2YT4A

Crystal structure of human dgcr8 core
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
213
structure length
196
Chain Sequence
GSHMSVQDKKEFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECENPSEPFGASVTIDGVTYGSGTASSKKLAKNKAARATLEILIPDFVKQSEELEYFNHISIEDSRVYELTSKAGLLSPYQILHECLKRNHGMGDTSIKFEQKSEYVMACGKHTVRGWCKNKRVGKQLASQKILQLLHPHVKNWGSLLRMYGRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Protein DGCR8
publication title Crystal structure of human DGCR8 core
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 196
sequence length 213
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2yt4A02
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2yt4A03
3.30.160.590 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2yt4A01
2ZM6E 1HR0E 4LFAE 4LF9E 2B7VA 4DV4E 3C4TA 4OOGC 2UUAE 1RC7A 2NA2A 4DUZE 2L3JA 1STUA 4K0KE 1GQEA 5LMUE 2MDRA 1UHZA 2RTXA 3VYYA 1WHQA 2NUEA 2LUQA 1XNQE 1J26A 2DIXA 4OX9E 1IBME 1HNZE 2DB2A 2YT4A 4JI3E 2JVAA 4LF7E 3OTOE 3T1YE 2N3HA 4JI4E 1PKPA 3P1XA 3J7Yp 4DR6E 1UILA 4X65E 5LMNE 4JI2E 4JI1E 2LTRA 4DV1E 1EKZA 4DV6E 4M30A 4JI0E 4X64E 5IWAE 4B3SE 2EZ6A 2LRSA 2B7TA 2CPNA 2LJHA 4LF6E 2DMYA 2N3GA 2RS7A 1N36E 1YYKA 1XNRE 4YY3E 4DR2E 4WFTA 1DI2A 4JI7E 4DUYE 4JI8E 4NXME 1X48A 4DR5E 4DV5E 4DR4E 3C4BA 4LFCE 2KHXA 2VQEE 1IBKE 1T4NA 1N32E 4DR1E 1HNXE 1I94E 2L3CA 4DV2E 2LBSB 2LTSA 4WYQB 5BR8E 4KHPE 1N34E 2NUGA 2UUBE 4DV0E 4JI6E 1HNWE 4X62E 1FKAE 2F4VE 4DV7E 3ADGA 2L2KB 1X47A 2UU9E 2VQFE 2RS6A 4B3ME 4NXNE 2UXCE 2L33A 2B3TB 1QU6A 2UXDE 3T1HE 2LUPB 2HHHE 1O0WA 4JI5E 4GKKE 4LF4E 3VYXA 2L2NA 1T4LB 1YZ9A 2UXBE 2JY9A 3LLHA 4X8WA 4GKJE 1RQ0A 1XMOE 1X49A 4DKKA 3HTXA 4M2ZA 4AQYE 1T4OA 1YYWA 4DV3E 3ADLA 3ADJA 4DR7E 4JV5E 1YYOA 4LF8E 2UUCE 2L2MA 1WHNA 2E5LE 4YHHE 5CFFE 1J5EE 4B3RE 2IHR1 1IBLE 4X66E 2RSMA 4LFBE 1ZBTA 4JYAE 1N33E 1FJGE 2NUFA 4DR3E 1XMQE 4LF5E 3ADIA 4B3TE
chains in the Genus database with same CATH superfamily
