SA 3ADJA 1A1JA 2YPNA 1WHQA 3EPKA 4O24A 2MKNA 4X64E 2EN3A 4BC9A 2EP3A 5A6JA 1YFHA 4DV5E 4LF7E 3JU0A 2YTFA 1YYWA 1RQ0A 2CTDA 4WXCA 5BR8E
chains in the Genus database with same CATH topology
4J8ZA 1PKPA 2UUAE 3VK6A 2LUPB 4KZSA 2V87A 2M7QA 4DUYE 1RC7A 4JI8E 4LF5E 4BCAA 4BBYA 2WZOA 4BMJA 5IWAE 3F6GA 4B3ME 3FIGA 5AE2A 4TUIA 4F54A 4DR6E 2L3JA 4NXME 2V89A 2LUQA 1N33E 3ADGA 4JI0E 2B7TA 3RMPA 2JOBA 3JTZA 4X66E 2LBSB 1WHNA 4DV4E 4TUGA 1HNXE 1ZBQA 2LE2A 3C4TA 3K6QA 3LLHA 1GQEA 4JI6E 2EWLA 1HNWE 3AV0A 1O0WA 2ODRC 2FV4B 1YYOA 1XMQE 1T4OA 2VE7C 1IBKE 1UILA 1IBME 3OMLA 2UUBE 2NUFA 1X47A 4DMIA 3J80C 3ADIA 2RS7A 4X65E 2KHXA 2FGGA 4F9AB 2YZTA 4LF8E 2RS6A 5AE1A 3OTOE 3P1XA 4BS9A 2UU9E 2L2NA 2UXDE 2LTSA 4GKJE 4L5NC 4JI1E 3T1YE 1N34E 4LFCE 2NUGA 4LU9A 5DNYA 1X49A 5AASA 2KOUA 3KWRA 3J7Yp 3IWCA 1GZ6A 4R8OA 5AE3A 4DV3E 4B3TE 2LRSA 2CPNA 4JI5E 2MC6A 4Q28A 2E1MA 4X62E 1YYKA 5F3WA 1X48A 3HXLA 2L2MA 2JVAA 3AUZA 2B7VA 3C4BA 4YHHE 4DV7E 4AQYE 1UHZA 4JI2E 3VYXA 2L6MA 4DR7E 1I94E 2N3HA 2IHR1 2RSMA 5FLXC 4F9CB 2DMYA 3ZOQB 5LMUE 4DV6E 4DR3E 3H09A 2L8TA 4YY3E 5T6JA 3HPZA 2V83A 4M0VA 3HTXA 2B3TB 2HHHE 1T4NA 2FTXB 4R03A 4JI7E 2UUCE 1DI2A 5LL6R 3LMLA 5CFFE 1FJGE 2VQEE 4DV0E 2NA2A 4M30A 3DJWA 1IBLE 3VYYA 1STUA 4LTYA 2LJHA 2N3GA 4F9BB 3F6HA 2DB2A 4DV2E 1SR9A 2V8QB 4DKKA 4DR1E 4LFAE 2NUEA 1T4LB 2H36X 4GEQB 4BC7A 3JAMC 2JR1A 3IWDA 4P7DA 4L8NA 2VF1A 5ADZA 2VQFE 1FKAE 3HQ1A 4LF6E 3ADLA 2JOXA 2ZM6E 4DR4E 4WSPA 1N36E 2E5LE 1N32E 2V88A 1J5EE 3IWBA 3J81C 4B3RE 1DQ3A 4DR5E 2UXCE 3DF6A 2MDRA 2JWOA 2F4VE 1J26A 1ZBTA 1EKZA 3J7AG 4P78A 4K0KE 2UXBE 4JI3E 4WFTA 2V85A 3T1HE 2DIXA 3HPSA 4I8OA 4X8WA 4DUZE 2YT4A 4LF4E 1XMOE 1YZ9A 2EZ6A 2KONA 4DV1E 4WPYA 4NXNE 1XNRE 4JYAE 2LMZA 3ADJA 2RTXA 4M2ZA 2MC5A 4OX9E 2M4IA 1WHQA 4KHPE 4LF9E 2B9DA 4X64E 4B3SE 5LMNE 2L33A 4WYQB 4BC9A 2M1SA 2LTRA 4OOGC 4LFBE 2ODRD 1QU6A 2L3CA 5IT9C 4DR2E 4DV5E 1WXRA 2G7HA 2V86A 4LF7E 3JU0A 4JI4E 1YYWA 4GKKE 3MSWA 1RQ0A 5A2QC 1HR0E 4JV5E 2K4VA 2DSYA 2JY9A 1XNQE 1HNZE 2F8BA 5BR8E 2L92A 