2YT4A

Crystal structure of human dgcr8 core
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
213
structure length
196
Chain Sequence
GSHMSVQDKKEFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECENPSEPFGASVTIDGVTYGSGTASSKKLAKNKAARATLEILIPDFVKQSEELEYFNHISIEDSRVYELTSKAGLLSPYQILHECLKRNHGMGDTSIKFEQKSEYVMACGKHTVRGWCKNKRVGKQLASQKILQLLHPHVKNWGSLLRMYGRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein DGCR8
publication title Crystal structure of human DGCR8 core
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 52
structure length 196
sequence length 213
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2yt4A02
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2yt4A03
3.30.160.590 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2yt4A01
2NUFA 4AQYE 5CFFE 4WFTA 4X65E 4JI6E 4DV4E 2L33A 2RSMA 1PKPA 4X62E 1GQEA 2MDRA 1IBME 4NXNE 2DMYA 1QU6A 1T4OA 4B3TE 1DI2A 2LUQA 4LFAE 4JI2E 4LFBE 2L2KB 2KHXA 5IWAE 1T4LB 4DR6E 2L2MA 1O0WA 4JV5E 1N33E 3P1XA 4JI7E 1STUA 2E5LE 2YT4A 2L3CA 4DR4E 4DR2E 1HNXE 2NA2A 3C4BA 3C4TA 1HNZE 2RS7A 3OTOE 1YYOA 2LRSA 4DV0E 2RTXA 2IHR1 2HHHE 4M2ZA 4NXME 4DR7E 4KHPE 1J5EE 4YY3E 1YYWA 3ADLA 4JI5E 2UXCE 4OX9E 2L3JA 1X47A 4LF5E 2B7TA 1XNRE 2EZ6A 2UXDE 3HTXA 2LJHA 4DR3E 2NUEA 1FKAE 2DIXA 4DV7E 4DKKA 2F4VE 1EKZA 1IBKE 2UU9E 4LF9E 4DV6E 1YZ9A 1T4NA 1WHQA 5BR8E 3ADIA 1XMQE 2NUGA 1ZBTA 1N36E 2UUBE 4GKKE 3T1HE 4X8WA 4GKJE 2LTRA 4LF7E 4LFCE 2VQEE 4JI0E 4DR5E 4LF6E 2UXBE 3ADGA 1N34E 4LF4E 4B3RE 4K0KE 2CPNA 4DV1E 1J26A 1X48A 3J7Yp 1HR0E 4DV5E 3VYXA 1RC7A 4X64E 1XMOE 4YHHE 2N3HA 4DR1E 2ZM6E 4JI4E 4DUYE 2N3GA 3LLHA 1FJGE 2B3TB 1I94E 3ADJA 5LMNE 4OOGC 4JYAE 1XNQE 4M30A 4WYQB 1HNWE 4DV3E 1IBLE 1RQ0A 2L2NA 3VYYA 2JY9A 2DB2A 4B3ME 4JI3E 4LF8E 1N32E 3T1YE 4B3SE 4JI1E 1UHZA 1WHNA 2LBSB 1YYKA 2LTSA 2RS6A 4DV2E 4X66E 2VQFE 1UILA 2JVAA 4JI8E 2UUAE 2B7VA 4DUZE 2LUPB 1X49A 2UUCE 5LMUE
chains in the Genus database with same CATH superfamily