2EJ4A 3TQMA 3C4TA 2EQ0A 1EH7A 2EPOA 3EPKA 1A1JA 2EE8A 4DUZE 2DGCA 1EH6A 2VF1A 2NUEA 3IWDA 2EOMA 3VYYA 2LUQA 5AE1A 2N8XA 1XNQE 2GPIA 5KL4A 4F9BB 1X3CA 1MGTA 2YT4A 4JI3E 4J8ZA 3P1XA 4DR6E 2E1MA 4IS1C 4X65E 4Q35B 2ADRA 2NABA 2JOBA 2KONA 2WCC3 2ENHA 2EP3A 4FK5C 3ZOQB 4B3SE 3KWRA 2EMGA 3THOB 5T6JA 2YTDA 2EN2A 2LRSA 1NCSA 1T38A 1TF3A 2N3GA 1N36E 4YY3E 4DR2E 3FIGA 3MSWA 4R2AA 4TUIA 4F6NA 4ZYHA 4BC9A 1X48A 2CT1A 2EPLX 4DV5E 2EORA 1N32E 2V83A 2EOOA 4KWYA 4WXCA 2L3CA 3QG5C 2LTSA 2ENCA 4KHPE 1BBGA 2EMWA 2EMKA 3HPSA 2EL6A 4DV0E 4JI6E 4IJDA 2EMCA 3HQ1A 2DLQA 4LF4E 3VYXA 2L2NA 2V86A 2EOQA 2YSPA 4BMJA 1RQ0A 2L92A 1X49A 2WBSA 4P7DA 4DV3E 4F9CB 2EN4A 3F6GA 4MLVA 4YHHE 1J5EE 4NHRA 4X66E 2G7HA 2K4VA 1PDAA 2M9AA 2MC5A 4LFBE 5KL6A 1ZBTA 3DJWA 2EPZA 2ELYA 3JTZA 1DGCA 3M99B 1XMQE 4LF5E 3ADIA 5A2QC 2B7VA 4DV4E 4BS9A 2UUAE 1NEIA 2F8BA 3RMPA 4L5NC 4F6MA 2YTOA 2WBUA 3EPHA 1STUA 2B9DA 3BBGA 3MHSC 1A1FA 2LJUA 1A1KA 4F2JC 2MKDA 1HNZE 2JR1A 2YTEA 4LU9A 3ECRA 3T1YE 1PKPA 1IQSA 2DLKA 3J7Yp 5LMNE 1ZU1A 2DMIA 4HTGA 2ELZA 2YWQA 3HXLA 1EKZA 4M30A 2EM8A 4O24A 4O43A 2JP9A 2EZ6A 2M1SA 3AV0A 1AH5A 4R8OA 2EPCA 2EPXA 2YTPA 4R2QA 2YRKA 1BBOA 2EMZA 4R2PA 1YYKA 1X5WA 4WFTA 4DUYE 2EMLA 4WSPA 2YSOA 3THNA 4DR5E 4LFCE 2JOXA 3K6QA 2LE2A 2EOZA 5LL6R 5AE3A 3DF6A 1HNXE 1IMUA 4BCAA 5A69A 5KL5A 2VRDA 2YTFA 2YTGA 2J7JA 3IWBA 1N34E 2UUBE 2DSYA 2LMZA 2V88A 1FKAE 4LTYA 1X47A 1JK2A 2VQFE 2UXCE 2EM7A 4O4KA 2YU8A 3HPZA 3EQ1A 1YZ9A 2BB8A 2EL4A 2JY9A 2EPUA 2I13A 4RH8A 5AE2A 2EWLA 2JYAA 3HTXA 1T4OA 1T39A 1A1IA 1YUJA 3ADJA 4JV5E 1YYOA 4LF8E 2EPAA 1YUIA 2JPAA 2L2MA 4BC7A 4WXDA 5AC5A 2IHR1 1KJKA 4NZVA 4ZYDA 5F3WA 4R2SA 1YFHA 3MHHC 2FV4B 1UN6B 4LF9E 4OOGC 2EOYA 2NA2A 5LLQA 2EM5A 1PJTA 5KL3A 3F6HA 2MDGA 3H09A 4M0VA 4K0KE 2EPNA 2Q8UA 5LMUE 2MDRA 2RTXA 4GZNC 1WHQA 2FGGA 3JU0A 1ZR9A 2DIXA 4OX9E 4R2EA 1IBME 2DB2A 4ZYGA 4WX9A 1A1GA 1DQ3A 4R2CA 2E72A 3OMLA 1UILA 1ZBQA 2EOJA 1A1HA 2ODRD 2LCEA 2YTNA 2CTDA 2EM0A 2EOSA 4JI1E 2LTRA 3C6KA 4DV1E 2RPCA 4DV6E 2WBTA 4JI0E 1PJSA 4X64E 2MKNA 2V8QB 2EMIA 4WSGA 2DRPA 1N3GA 2B7TA 4O5GA 3IWCA 2CPNA 2ENAA 2EQ3A 2LJHA 2DMYA 2EMYA 1XNRE 2YZTA 1DI2A 3KZYA 2PRTA 3BIDA 2I9IA 4ZYEA 4DR4E 3C4BA 2WZOA 2EMAA 4Q28A 1T4NA 4DR1E 4DV2E 2LT7A 1LLMC 2LBSB 4WYQB 2D9HA 