2L2KB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PKP A;  2UUA E;  2LUP B;  4DUY E;  1RC7 A;  4JI8 E;  4LF5 E;  5IWA E;  4B3M E;  4DR6 E;  2L3J A;  4NXM E;  2LUQ A;  1N33 E;  3ADG A;  4JI0 E;  2B7T A;  4X66 E;  2LBS B;  1WHN A;  4DV4 E;  1HNX E;  3C4T A;  3LLH A;  4JI6 E;  1GQE A;  1HNW E;  1O0W A;  1XMQ E;  1YYO A;  1T4O A;  1IBK E;  1UIL A;  1IBM E;  2UUB E;  2NUF A;  1X47 A;  3ADI A;  2RS7 A;  4X65 E;  2KHX A;  4LF8 E;  2RS6 A;  3OTO E;  3P1X A;  2UU9 E;  2L2N A;  2UXD E;  2LTS A;  4GKJ E;  4JI1 E;  4LFC E;  3T1Y E;  1N34 E;  2NUG A;  1X49 A;  4B3T E;  3J7Y p;  4JV5 E;  4DV3 E;  2LRS A;  2CPN A;  4JI5 E;  4X62 E;  1YYK A;  1X48 A;  2L2M A;  2JVA A;  3C4B A;  2B7V A;  4YHH E;  4DV7 E;  4AQY E;  4JI2 E;  1UHZ A;  3VYX A;  4DR7 E;  1I94 E;  2N3H A;  2IHR 1;  2RSM A;  2DMY A;  5LMU E;  4DV6 E;  4DR3 E;  4YY3 E;  3HTX A;  2B3T B;  2HHH E;  1T4N A;  4JI7 E;  2UUC E;  1DI2 A;  5CFF E;  1FJG E;  2VQE E;  4DV0 E;  2NA2 A;  4M30 A;  1IBL E;  3VYY A;  1STU A;  2LJH A;  2N3G A;  2DB2 A;  4DV2 E;  4LFA E;  4DKK A;  4DR1 E;  2NUE A;  1T4L B;  4LF6 E;  1FKA E;  2VQF E;  3ADL A;  2ZM6 E;  4DR4 E;  1N36 E;  2E5L E;  1N32 E;  1J5E E;  4B3R E;  4DR5 E;  2UXC E;  2MDR A;  2F4V E;  1J26 A;  1ZBT A;  1EKZ A;  4K0K E;  2UXB E;  4JI3 E;  4WFT A;  3T1H E;  2DIX A;  4X8W A;  4DUZ E;  1YZ9 A;  4LF4 E;  2YT4 A;  1XMO E;  4JYA E;  2EZ6 A;  4DV1 E;  4NXN E;  1XNR E;  3ADJ A;  2RTX A;  4M2Z A;  4OX9 E;  1WHQ A;  4KHP E;  4LF9 E;  4X64 E;  4B3S E;  5LMN E;  2L33 A;  4WYQ B;  2LTR A;  4OOG C;  4LFB E;  2L3C A;  1QU6 A;  4DR2 E;  4DV5 E;  4LF7 E;  4JI4 E;  1YYW A;  4GKK E;  1HR0 E;  1RQ0 A;  2JY9 A;  1XNQ E;  1HNZ E;  5BR8 E;  2L2K B; 
#chains in the Genus database with same CATH topology