4BBYA 2EM7A 1PJQA 2EOFA 2MDGA 1MGTA 1WXRA 4WFTA 2LV2A 1BB8A 2EM2A 1TF3A 2EOIA 2EQ1A 1B69A 2RPCA 2YTDA 1F2IG 1GQEA 1IBME 2DMYA 3HPSA 4BHBA 1T4OA 4B3TE 2ELYA 3H09A 2LUQA 1EH6A 2H36X 4BC9A 5LLQA 4LFBE 4P7DA 1UN6B 4BMJA 2EPLX 1N33E 2EOYA 1STUA 2E5LE 5IT9C 1A1JA 2L3CA 4DR4E 2R1FA 4X9JA 3C4TA 4TUIA 2YTEA 2D9HA 3OTOE 2M4IA 2LRSA 5DNYA 4NXME 2MC5A 2YTGA 2JR1A 4JI5E 1A1GA 3THNA 3ZOQB 2YU5A 1X47A 1XNRE 2EZ6A 4R2RA 2UXDE 5KL5A 2V88A 1FKAE 2DIXA 2EMIA 3L00A 1IBKE 2EL6A 4LF9E 2HJJA 3FIGA 1YSAC 2LMZA 2LE2A 2EMLA 1IMUA 2EMHA 2L6MA 1ZBTA 2YTJA 4GKKE 2UUBE 1KYQA 4O5GA 3T1HE 5A2QC 4M0VA 4BCAA 4KZSA 5AASA 1Z1BA 4JI0E 1JK1A 3JTZA 4LF4E 2WBTA 3KZZA 1BBGA 4DV1E 4F9AB 1EH7A 1X48A 3J7Yp 1RC7A 4X64E 1XMOE 3IWCA 4YHHE 2N3HA 4WSGA 3EPKA 4WPYA 1PJTA 2ZM6E 2N3GA 2EN7A 1FJGE 2B3TB 5LL6R 2PRTA 4M30A 4DV3E 2EN3A 2WCC3 2JYAA 2L2NA 2L92A 4R2SA 4GEQB 2ADRA 2EE8A 4O24A 4JI3E 1SR9A 3BIDA 2EM0A 2EOXA 5F3WA 4JI1E 1UHZA 2I13A 2ODRC 1WHNA 1GZ6A 2K7IA 2M7QA 1YYKA 2RSIA 1EH8A 2RS6A 4BHCA 1UILA 1A1IA 2E72A 2UUAE 5AE1A 4DUZE 2GLIA 2UUCE 2EPNA 3IWBA 3MSWA 2JOXA 3MHHC 2FTXB 2YRHA 5IXMB 3J7AG 4IS1C 2EM4A 2EMGA 4JI6E 2VF1A 3BBGA 1PKPA 1T38A 4NXNE 2V87A 4RHBB 3DF6A 1IQSA 3THOB 5KL3A 5AC4A 1DI2A 2E1MA 1X3CA 2YU8A 4MLQA 4MLVA 4JI2E 2I9IA 3C6KA 1NEIA 1ZU1A 2EWLA 2B9DA 3JU0A 1X6FA 2EOZA 5KL6A 2L2MA 1O0WA 2EPUA 3P1XA 4JI7E 4GZNC 1JK2A 1WRJA 1AH5A 2YSOA 2NA2A 5A69A 2EQ3A 3C4BA 1HNZE 2JWOA 3DJWA 1AAYA 2MC6A 4M2ZA 3ECRA 2EOEA 3BGHA 4DR7E 2EOOA 2EPPA 2EMYA 5KL4A 3KZYA 2EMZA 3ADLA 2EPOA 2EPRA 3VHTB 4DR3E 5TSEA 4DV7E 3BF2A 1DQ3A 2A25A 4HEIA 4WXCA 2JOBA 1YZ9A 1T4NA 3EPHA 5BR8E 2EM6A 1YPNA 1ZAAC 2NUGA 3F6GA 2ENAA 4NHRA 2KOUA 4R2EA 4LTYA 4X8WA 4WXDA 2LTRA 4LFCE 2EMAA 4M9VC 4DR5E 4LF6E 2UXBE 4KWYA 5KL2A 1WJPA 2CPNA 2LJUA 1RMDA 1J26A 5ADZA 2YRKA 1HR0E 2EMCA 2DGCA 4R2CA 4R2DA 4O4KA 4ZYDA 2YTQA 2JPAA 4DR1E 3LLHA 4ZYEA 2WZOA 2EM3A 1T39A 2EJ4A 1A1FA 3ADJA 4TUGA 1XNQE 1HNWE 2DLKA 3VYYA 2DB2A 1N32E 3T1YE 2EOHA 2YZTA 4J8ZA 1BBOA 2LTSA 2V89A 3HQ1A 4F2JC 2VQFE 2MKNA 3EQ1A 2B7VA 2CTDA 1X49A 4BC7A 3AUZA 2YWQA 4P78A 4AQYE 3LMLA 5CFFE 4X65E 2BBGA 3HPZA 4I8OA 2RSMA 4X62E 1TN9A 3EPJA 3AV0A 2EPKX 2N8XA 2V85A 1YUJA 4LFAE 3TQMA 2VE7C 1ZBQA 2L2KB 2KHXA 5AC5A 2FGGA 1X5WA 2JP9A 1UBDC 1P47A 2G7HA 4F9CB 2YT4A 2EMXA 2WBSA 1MEYC 3UK3C 3K6QA 4HTGA 3IWDA 3JAMC 2HHHE 2RTXA 2IHR1 1J5EE 2L8TA 4YY3E 1YYWA 2EMFA 2EOQA 2UXCE 4OX9E 2YTOA 4LF5E 1TF6A 2EOMA 2EOSA 2NUEA 2LO3A 