2EN1A 2VE7C 2NUGA 2R76A 1HNWE 3C6MA 2F4VE 1WJPA 4DV7E 1B69A 3ADGA 4R2RA 2L2KB 5A6BA 1IQOA 4NXNE 1YPNA 2ODRC 3T1HE 2EN7A 3J81C 2CSHA 2LUPB 2HHHE 4JI5E 1AAYA 1T4LB 4MLQA 2LV2A 2UXBE 2M7QA 3LLHA 1X6HA 4X8WA 2EL5A 1TN9A 4GKJE 2YTQA 4DMIA 2V85A 5AASA 4AQYE 1GTKA 1A1LA 5AC4A 2RSIA 2M4IA 5A6AA 3EPJA 1WHNA 4M9VC 2E5LE 5ADZA 4B3RE 4P78A 2EOXA 1IBLE 1WRJA 4JYAE 1N33E 4TUGA 4KZSA 2EM9A 1SR9A 2ZM6E 1HR0E 4LFAE 1SFEA 2GHFA 1RC7A 2EPPA 5IV8B 2HJJA 2EPRA 4X9JA 2L3JA 1Z1BA 1F2IG 2EM6A 1L4SA 1GQEA 1GZ6A 2R1FA 1UHZA 1PJQA 4R2DA 1J26A 5DNYA 5IXMB 2EOEA 3VHTB 2JVAA 3JAMC 3OTOE 4JI4E 2N3HA 4LF7E 1P47A 3UK3C 4JI2E 5IT9C 2GLIA 2HC5A 2EMFA 4GEQB 5TSEA 1RMDA 5KL7A 4BHBA 5IWAE 3AUZA 3EPLA 4BHCA 4WPYA 2HGHA 2LO3A 4BBYA 1X6EA 2YTIA 1MEYC 1JK1A 4LF6E 3LMLA 2RS7A 4F54A 2EMBA 4JI7E 2YRMA 4JI8E 2A25A 1TF6A 4L8NA 1G2DC 5FLXC 1UBDC 4NXME 2JXPA 2EN8A 3J80C 2KHXA 2VQEE 2EPMX 1IBKE 4HEIA 2K7IA 1I94E 2EM4A 1BB8A 5A6BD 5BR8E 2EMHA 2V87A 5A6JA 2KOUA 2EOFA 2L6MA 2JWOA 2EOIA 4X62E 2FTXB 2H36X 2YU5A 1QNTA 2LVHA 2RQLA 2UU9E 3VK6A 2RS6A 4B3ME 2L33A 3J7AG 2B3TB 1QU6A 2YPNA 5A6KA 2UXDE 4GKKE 1O0WA 1EH8A 1X6FA 1WXRA 2EM3A 4I8OA 1G2FC 4R03A 1XMOE 1ZAAC 3BF2A 2EMXA 4DKKA 2EOHA 4M2ZA 1YYWA 4RHBB 2MC6A 2V89A 3ADLA 4DR7E 3KZZA 2UUCE 4N4RB 2YTJA 4F9AB 2EM2A 2EN3A 5CFFE 3BGHA 2EQ1A 2RSMA 3L00A 1YSAC 1KYQA 2L8TA 2YRHA 1FJGE 2EN6A 2NUFA 5KL2A 2EPKX 4DR3E 4B3TE 2BBGA
chains in the Genus database with same CATH topology
2ZM6E 5A2QC 1HR0E 4LFAE 4LF9E 2B7VA 4DV4E 3C4TA 4OOGC 4BS9A 2UUAE 1RC7A 2F8BA 3RMPA 2NA2A 4L5NC 4DUZE 3F6HA 2L3JA 1STUA 2B9DA 3H09A 2VF1A 4M0VA 4K0KE 1GQEA 1GZ6A 2MDRA 1UHZA 2RTXA 3IWDA 1WHQA 5LMUE 3VYYA 2FGGA 2LUQA 5AE1A 1XNQE 3JU0A 1J26A 2DIXA 5DNYA 4F9BB 1IBME 1HNZE 4OX9E 2DB2A 2JR1A 4LU9A 2YT4A 4JI3E 2JVAA 3JAMC 3OTOE 3T1YE 1DQ3A 2N3HA 1PKPA 3P1XA 4J8ZA 4JI4E 3J7Yp 4DR6E 2E1MA 3OMLA 1UILA 4X65E 5LMNE 5IT9C 1ZBQA 4JI2E 2ODRD 4GEQB 4JI1E 2JOBA 2LTRA 3HXLA 2KONA 4DV1E 1EKZA 4DV6E 4M30A 4JI0E 4LF7E 4X64E 3ZOQB 5IWAE 2V8QB 4B3SE 3KWRA 3AUZA 2EZ6A 2M1SA 3AV0A 5T6JA 4R8OA 4WPYA 2LRSA 4BBYA 2B7TA 3IWCA 2CPNA 2LJHA 4LF6E 2DMYA 2N3GA 2RS7A 3LMLA 4F54A 1N36E 2YZTA 4YY3E 4DR2E 1XNRE 4WFTA 3FIGA 1YYKA 3MSWA 4TUIA 1DI2A 4JI7E 4DUYE 4JI8E 4BC9A 4L8NA 4WSPA 5FLXC 4NXME 1X48A 4DR5E 4DV5E 4DR4E 3C4BA 3J80C 2KHXA 2WZOA 4LFCE 2VQEE 2JOXA 4Q28A 1IBKE 3K6QA 2LE2A 1T4NA 5LL6R 5AE3A 2V83A 3DF6A 4DR1E 1HNXE 1I94E 1N32E 2L3CA 4DV2E 2LBSB 4BCAA 2LTSA 4WYQB 5BR8E 3IWBA 4KHPE 2V87A 2VE7C 2KOUA 1N34E 2NUGA 2UUBE 3HPSA 2DSYA 2L6MA 4DV0E 2JWOA 2LMZA 4JI6E 1HNWE 4X62E 2V88A 2FTXB 2H36X 4LTYA 1FKAE 2F4VE 4DV7E 3ADGA 3HQ1A 2L2KB 1X47A 2UU9E 3VK6A 2VQFE 2RS6A 4B3ME 4NXNE 2UXCE 2L33A 3J7AG 2B3TB 1QU6A 2ODRC 2UXDE 3T1HE 3J81C 2LUPB 1O0WA 2HHHE 4JI5E 3HPZA 4GKKE 4LF4E 3VYXA 2L2NA 1T4LB 1YZ9A 1WXRA 2UXBE 2JY9A 2V86A 4I8OA 2M7QA 3LLHA 4X8WA 4BMJA 4R03A 5AE2A 4GKJE 4DMIA 1RQ0A 1XMOE 2L92A 2EWLA 2V85A 5AASA 1X49A 4DKKA 3HTXA 4M2ZA 4AQYE 1T4OA 4P7DA 1YYWA 4DV3E 2MC6A 2V89A 3ADJA 4F9CB 3ADLA 4DR7E 4JV5E 1YYOA 4LF8E 2UUCE 2M4IA 2L2MA 4F9AB 1WHNA 4BC7A 3F6GA 2E5LE 4YHHE 5CFFE 1J5EE 5ADZA 4B3RE 2IHR1 4P78A 1IBLE 4X66E 2G7HA 2K4VA 2RSMA 2MC5A 4LFBE 1ZBTA 5F3WA 4JYAE 2NUEA 1N33E 4TUGA 2L8TA 1FJGE 3DJWA 4KZSA 2NUFA 3JTZA 2FV4B 4DR3E 1SR9A 1XMQE 4LF5E 3ADIA 4B3TE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZM6 E;  1HR0 E;  4LFA E;  4LF9 E;  2B7V A;  4DV4 E;  3C4T A;  4OOG C;  2UUA E;  1RC7 A;  2NA2 A;  4DUZ E;  2L3J A;  1STU A;  4K0K E;  1GQE A;  5LMU E;  2MDR A;  1UHZ A;  2RTX A;  3VYY A;  1WHQ A;  2NUE A;  2LUQ A;  1XNQ E;  1J26 A;  2DIX A;  4OX9 E;  1IBM E;  1HNZ E;  2DB2 A;  2YT4 A;  4JI3 E;  2JVA A;  4LF7 E;  3OTO E;  3T1Y E;  2N3H A;  4JI4 E;  1PKP A;  3P1X A;  3J7Y p;  4DR6 E;  1UIL A;  4X65 E;  5LMN E;  4JI2 E;  4JI1 E;  2LTR A;  4DV1 E;  1EKZ A;  4DV6 E;  4M30 A;  4JI0 E;  4X64 E;  5IWA E;  4B3S E;  2EZ6 A;  2LRS A;  2B7T A;  2CPN A;  2LJH A;  4LF6 E;  2DMY A;  2N3G A;  2RS7 A;  1N36 E;  1YYK A;  1XNR E;  4YY3 E;  4DR2 E;  4WFT A;  1DI2 A;  4JI7 E;  4DUY E;  4JI8 E;  4NXM E;  1X48 A;  4DR5 E;  4DV5 E;  4DR4 E;  3C4B A;  4LFC E;  2KHX A;  2VQE E;  1IBK E;  1T4N A;  1N32 E;  4DR1 E;  1HNX E;  1I94 E;  2L3C A;  4DV2 