 4R2E A;  4WXD A;  3VK6 A;  2LUP B;  4MLQ A;  1RC7 A;  2EPC A;  4LF5 E;  4BMJ A;  2EM8 A;  2LV2 A;  1AH5 A;  2YTQ A;  2ELY A;  2MKD A;  4TUI A;  2V89 A;  2LUQ A;  1AAY A;  4RH8 A;  1ZR9 A;  1A1G A;  4X66 E;  1UBD C;  2LBS B;  2D9H A;  3TQM A;  1ZBQ A;  3C4T A;  2YTO A;  3LLH A;  1UN6 B;  5A6A A;  1O0W A;  1IBM E;  2JYA A;  4R2S A;  4DMI A;  3J80 C;  2JP9 A;  3ADI A;  2KHX A;  2YTI A;  1PJS A;  5AE1 A;  5KL5 A;  4R2R A;  2EE8 A;  4R2Q A;  2WBT A;  2LTS A;  2YSP A;  4JI1 E;  1A1F A;  3T1Y E;  1N34 E;  2NUG A;  2DLK A;  1X49 A;  5AC5 A;  4JV5 E;  4DV3 E;  1GZ6 A;  2N8X A;  1X6H A;  2EM4 A;  2MC6 A;  4Q28 A;  4X62 E;  1YYK A;  1MGT A;  1X48 A;  4AQY E;  4YHH E;  4ZYG A;  5A6B D;  2EMA A;  1YUJ A;  2EN4 A;  4DV6 E;  1N3G A;  2L8T A;  3BID A;  4O5G A;  1EH7 A;  2DRP A;  4N4R B;  2EPL X;  2HGH A;  4R03 A;  4JI7 E;  2VQE E;  3DJW A;  2DLQ A;  2ELZ A;  2LJU A;  2DGC A;  3F6H A;  2EMK A;  2DB2 A;  4DV2 E;  1KJK A;  2EMH A;  1BB8 A;  3JAM C;  2JXP A;  4P7D A;  2VF1 A;  2EOX A;  2EM3 A;  2E5L E;  2V88 A;  3EPJ A;  1J5E E;  2EMG A;  1DQ3 A;  2EPP A;  3DF6 A;  2EM6 A;  5IV8 B;  4BHB A;  2YTG A;  4IJD A;  3QG5 C;  2UXB E;  1KYQ A;  3HPS A;  1YZ9 A;  1XMO E;  4JYA E;  2EZ6 A;  4NXN E;  2LMZ A;  1G2D C;  2RTX A;  1IQO A;  4LF9 E;  2EQ3 A;  1YSA C;  2EJ4 A;  2EMY A;  1QU6 A;  2L3C A;  5IT9 C;  2EOI A;  1WXR A;  2G7H A;  4GKK E;  2GLI A;  2DSY A;  2JY9 A;  1HNZ E;  2F8B A;  4J8Z A;  1PKP A;  2UUA E;  4X9J A;  2V87 A;  1TF3 A;  2EOO A;  4BBY A;  1X6E A;  2EL6 A;  2EOF A;  2YTN A;  4F54 A;  4NXM E;  2EN7 A;  1N33 E;  4JI0 E;  2B7T A;  4IS1 C;  1WHN A;  2EN1 A;  4TUG A;  4NHR A;  2LE2 A;  4GZN C;  2EN8 A;  2I13 A;  4JI6 E;  1GQE A;  2FV4 B;  2YRM A;  3BGH A;  1IBK E;  2E72 A;  2RSI A;  1BBG A;  2EM7 A;  1DGC A;  2EMI A;  3EQ1 A;  2YZT A;  4LF8 E;  3EPH A;  2ADR A;  2MDG A;  4LU9 A;  4B3T E;  2EMB A;  3J7Y p;  5AE3 A;  2EPN A;  4O43 A;  2EOY A;  2E1M A;  5F3W A;  1BBO A;  1UHZ A;  2ENC A;  4DR7 E;  2L6M A;  2R1F A;  1I94 E;  3THO B;  5FLX C;  2EL5 A;  4F9C B;  2EML A;  3ZOQ B;  2HJJ A;  1JK2 A;  1ZU1 A;  3KZY A;  5A69 A;  3HPZ A;  4WX9 A;  2B3T B;  2EOR A;  4HEI A;  1T4N A;  2FTX B;  2LO3 A;  2UUC E;  2YU5 A;  3LML A;  5CFF E;  4DV0 E;  4M30 A;  