4L8NA 4DKKA 2EPMX 2EPCA 2ENCA 4ZYGA 2EOJA 2K4VA 4IJDA 1L4SA 2ELZA 4BS9A 2GPIA 1XMQE 2EM8A 4R03A 4NZVA 1N36E 2YTNA 1KJKA 4GKJE 2DMIA 1N34E 2V86A 4R2AA 2M9AA 4DV5E 2YSPA 4N4RB 2HC5A 2EPZA 3HXLA 2KONA 1A1HA 1PDAA 4R2QA 4F6NA 1I94E 5AE3A 4OOGC 4JYAE 1YUIA 2EN8A 4WYQB 5A6KA 2LT7A 1RQ0A 4B3ME 4LF8E 2EN1A 2YTPA 4B3SE 1GTKA 2YRMA 3EPLA 4L5NC 2LBSB 3J80C 5KL7A 4DV2E 2JVAA 2EPAA 2EQ0A 4JI8E 2RQLA 2EM5A 2RS7A 5LMUE 4F6MA 2NUFA 5A6AA 2V8QB 2EL5A 4DV4E 2L33A 2EMKA 2MDRA 1QU6A 4DMIA 4ZYHA 4LU9A 5FLXC 1QNTA 2DRPA 2GHFA 5IV8B 3F6HA 2DLQA 1LLMC 5IWAE 1T4LB 1G2DC 4DR6E 4JV5E 2CSHA 2YTIA 1X6EA 2EMWA 1PJSA 3QG5C 4DR2E 1HNXE 1G2FC 2EPXA 2VRDA 3J81C 5AE2A 1A1LA 1YYOA 4DV0E 2EN4A 4KHPE 4O43A 2L3JA 1A1KA 2B7TA 5A6BD 2WBUA 2EM9A 2LJHA 3HTXA 1YFHA 1DGCA 2F4VE 3MHSC 4FK5C 1EKZA 1NCSA 5T6JA 2UU9E 4DV6E 2F8BA 2YTFA 3M99B 1WHQA 4WX9A 5A6BA 3ADIA 4F54A 3VK6A 2EL4A 4R8OA 3KWRA 4Q35B 2EMBA 5A6JA 4LF7E 2HGHA 1N3GA 2VQEE 4R2PA 4Q28A 3ADGA 4B3RE 4K0KE 2EP3A 1X6HA 1ZR9A 2V83A 2YPNA 3C6MA 3VYXA 2BB8A 2EORA 4RH8A 4F9BB 3RMPA 2DSYA 4JI4E 2LVHA 4DUYE 2LCEA 2JXPA 5LMNE 2R76A 2CT1A 2FV4B 1IBLE 1IQOA 2ENHA 2JY9A 3OMLA 2EN6A 2Q8UA 2NABA 2M1SA 4WSPA 2MKDA 2EN2A 4X66E 2J7JA 2ODRD 2LUPB 1SFEA
chains in the Genus database with same CATH topology
4BBYA 3IWBA 3MSWA 4BC7A 2NUFA 3AUZA 4P78A 2JOXA 2V8QB 4AQYE 2FTXB 3LMLA 5CFFE 1WXRA 3J7AG 4WFTA 4X65E 3HPZA 4I8OA 4JI6E 2VF1A 4DV4E 2L33A 2RSMA 1PKPA 4X62E 1GQEA 2MDRA 1IBME 4NXNE 2DMYA 1QU6A 2V87A 3HPSA 3DF6A 4DMIA 3AV0A 4LU9A 1T4OA 4B3TE 3H09A 5FLXC 1DI2A 2LUQA 2V85A 4LFAE 2E1MA 2H36X 4BC9A 4JI2E 2VE7C 4LFBE 1ZBQA 2EWLA 2B9DA 2L2KB 3JU0A 2KHXA 3F6HA 2FGGA 4P7DA 4BMJA 5IWAE 1T4LB 4DR6E 2L2MA 1O0WA 4JV5E 1N33E 3P1XA 4JI7E 1STUA 2G7HA 2E5LE 4F9CB 2YT4A 5IT9C 2L3CA 4DR4E 4DR2E 1HNXE 2NA2A 3K6QA 3IWDA 3C4BA 3C4TA 3J81C 3JAMC 1HNZE 4TUIA 2JWOA 3DJWA 5AE2A 3OTOE 2M4IA 2LRSA 2MC6A 2RTXA 2IHR1 5DNYA 4DV0E 1YYOA 2HHHE 4M2ZA 4NXME 4KHPE 4DR7E 2MC5A 1J5EE 2L8TA 4YY3E 1YYWA 2JR1A 3ADLA 4JI5E 2UXCE 4OX9E 3ZOQB 2L3JA 1X47A 4LF5E 2B7TA 1XNRE 2EZ6A 2UXDE 3HTXA 2LJHA 4DR3E 2V88A 2NUEA 1FKAE 2DIXA 4L8NA 4DKKA 4DV7E 2F4VE 1DQ3A 1EKZA 1IBKE 2JOBA 2K4VA 5T6JA 2UU9E 4LF9E 4DV6E 2F8BA 1YZ9A 