E;  2LBS B;  2LTS A;  4WYQ B;  5BR8 E;  4KHP E;  1N34 E;  2NUG A;  2UUB E;  4DV0 E;  4JI6 E;  1HNW E;  4X62 E;  1FKA E;  2F4V E;  4DV7 E;  3ADG A;  2L2K B;  1X47 A;  2UU9 E;  2VQF E;  2RS6 A;  4B3M E;  4NXN E;  2UXC E;  2L33 A;  2B3T B;  1QU6 A;  2UXD E;  3T1H E;  2LUP B;  2HHH E;  1O0W A;  4JI5 E;  4GKK E;  4LF4 E;  3VYX A;  2L2N A;  1T4L B;  1YZ9 A;  2UXB E;  2JY9 A;  3LLH A;  4X8W A;  4GKJ E;  1RQ0 A;  1XMO E;  1X49 A;  4DKK A;  3HTX A;  4M2Z A;  4AQY E;  1T4O A;  1YYW A;  4DV3 E;  3ADL A;  3ADJ A;  4DR7 E;  4JV5 E;  1YYO A;  4LF8 E;  2UUC E;  2L2M A;  1WHN A;  2E5L E;  4YHH E;  5CFF E;  1J5E E;  4B3R E;  2IHR 1;  1IBL E;  4X66 E;  2RSM A;  4LFB E;  1ZBT A;  4JYA E;  1N33 E;  1FJG E;  2NUF A;  4DR3 E;  1XMQ E;  4LF5 E;  3ADI A;  4B3T E; 
#chains in the Genus database with same CATH topology
 2EJ4 A;  3TQM A;  3C4T A;  2EQ0 A;  1EH7 A;  2EPO A;  3EPK A;  1A1J A;  2EE8 A;  4DUZ E;  2DGC A;  1EH6 A;  2VF1 A;  2NUE A;  3IWD A;  2EOM A;  3VYY A;  2LUQ A;  5AE1 A;  2N8X A;  1XNQ E;  2GPI A;  5KL4 A;  4F9B B;  1X3C A;  1MGT A;  2YT4 A;  4JI3 E;  4J8Z A;  3P1X A;  4DR6 E;  2E1M A;  4IS1 C;  4X65 E;  4Q35 B;  2ADR A;  2NAB A;  2JOB A;  2KON A;  2WCC 3;  2ENH A;  2EP3 A;  4FK5 C;  3ZOQ B;  4B3S E;  3KWR A;  2EMG A;  3THO B;  5T6J A;  2YTD A;  2EN2 A;  2LRS A;  1NCS A;  1T38 A;  1TF3 A;  2N3G A;  1N36 E;  4YY3 E;  4DR2 E;  3FIG A;  3MSW A;  4R2A A;  4TUI A;  4F6N A;  4ZYH A;  4BC9 A;  1X48 A;  2CT1 A;  2EPL X;  4DV5 E;  2EOR A;  1N32 E;  2V83 A;  2EOO A;  4KWY A;  4WXC A;  2L3C A;  3QG5 C;  2LTS A;  2ENC A;  4KHP E;  1BBG A;  2EMW A;  2EMK A;  3HPS A;  2EL6 A;  4DV0 E;  4JI6 E;  4IJD A;  2EMC A;  3HQ1 A;  2DLQ A;  4LF4 E;  3VYX A;  2L2N A;  2V86 A;  2EOQ A;  2YSP A;  4BMJ A;  1RQ0 A;  2L92 A;  1X49 A;  2WBS A;  4P7D A;  4DV3 E;  4F9C B;  2EN4 A;  3F6G A;  4MLV A;  4YHH E;  1J5E E;  4NHR A;  4X66 E;  2G7H A;  2K4V A;  1PDA A;  2M9A A;  2MC5 A;  4LFB E;  5KL6 A;  1ZBT A;  3DJW A;  2EPZ A;  2ELY A;  3JTZ A;  1DGC A;  3M99 B;  1XMQ E;  4LF5 E;  3ADI A;  5A2Q C;  2B7V A;  4DV4 E;  4BS9 