1IBL E;  1STU A;  4LTY A;  2LJH A;  3VHT B;  4DKK A;  2NUE A;  2EMC A;  1T4L B;  2I9I A;  3M99 B;  4F6M A;  2JPA A;  5ADZ A;  3HQ1 A;  2JOX A;  2ZM6 E;  4WSP A;  1N36 E;  1N32 E;  3IWB A;  4B3R E;  1T39 A;  2JWO A;  1ZBT A;  4JI3 E;  2Q8U A;  2V85 A;  4DUZ E;  2RQL A;  4DV1 E;  1XNR E;  4M2Z A;  4OX9 E;  2M4I A;  2J7J A;  2EN2 A;  2B9D A;  2EMW A;  2EMZ A;  3EPL A;  2LTR A;  4LFB E;  4R2D A;  2EPX A;  2EOM A;  1ZAA C;  2V86 A;  1YUI A;  2YRK A;  4JI4 E;  3MSW A;  5A2Q C;  2WBU A;  2K7I A;  2K4V A;  1XNQ E;  2L92 A;  4R2P A;  1EH8 A;  1NEI A;  5IXM B;  5A6B A;  2M7Q A;  3L00 A;  4BCA A;  2EOH A;  4B3M E;  3FIG A;  5AE2 A;  1GTK A;  2EL4 A;  4DR6 E;  2L3J A;  2EM9 A;  1A1I A;  2EPZ A;  2BBG A;  1WRJ A;  3RMP A;  4DV4 E;  3ECR A;  2EM5 A;  5TSE A;  2EWL A;  3AV0 A;  2GHF A;  2ODR C;  2M9A A;  1T4O A;  4ZYH A;  1UIL A;  2UUB E;  4MLV A;  2RS7 A;  4X65 E;  1G2F C;  2FGG A;  2YTJ A;  2YRH A;  1TF6 A;  2RS6 A;  2EQ1 A;  3P1X A;  2LVH A;  3MHS C;  2UU9 E;  5KL2 A;  2YTD A;  5DNY A;  2EPR A;  5AAS A;  3IWC A;  4R8O A;  1P47 A;  2CPN A;  2LCE A;  2VRD A;  3HXL A;  2L2M A;  2JVA A;  3AUZ A;  2B7V A;  3C4B A;  4DV7 E;  2YSO A;  1X5W A;  2N3H A;  1SFE A;  4NZV A;  3H09 A;  2NAB A;  4YY3 E;  2EPA A;  5T6J A;  4R2C A;  5KL7 A;  2V83 A;  3HTX A;  2RPC A;  3BF2 A;  1IQS A;  2WCC 3;  2EM0 A;  3C6M A;  1FJG E;  2DMI A;  2NA2 A;  4RHB B;  5LLQ A;  4WSG A;  2N3G A;  1PJQ A;  4KWY A;  4F9B B;  1SR9 A;  2EMX A;  2H36 X;  4BC7 A;  2JR1 A;  3IWD A;  4LF6 E;  4L8N A;  2VQF E;  3ADL A;  2CSH A;  4DR5 E;  2UXC E;  2F4V E;  1J26 A;  1A1L A;  3J7A G;  4HTG A;  4K0K E;  1RMD A;  2EOJ A;  2DIX A;  4I8O A;  1PDA A;  5KL3 A;  2YT4 A;  4FK5 C;  2EPK X;  1QNT A;  4F2J C;  2MC5 A;  2CT1 A;  4KHP E;  4B3S E;  5LMN E;  2L33 A;  4WYQ B;  2YTP A;  1Z1B A;  2M1S A;  4OOG C;  2BB8 A;  2ODR D;  4DR2 E;  1A1K A;  1HR0 E;  1WJP A;  3T1H E;  2L2K B;  3THN A;  1X6F A;  4KZS A;  4DUY E;  4JI8 E;  1YPN A;  2A25 A;  2EPM X;  2WZO A;  5A6K A;  2YWQ A;  3F6G A;  5IWA E;  2EN6 A;  2EOQ A;  2PRT A;  1MEY C;  5AC4 A;  2EOZ A;  3KZZ A;  3ADG A;  2JOB A;  3JTZ A;  1HNX E;  2EMF A;  3K6Q A;  2ENA A;  1HNW E;  2EPU A;  1XMQ E;  1YYO A;  2EQ0 A;  2VE7 C;  3OML A;  3UK3 C;  2NUF A;  1X3C A;  1X47 A;  5KL4 A;  1JK1 A;  1PJT A;  2YU8 A;  2EPO A;  4F9A B;  2EOS A;  3OTO E;  1LLM C;  2R76 A;  4BS9 A;  2L2N A;  2UXD E;  4GKJ E;  4L5N C;  4LFC E;  2KOU A;  3KWR A;  3C6K A;  2LRS A;  4O4K A;  4JI5 E;  1NCS A;  4JI2 E;  3VYX A;  2IHR 1;  2RSM A;  3BBG A;  2LT7 A;  1T38 A;  2DMY A;  1A1H A;  5LMU E;  1EH6 A;  4DR3 E;  4M0V A;  2EOE A;  2HHH E;  4R2A A;  1DI2 A;  5LL6 R;  5KL6 A;  4M9V C;  3VYY A;  4Q35 B;  2V8Q B;  4LFA E;  4DR1 E;  2YTE A;  3MHH C;  2ENH A;  4ZYE A;  1IMU A;  4GEQ B;  4BHC A;  1FKA E;  2WBS A;  4DR4 E;  3J81 C;  1B69 A;  2MDR A;  1TN9 A;  1F2I G;  4F6N A;  1EKZ A;  4P78 A;  2EM2 A;  2HC5 A;  4WFT A;  2GPI A;  4X8W A;  4LF4 E;  2KON A;  4ZYD A;  4WPY A;  1L4S A;  3ADJ A;  1A1J A;  2YPN A;  1WHQ A;  3EPK A;  4O24 A;  2MKN A;  4X64 E;  2EN3 A;  4BC9 A;  2EP3 A;  5A6J A;  1YFH A;  4DV5 E;  4LF7 E;  3JU0 A;  2YTF A;  1YYW A;  1RQ0 A;  2CTD A;  4WXC A;  5BR8 E; 
#chains in the Genus database with same CATH homology
 4J8Z A;  1PKP A;  2UUA E;  3VK6 A;  2LUP B;  4KZS A;  2V87 A;  2M7Q A;  4DUY E;  1RC7 A;  4JI8 E;  4LF5 E;  4BCA A;  4BBY A;  2WZO A;  4BMJ A;  5IWA E;  3F6G A;  4B3M E;  3FIG A;  5AE2 A;  4TUI A;  4F54 A;  4DR6 E;  2L3J A;  4NXM E;  2V89 A;  2LUQ A;  1N33 E;  3ADG A;  4JI0 E;  2B7T A;  3RMP A;  2JOB A;  3JTZ A;  4X66 E;  2LBS B;  1WHN A;  4DV4 E;  4TUG A;  1HNX E;  1ZBQ A;  2LE2 A;  3C4T A;  3K6Q A;  3LLH A;  1GQE A;  4JI6 E;  2EWL A;  1HNW E;  3AV0 A;  1O0W A;  2ODR C;  2FV4 B;  1YYO A;  1XMQ E;  1T4O A;  2VE7 C;  1IBK E;  1UIL A;  1IBM E;  3OML A;  2UUB E;  2NUF A;  1X47 A;  4DMI A;  3J80 C;  3ADI A;  2RS7 A;  4X65 E;  2KHX A;  2FGG A;  4F9A B;  2YZT A;  4LF8 E;  2RS6 A;  5AE1 A;  3OTO E;  3P1X A;  4BS9 A;  2UU9 E;  2L2N A;  2UXD