1T4NA 3FIGA 2LMZA 1WHQA 2LE2A 5BR8E 4BS9A 3ADIA 4F54A 2L6MA 1XMQE 4R03A 2NUGA 1ZBTA 3F6GA 3VK6A 4R8OA 3KWRA 1N36E 2UUBE 2KOUA 4GKKE 4LTYA 3T1HE 4X8WA 5A2QC 4GKJE 4M0VA 2LTRA 4LF7E 4BCAA 4KZSA 5AASA 2VQEE 4LFCE 4JI0E 4Q28A 4DR5E 4LF6E 2UXBE 3ADGA 3JTZA 1N34E 4LF4E 4B3RE 4K0KE 2V86A 2CPNA 4DV1E 4F9AB 1J26A 1X48A 3J7Yp 2V83A 5ADZA 1HR0E 4DV5E 3VYXA 1RC7A 4X64E 1XMOE 3IWCA 4F9BB 3RMPA 3HXLA 2KONA 4YHHE 2N3HA 2DSYA 4WPYA 4DR1E 2ZM6E 4JI4E 4DUYE 2N3GA 3LLHA 1FJGE 2B3TB 2WZOA 5LL6R 5AE3A 1I94E 3ADJA 5LMNE 4OOGC 4JYAE 4TUGA 1XNQE 4M30A 2FV4B 4WYQB 1HNWE 4DV3E 1IBLE 1RQ0A 2L2NA 2L92A 3VYYA 2JY9A 2DB2A 4GEQB 4B3ME 4JI3E 4LF8E 3T1YE 4B3SE 1N32E 1SR9A 5F3WA 3OMLA 4JI1E 1UHZA 2ODRC 2YZTA 4J8ZA 1WHNA 2LUPB 4L5NC 1GZ6A 2LBSB 2M7QA 1YYKA 3J80C 2M1SA 4WSPA 2LTSA 2V89A 2RS6A 3HQ1A 4DV2E 5LMUE 4X66E 2VQFE 1UILA 2JVAA 4JI8E 2UUAE 2B7VA 2ODRD 5AE1A 1X49A 4DUZE 2UUCE 2RS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NUF A;  4AQY E;  5CFF E;  4WFT A;  4X65 E;  4JI6 E;  4DV4 E;  2L33 A;  2RSM A;  1PKP A;  4X62 E;  1GQE A;  2MDR A;  1IBM E;  4NXN E;  2DMY A;  1QU6 A;  1T4O A;  4B3T E;  1DI2 A;  2LUQ A;  4LFA E;  4JI2 E;  4LFB E;  2L2K B;  2KHX A;  5IWA E;  1T4L B;  4DR6 E;  2L2M A;  1O0W A;  4JV5 E;  1N33 E;  3P1X A;  4JI7 E;  1STU A;  2E5L E;  2YT4 A;  2L3C A;  4DR4 E;  4DR2 E;  1HNX E;  2NA2 A;  3C4B A;  3C4T A;  1HNZ E;  2RS7 A;  3OTO E;  1YYO A;  2LRS A;  4DV0 E;  2RTX A;  2IHR 1;  2HHH E;  4M2Z A;  4NXM E;  4DR7 E;  4KHP E;  1J5E E;  4YY3 E;  1YYW A;  3ADL A;  4JI5 E;  2UXC E;  4OX9 E;  2L3J A;  1X47 A;  4LF5 E;  2B7T A;  1XNR E;  2EZ6 A;  2UXD E;  3HTX A;  2LJH A;  4DR3 E;  2NUE A;  1FKA E;  2DIX A;  4DV7 E;  4DKK A;  2F4V E;  1EKZ A;  1IBK E;  2UU9 E;  4LF9 E;  4DV6 E;  1YZ9 A;  1T4N A;  1WHQ A;  5BR8 E;  3ADI A;  1XMQ E;  2NUG A;  1ZBT A;  1N36 E;  2UUB E;  4GKK E;  3T1H E;  4X8W A;  4GKJ E;  2LTR A;  4LF7 E;  4LFC E;  2VQE E;  4JI0 E;  4DR5 E;  4LF6 E;  2UXB E;  3ADG A;  1N34 E;  4LF4 E;  4B3R E;  4K0K E;  2CPN A;  4DV1 E;  1J26 A;  1X48 A;  3J7Y p;  1HR0 E;  4DV5 E;  3VYX A;  1RC7 A;  4X64 E;  1XMO E;  4YHH E;  2N3H A;  4DR1 E;  2ZM6 E;  4JI4 E;  4DUY E;  2N3G A;  3LLH A;  