A;  2UUA E;  1NEI A;  2F8B A;  3RMP A;  4L5N C;  4F6M A;  2YTO A;  2WBU A;  3EPH A;  1STU A;  2B9D A;  3BBG A;  3MHS C;  1A1F A;  2LJU A;  1A1K A;  4F2J C;  2MKD A;  1HNZ E;  2JR1 A;  2YTE A;  4LU9 A;  3ECR A;  3T1Y E;  1PKP A;  1IQS A;  2DLK A;  3J7Y p;  5LMN E;  1ZU1 A;  2DMI A;  4HTG A;  2ELZ A;  2YWQ A;  3HXL A;  1EKZ A;  4M30 A;  2EM8 A;  4O24 A;  4O43 A;  2JP9 A;  2EZ6 A;  2M1S A;  3AV0 A;  1AH5 A;  4R8O A;  2EPC A;  2EPX A;  2YTP A;  4R2Q A;  2YRK A;  1BBO A;  2EMZ A;  4R2P A;  1YYK A;  1X5W A;  4WFT A;  4DUY E;  2EML A;  4WSP A;  2YSO A;  3THN A;  4DR5 E;  4LFC E;  2JOX A;  3K6Q A;  2LE2 A;  2EOZ A;  5LL6 R;  5AE3 A;  3DF6 A;  1HNX E;  1IMU A;  4BCA A;  5A69 A;  5KL5 A;  2VRD A;  2YTF A;  2YTG A;  2J7J A;  3IWB A;  1N34 E;  2UUB E;  2DSY A;  2LMZ A;  2V88 A;  1FKA E;  4LTY A;  1X47 A;  1JK2 A;  2VQF E;  2UXC E;  2EM7 A;  4O4K A;  2YU8 A;  3HPZ A;  3EQ1 A;  1YZ9 A;  2BB8 A;  2EL4 A;  2JY9 A;  2EPU A;  2I13 A;  4RH8 A;  5AE2 A;  2EWL A;  2JYA A;  3HTX A;  1T4O A;  1T39 A;  1A1I A;  1YUJ A;  3ADJ A;  4JV5 E;  1YYO A;  4LF8 E;  2EPA A;  1YUI A;  2JPA A;  2L2M A;  4BC7 A;  4WXD A;  5AC5 A;  2IHR 1;  1KJK A;  4NZV A;  4ZYD A;  5F3W A;  4R2S A;  1YFH A;  3MHH C;  2FV4 B;  1UN6 B;  4LF9 E;  4OOG C;  2EOY A;  2NA2 A;  5LLQ A;  2EM5 A;  1PJT A;  5KL3 A;  3F6H A;  2MDG A;  3H09 A;  4M0V A;  4K0K E;  2EPN A;  2Q8U A;  5LMU E;  2MDR A;  2RTX A;  4GZN C;  1WHQ A;  2FGG A;  3JU0 A;  1ZR9 A;  2DIX A;  4OX9 E;  4R2E A;  1IBM E;  2DB2 A;  4ZYG A;  4WX9 A;  1A1G A;  1DQ3 A;  4R2C A;  2E72 A;  3OML A;  1UIL A;  1ZBQ A;  2EOJ A;  1A1H A;  2ODR D;  2LCE A;  2YTN A;  2CTD A;  2EM0 A;  2EOS A;  4JI1 E;  2LTR A;  3C6K A;  4DV1 E;  2RPC A;  4DV6 E;  2WBT A;  4JI0 E;  1PJS A;  4X64 E;  2MKN A;  2V8Q B;  2EMI A;  4WSG A;  2DRP A;  1N3G A;  2B7T A;  4O5G A;  3IWC A;  2CPN A;  2ENA A;  2EQ3 A;  2LJH A;  2DMY A;  2EMY A;  1XNR E;  2YZT A;  1DI2 A;  3KZY A;  2PRT A;  3BID A;  2I9I A;  4ZYE A;  4DR4 E;  3C4B A;  2WZO A;  2EMA A;  4Q28 A;  1T4N A;  4DR1 E;  4DV2 E;  2LT7 A;  1LLM C;  2LBS B;  4WYQ B;  2D9H A;  2EN1 A;  2VE7 C;  2NUG A;  2R76 A;  1HNW E;  3C6M A;  2F4V E;  1WJP A;  4DV7 E;  1B69 A;  3ADG A;  4R2R A;  2L2K B;  5A6B A;  1IQO A;  4NXN E;  1YPN A;  2ODR C;  3T1H E;  2EN7 A;  3J81 C;  2CSH A;  2LUP B;  2HHH E;  4JI5 E;  1AAY A;  1T4L B;  4MLQ A;  2LV2 A;  2UXB E;  2M7Q A;  3LLH A;  1X6H A;  4X8W A;  2EL5 A;  1TN9 A;  4GKJ E;  2YTQ A;  4DMI A;  2V85 A;  5AAS A;  4AQY E;  1GTK A;  1A1L A;  5AC4 A;  2RSI A;  2M4I A;  5A6A A;  3EPJ A;  1WHN A;  4M9V C;  2E5L E;  5ADZ A;  4B3R E;  4P78 A;  2EOX A;  1IBL E;  1WRJ A;  4JYA E;  1N33 E;  4TUG A;  4KZS A;  2EM9 A;  1SR9 A;  2ZM6 E;  1HR0 E;  4LFA E;  1SFE A;  2GHF A;  1RC7 A;  2EPP A;  5IV8 B;  2HJJ A;  2EPR A;  4X9J A;  2L3J A;  1Z1B A;  1F2I G;  2EM6 A;  1L4S A;  1GQE A;  1GZ6 A;  2R1F A;  1UHZ A;  1PJQ A;  4R2D A;  1J26 A;  5DNY A;  5IXM B;  2EOE A;  3VHT B;  2JVA A;  3JAM C;  3OTO E;  4JI4 E;  2N3H A;  4LF7 E;  1P47 A;  3UK3 C;  4JI2 E;  5IT9 C;  2GLI A;  2HC5 A;  2EMF A;  4GEQ B;  5TSE A;  1RMD A;  5KL7 A;  4BHB A;  5IWA E;  3AUZ A;  3EPL A;  4BHC A;  4WPY A;  2HGH A;  2LO3 A;  4BBY A;  1X6E A;  2YTI A;  1MEY C;  1JK1 A;  4LF6 E;  3LML A;  2RS7 A;  4F54 A;  2EMB A;  4JI7 E;  2YRM A;  4JI8 E;  2A25 A;  1TF6 A;  4L8N A;  1G2D C;  5FLX C;  1UBD C;  4NXM E;  2JXP A;  2EN8 A;  3J80 C;  2KHX A;  2VQE E;  2EPM X;  1IBK E;  4HEI A;  2K7I A;  1I94 E;  2EM4 A;  1BB8 A;  5A6B D;  5BR8 E;  2EMH A;  2V87 A;  5A6J A;  2KOU A;  2EOF A;  2L6M A;  2JWO A;  2EOI A;  4X62 E;  2FTX B;  2H36 X;  2YU5 A;  1QNT A;  2LVH A;  2RQL A;  2UU9 E;  3VK6 A;  2RS6 A;  4B3M E;  2L33 A;  3J7A G;  2B3T B;  1QU6 A;  2YPN A;  5A6K A;  2UXD E;  4GKK E;  1O0W A;  1EH8 A;  1X6F A;  1WXR A;  2EM3 A;  4I8O A;  1G2F C;  4R03 A;  1XMO E;  1ZAA C;  3BF2 A;  2EMX A;  4DKK A;  2EOH A;  4M2Z A;  1YYW A;  4RHB B;  2MC6 A;  2V89 A;  3ADL A;  4DR7 E;  3KZZ A;  2UUC E;  4N4R B;  2YTJ A;  4F9A B;  2EM2 A;  2EN3 A;  5CFF E;  3BGH A;  2EQ1 A;  2RSM A;  3L00 A;  1YSA C;  1KYQ A;  2L8T A;  2YRH A;  1FJG E;  2EN6 A;  2NUF A;  5KL2 A;  2EPK X;  4DR3 E;  4B3T E;  2BBG A; 