E;  2LTS A;  4GKJ E;  4L5N C;  4JI1 E;  3T1Y E;  1N34 E;  4LFC E;  2NUG A;  4LU9 A;  5DNY A;  1X49 A;  5AAS A;  2KOU A;  3KWR A;  3J7Y p;  3IWC A;  1GZ6 A;  4R8O A;  5AE3 A;  4DV3 E;  4B3T E;  2LRS A;  2CPN A;  4JI5 E;  2MC6 A;  4Q28 A;  2E1M A;  4X62 E;  1YYK A;  5F3W A;  1X48 A;  3HXL A;  2L2M A;  2JVA A;  3AUZ A;  2B7V A;  3C4B A;  4YHH E;  4DV7 E;  4AQY E;  1UHZ A;  4JI2 E;  3VYX A;  2L6M A;  4DR7 E;  1I94 E;  2N3H A;  2IHR 1;  2RSM A;  5FLX C;  4F9C B;  2DMY A;  3ZOQ B;  5LMU E;  4DV6 E;  4DR3 E;  3H09 A;  2L8T A;  4YY3 E;  5T6J A;  3HPZ A;  2V83 A;  4M0V A;  3HTX A;  2B3T B;  2HHH E;  1T4N A;  2FTX B;  4R03 A;  4JI7 E;  2UUC E;  1DI2 A;  5LL6 R;  3LML A;  5CFF E;  1FJG E;  2VQE E;  4DV0 E;  2NA2 A;  4M30 A;  3DJW A;  1IBL E;  3VYY A;  1STU A;  4LTY A;  2LJH A;  2N3G A;  4F9B B;  3F6H A;  2DB2 A;  4DV2 E;  1SR9 A;  2V8Q B;  4DKK A;  4DR1 E;  4LFA E;  2NUE A;  1T4L B;  2H36 X;  4GEQ B;  4BC7 A;  3JAM C;  2JR1 A;  3IWD A;  4P7D A;  4L8N A;  2VF1 A;  5ADZ A;  2VQF E;  1FKA E;  3HQ1 A;  4LF6 E;  3ADL A;  2JOX A;  2ZM6 E;  4DR4 E;  4WSP A;  1N36 E;  2E5L E;  1N32 E;  2V88 A;  1J5E E;  3IWB A;  3J81 C;  4B3R E;  1DQ3 A;  4DR5 E;  2UXC E;  3DF6 A;  2MDR A;  2JWO A;  2F4V E;  1J26 A;  1ZBT A;  1EKZ A;  3J7A G;  4P78 A;  4K0K E;  2UXB E;  4JI3 E;  4WFT A;  2V85 A;  3T1H E;  2DIX A;  3HPS A;  4I8O A;  4X8W A;  4DUZ E;  2YT4 A;  4LF4 E;  1XMO E;  1YZ9 A;  2EZ6 A;  2KON A;  4DV1 E;  4WPY A;  4NXN E;  1XNR E;  4JYA E;  2LMZ A;  3ADJ A;  2RTX A;  4M2Z A;  2MC5 A;  4OX9 E;  2M4I A;  1WHQ A;  4KHP E;  4LF9 E;  2B9D A;  4X64 E;  4B3S E;  5LMN E;  2L33 A;  4WYQ B;  4BC9 A;  2M1S A;  2LTR A;  4OOG C;  4LFB E;  2ODR D;  1QU6 A;  2L3C A;  5IT9 C;  4DR2 E;  4DV5 E;  1WXR A;  2G7H A;  2V86 A;  4LF7 E;  3JU0 A;  4JI4 E;  1YYW A;  4GKK E;  3MSW A;  1RQ0 A;  5A2Q C;  1HR0 E;  4JV5 E;  2K4V A;  2DSY A;  2JY9 A;  1XNQ E;  1HNZ E;  2F8B A;  5BR8 E;  2L92 A;  2L2K B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...