1FJG E;  2B3T B;  1I94 E;  3ADJ A;  5LMN E;  4OOG C;  4JYA E;  1XNQ E;  4M30 A;  4WYQ B;  1HNW E;  4DV3 E;  1IBL E;  1RQ0 A;  2L2N A;  3VYY A;  2JY9 A;  2DB2 A;  4B3M E;  4JI3 E;  4LF8 E;  1N32 E;  3T1Y E;  4B3S E;  4JI1 E;  1UHZ A;  1WHN A;  2LBS B;  1YYK A;  2LTS A;  2RS6 A;  4DV2 E;  4X66 E;  2VQF E;  1UIL A;  2JVA A;  4JI8 E;  2UUA E;  2B7V A;  4DUZ E;  2LUP B;  1X49 A;  2UUC E;  5LMU E; 
#chains in the Genus database with same CATH topology
 4BBY A;  2EM7 A;  1PJQ A;  2EOF A;  2MDG A;  1MGT A;  1WXR A;  4WFT A;  2LV2 A;  1BB8 A;  2EM2 A;  1TF3 A;  2EOI A;  2EQ1 A;  1B69 A;  2RPC A;  2YTD A;  1F2I G;  1GQE A;  1IBM E;  2DMY A;  3HPS A;  4BHB A;  1T4O A;  4B3T E;  2ELY A;  3H09 A;  2LUQ A;  1EH6 A;  2H36 X;  4BC9 A;  5LLQ A;  4LFB E;  4P7D A;  1UN6 B;  4BMJ A;  2EPL X;  1N33 E;  2EOY A;  1STU A;  2E5L E;  5IT9 C;  1A1J A;  2L3C A;  4DR4 E;  2R1F A;  4X9J A;  3C4T A;  4TUI A;  2YTE A;  2D9H A;  3OTO E;  2M4I A;  2LRS A;  5DNY A;  4NXM E;  2MC5 A;  2YTG A;  2JR1 A;  4JI5 E;  1A1G A;  3THN A;  3ZOQ B;  2YU5 A;  1X47 A;  1XNR E;  2EZ6 A;  4R2R A;  2UXD E;  5KL5 A;  2V88 A;  1FKA E;  2DIX A;  2EMI A;  3L00 A;  1IBK E;  2EL6 A;  4LF9 E;  2HJJ A;  3FIG A;  1YSA C;  2LMZ A;  2LE2 A;  2EML A;  1IMU A;  2EMH A;  2L6M A;  1ZBT A;  2YTJ A;  4GKK E;  2UUB E;  1KYQ A;  4O5G A;  3T1H E;  5A2Q C;  4M0V A;  4BCA A;  4KZS A;  5AAS A;  1Z1B A;  4JI0 E;  1JK1 A;  3JTZ A;  4LF4 E;  2WBT A;  3KZZ A;  1BBG A;  4DV1 E;  4F9A B;  1EH7 A;  1X48 A;  3J7Y p;  1RC7 A;  4X64 E;  1XMO E;  3IWC A;  4YHH E;  2N3H A;  4WSG A;  3EPK A;  4WPY A;  1PJT A;  2ZM6 E;  2N3G A;  2EN7 A;  1FJG E;  2B3T B;  5LL6 R;  2PRT A;  4M30 A;  4DV3 E;  2EN3 A;  2WCC 3;  2JYA A;  2L2N A;  2L92 A;  4R2S A;  4GEQ B;  2ADR A;  2EE8 A;  4O24 A;  4JI3 E;  1SR9 A;  3BID A;  2EM0 A;  2EOX A;  5F3W A;  4JI1 E;  1UHZ A;  2I13 A;  2ODR C;  1WHN A;  1GZ6 A;  2K7I A;  2M7Q A;  1YYK A;  2RSI A;  1EH8 A;  2RS6 A;  4BHC A;  1UIL A;  1A1I A;  2E72 A;  2UUA E;  5AE1 A;  4DUZ E;  2GLI A;  2UUC E;  2EPN A;  3IWB A;  3MSW A;  2JOX A;  3MHH C;  2FTX B;  2YRH A;  5IXM B;  3J7A G;  4IS1 C;  2EM4 A;  2EMG A;  4JI6 E;  2VF1 A;  3BBG A;  1PKP A;  1T38 A;  4NXN E;  2V87 A;  4RHB B;  3DF6 A;  1IQS A;  3THO B;  5KL3 A;  5AC4 A;  1DI2 A;  2E1M A;  1X3C A;  2YU8 A;  4MLQ A;  4MLV A;  4JI2 E;  2I9I A;  3C6K A;  1NEI A;  1ZU1 A;  2EWL A;  2B9D A;  3JU0 A;  1X6F A;  2EOZ A;  5KL6 A;  2L2M A;  1O0W A;  2EPU A;  3P1X A;  4JI7 E;  4GZN C;  1JK2 A;  1WRJ A;  1AH5 A;  2YSO A;  2NA2 A;  5A69 A;  2EQ3 A;  3C4B A;  1HNZ E;  2JWO A;  3DJW A;  1AAY A;  2MC6 A;  4M2Z A;  3ECR A;  2EOE A;  3BGH A;  4DR7 E;  2EOO A;  2EPP A;  2EMY A;  5KL4 A;  3KZY A;  2EMZ A;  3ADL A;  2EPO A;  2EPR A;  3VHT B;  4DR3 E;  5TSE A;  4DV7 E;  3BF2 A;  1DQ3 A;  2A25 A;  4HEI A;  4WXC A;  2JOB A;  1YZ9 A;  1T4N A;  3EPH A;  5BR8 E;  2EM6 A;  1YPN A;  1ZAA C;  2NUG A;  3F6G A;  2ENA A;  4NHR A;  2KOU A;  4R2E A;  4LTY A;  4X8W A;  4WXD A;  2LTR A;  4LFC E;  2EMA A;  4M9V C;  4DR5 E;  4LF6 E;  2UXB E;  4KWY A;  5KL2 A;  1WJP A;  2CPN A;  2LJU A;  1RMD A;  1J26 A;  5ADZ A;  2YRK A;  1HR0 E;  2EMC A;  2DGC A;  4R2C A;  4R2D A;  4O4K A;  4ZYD A;  2YTQ A;  2JPA A;  4DR1 E;  3LLH A;  4ZYE A;  2WZO A;  2EM3 A;  1T39 A;  2EJ4 A;  1A1F A;  3ADJ A;  4TUG A;  1XNQ E;  1HNW E;  2DLK A;  3VYY A;  2DB2 A;  1N32 E;  3T1Y E;  2EOH A;  2YZT A;  4J8Z A;  1BBO A;  2LTS A;  2V89 A;  3HQ1 A;  4F2J C;  2VQF E;  2MKN A;  3EQ1 A;  2B7V A;  2CTD A;  1X49 A;  4BC7 A;  3AUZ A;  2YWQ A;  4P78 A;  4AQY E;  3LML A;  5CFF E;  4X65 E;  2BBG A;  3HPZ A;  4I8O A;  2RSM A;  4X62 E;  1TN9 A;  3EPJ A;  3AV0 A;  2EPK X;  2N8X A;  2V85 A;  1YUJ A;  4LFA E;  3TQM A;  2VE7 C;  1ZBQ A;  2L2K B;  2KHX A;  5AC5 A;  2FGG A;  1X5W A;  2JP9 A;  1UBD C;  1P47 A;  2G7H A;  4F9C B;  2YT4 A;  2EMX A;  2WBS A;  1MEY C;  3UK3 C;  3K6Q A;  4HTG A;  3IWD A;  3JAM C;  2HHH E;  2RTX A;  2IHR 1;  1J5E E;  2L8T A;  4YY3 E;  1YYW A;  2EMF A;  2EOQ A;  2UXC E;  4OX9 E;  2YTO A;  4LF5 E;  1TF6 A;  2EOM A;  2EOS A;  2NUE A;  2LO3 A;  4L8N A;  4DKK A;  2EPM X;  2EPC A;  2ENC A;  4ZYG A;  2EOJ A;  2K4V A;  4IJD A;  1L4S A;  2ELZ A;  4BS9 A;  2GPI A;  1XMQ E;  2EM8 A;  4R03 A;  4NZV A;  1N36 E;  2YTN A;  1KJK A;  4GKJ E;  2DMI A;  1N34 E;  2V86 A;  4R2A A;  2M9A A;  4DV5 E;  2YSP A;  4N4R B;  2HC5 A;  2EPZ A;  3HXL A;  2KON A;  1A1H A;  1PDA A;  4R2Q A;  4F6N A;  1I94 E;  5AE3 A;  4OOG C;  4JYA E;  1YUI A;  2EN8 A;  4WYQ B;  5A6K A;  2LT7 A;  1RQ0 A;  4B3M E;  4LF8 E;  2EN1 A;  2YTP A;  4B3S E;  1GTK A;  2YRM A;  3EPL A;  4L5N C;  2LBS B;  3J80 C;  5KL7 A;  4DV2 E;  2JVA A;  2EPA A;  2EQ0 A;  4JI8 E;  2RQL A;  2EM5 A;  2RS7 A;  5LMU E;  4F6M A;  2NUF A;  5A6A A;  2V8Q B;  2EL5 A;  4DV4 E;  2L33 A;  2EMK A;  2MDR A;  1QU6 A;  4DMI A;  4ZYH A;  4LU9 A;  5FLX C;  1QNT A;  2DRP A;  2GHF A;  5IV8 B;  3F6H A;  2DLQ A;  1LLM C;  5IWA E;  1T4L B;  1G2D C;  4DR6 E;  4JV5 E;  2CSH A;  2YTI A;  1X6E A;  2EMW A;  1PJS A;  3QG5 C;  4DR2 E;  1HNX E;  1G2F C;  2EPX A;  2VRD A;  3J81 C;  5AE2 A;  1A1L A;  1YYO A;  4DV0 E;  2EN4 A;  4KHP E;  4O43 A;  2L3J A;  1A1K A;  2B7T A;  5A6B D;  2WBU A;  2EM9 A;  2LJH A;  3HTX A;  1YFH A;  1DGC A;  2F4V E;  3MHS C;  4FK5 C;  1EKZ A;  1NCS A;  5T6J A;  2UU9 E;  4DV6 E;  2F8B A;  2YTF A;  3M99 B;  1WHQ A;  4WX9 A;  5A6B A;  3ADI A;  4F54 A;  3VK6 A;  2EL4 A;  4R8O A;  3KWR A;  4Q35 B;  2EMB A;  5A6J A;  4LF7 E;  2HGH A;  1N3G A;  2VQE E;  4R2P A;  4Q28 A;  3ADG A;  4B3R E;  4K0K E;  2EP3 A;  1X6H A;  1ZR9 A;  2V83 A;  2YPN A;  3C6M A;  3VYX A;  2BB8 A;  2EOR A;  4RH8 A;  4F9B B;  3RMP A;  2DSY A;  4JI4 E;  2LVH A;  4DUY E;  2LCE A;  2JXP A;  5LMN E;  2R76 A;  2CT1 A;  2FV4 B;  1IBL E;  1IQO A;  2ENH A;  2JY9 A;  3OML A;  2EN6 A;  2Q8U A;  2NAB A;  2M1S A;  4WSP A;  2MKD A;  2EN2 A;  4X66 E;  2J7J A;  2ODR D;  2LUP B;  1SFE A; 
#chains in the Genus database with same CATH homology
 4BBY A;  3IWB A;  3MSW A;  4BC7 A;  2NUF A;  3AUZ A;  4P78 A;  2JOX A;  2V8Q B;  4AQY E;  2FTX B;  3LML A;  5CFF E;  1WXR A;  3J7A G;  4WFT A;  4X65 E;  3HPZ A;  4I8O A;  4JI6 E;  2VF1 A;  4DV4 E;  2L33 A;  2RSM A;  1PKP A;  4X62 E;  1GQE A;  2MDR A;  1IBM E;  4NXN E;  2DMY A;  1QU6 A;  2V87 A;  3HPS A;  3DF6 A;  4DMI A;  3AV0 A;  4LU9 A;  1T4O A;  4B3T E;  3H09 A;  5FLX C;  1DI2 A;  2LUQ A;  2V85 A;  4LFA E;  2E1M A;  2H36 X;  4BC9 A;  4JI2 E;  2VE7 C;  4LFB E;  1ZBQ A;  2EWL A;  2B9D A;  2L2K B;  3JU0 A;  2KHX A;  3F6H A;  2FGG A;  4P7D A;  4BMJ A;  5IWA E;  1T4L B;  4DR6 E;  2L2M A;  1O0W A;  4JV5 E;  1N33 E;  3P1X A;  4JI7 E;  1STU A;  2G7H A;  2E5L E;  4F9C B;  2YT4 A;  5IT9 C;  2L3C A;  4DR4 E;  4DR2 E;  1HNX E;  2NA2 A;  3K6Q A;  3IWD A;  3C4B A;  3C4T A;  3J81 C;  3JAM C;  1HNZ E;  4TUI A;  2JWO A;  3DJW A;  5AE2 A;  3OTO E;  2M4I A;  2LRS A;  2MC6 A;  2RTX A;  2IHR 1;  5DNY A;  4DV0 E;  1YYO A;  2HHH E;  4M2Z A;  4NXM E;  4KHP E;  4DR7 E;  2MC5 A;  1J5E E;  2L8T A;  4YY3 E;  1YYW A;  2JR1 A;  3ADL A;  4JI5 E;  2UXC E;  4OX9 E;  3ZOQ B;  2L3J A;  1X47 A;  4LF5 E;  2B7T A;  1XNR E;  2EZ6 A;  2UXD E;  3HTX A;  2LJH A;  4DR3 E;  2V88 A;  2NUE A;  1FKA E;  2DIX A;  4L8N A;  4DKK A;  4DV7 E;  2F4V E;  1DQ3 A;  1EKZ A;  1IBK E;  2JOB A;  2K4V A;  5T6J A;  2UU9 E;  4LF9 E;  4DV6 E;  2F8B A;  1YZ9 A;  1T4N A;  3FIG A;  2LMZ A;  1WHQ A;  2LE2 A;  5BR8 E;  4BS9 A;  3ADI A;  4F54 A;  2L6M A;  1XMQ E;  4R03 A;  2NUG A;  1ZBT A;  3F6G A;  3VK6 A;  4R8O A;  3KWR A;  1N36 E;  2UUB E;  2KOU A;  4GKK E;  4LTY A;  3T1H E;  4X8W A;  5A2Q C;  4GKJ E;  4M0V A;  2LTR A;  4LF7 E;  4BCA A;  4KZS A;  5AAS A;  2VQE E;  4LFC E;  4JI0 E;  4Q28 A;  4DR5 E;  4LF6 E;  2UXB E;  3ADG A;  3JTZ A;  1N34 E;  4LF4 E;  4B3R E;  4K0K E;  2V86 A;  2CPN A;  4DV1 E;  4F9A B;  1J26 A;  1X48 A;  3J7Y p;  2V83 A;  5ADZ A;  1HR0 E;  4DV5 E;  3VYX A;  1RC7 A;  4X64 E;  1XMO E;  3IWC A;  4F9B B;  3RMP A;  3HXL A;  2KON A;  4YHH E;  2N3H A;  2DSY A;  4WPY A;  4DR1 E;  2ZM6 E;  4JI4 E;  4DUY E;  2N3G A;  3LLH A;  1FJG E;  2B3T B;  2WZO A;  5LL6 R;  5AE3 A;  1I94 E;  3ADJ A;  5LMN E;  4OOG C;  4JYA E;  4TUG A;  1XNQ E;  4M30 A;  2FV4 B;  4WYQ B;  1HNW E;  4DV3 E;  1IBL E;  1RQ0 A;  2L2N A;  2L92 A;  3VYY A;  2JY9 A;  2DB2 A;  4GEQ B;  4B3M E;  4JI3 E;  4LF8 E;  3T1Y E;  4B3S E;  1N32 E;  1SR9 A;  5F3W A;  3OML A;  4JI1 E;  1UHZ A;  2ODR C;  2YZT A;  4J8Z A;  1WHN A;  2LUP B;  4L5N C;  1GZ6 A;  2LBS B;  2M7Q A;  1YYK A;  3J80 C;  2M1S A;  4WSP A;  2LTS A;  2V89 A;  2RS6 A;  3HQ1 A;  4DV2 E;  5LMU E;  4X66 E;  2VQF E;  1UIL A;  2JVA A;  4JI8 E;  2UUA E;  2B7V A;  2ODR D;  5AE1 A;  1X49 A;  4DUZ E;  2UUC E;  2RS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...