#chains in the Genus database with same CATH homology
 2ZM6 E;  5A2Q C;  1HR0 E;  4LFA E;  4LF9 E;  2B7V A;  4DV4 E;  3C4T A;  4OOG C;  4BS9 A;  2UUA E;  1RC7 A;  2F8B A;  3RMP A;  2NA2 A;  4L5N C;  4DUZ E;  3F6H A;  2L3J A;  1STU A;  2B9D A;  3H09 A;  2VF1 A;  4M0V A;  4K0K E;  1GQE A;  1GZ6 A;  2MDR A;  1UHZ A;  2RTX A;  3IWD A;  1WHQ A;  5LMU E;  3VYY A;  2FGG A;  2LUQ A;  5AE1 A;  1XNQ E;  3JU0 A;  1J26 A;  2DIX A;  5DNY A;  4F9B B;  1IBM E;  1HNZ E;  4OX9 E;  2DB2 A;  2JR1 A;  4LU9 A;  2YT4 A;  4JI3 E;  2JVA A;  3JAM C;  3OTO E;  3T1Y E;  1DQ3 A;  2N3H A;  1PKP A;  3P1X A;  4J8Z A;  4JI4 E;  3J7Y p;  4DR6 E;  2E1M A;  3OML A;  1UIL A;  4X65 E;  5LMN E;  5IT9 C;  1ZBQ A;  4JI2 E;  2ODR D;  4GEQ B;  4JI1 E;  2JOB A;  2LTR A;  3HXL A;  2KON A;  4DV1 E;  1EKZ A;  4DV6 E;  4M30 A;  4JI0 E;  4LF7 E;  4X64 E;  3ZOQ B;  5IWA E;  2V8Q B;  4B3S E;  3KWR A;  3AUZ A;  2EZ6 A;  2M1S A;  3AV0 A;  5T6J A;  4R8O A;  4WPY A;  2LRS A;  4BBY A;  2B7T A;  3IWC A;  2CPN A;  2LJH A;  4LF6 E;  2DMY A;  2N3G A;  2RS7 A;  3LML A;  4F54 A;  1N36 E;  2YZT A;  4YY3 E;  4DR2 E;  1XNR E;  4WFT A;  3FIG A;  1YYK A;  3MSW A;  4TUI A;  1DI2 A;  4JI7 E;  4DUY E;  4JI8 E;  4BC9 A;  4L8N A;  4WSP A;  5FLX C;  4NXM E;  1X48 A;  4DR5 E;  4DV5 E;  4DR4 E;  3C4B A;  3J80 C;  2KHX A;  2WZO A;  4LFC E;  2VQE E;  2JOX A;  4Q28 A;  1IBK E;  3K6Q A;  2LE2 A;  1T4N A;  5LL6 R;  5AE3 A;  2V83 A;  3DF6 A;  4DR1 E;  1HNX E;  1I94 E;  1N32 E;  2L3C A;  4DV2 E;  2LBS B;  4BCA A;  2LTS A;  4WYQ B;  5BR8 E;  3IWB A;  4KHP E;  2V87 A;  2VE7 C;  2KOU A;  1N34 E;  2NUG A;  2UUB E;  3HPS A;  2DSY A;  2L6M A;  4DV0 E;  2JWO A;  2LMZ A;  4JI6 E;  1HNW E;  4X62 E;  2V88 A;  2FTX B;  2H36 X;  4LTY A;  1FKA E;  2F4V E;  4DV7 E;  3ADG A;  3HQ1 A;  2L2K B;  1X47 A;  2UU9 E;  3VK6 A;  2VQF E;  2RS6 A;  4B3M E;  4NXN E;  2UXC E;  2L33 A;  3J7A G;  2B3T B;  1QU6 A;  2ODR C;  2UXD E;  3T1H E;  3J81 C;  2LUP B;  1O0W A;  2HHH E;  4JI5 E;  3HPZ A;  4GKK E;  4LF4 E;  3VYX A;  2L2N A;  1T4L B;  1YZ9 A;  1WXR A;  2UXB E;  2JY9 A;  2V86 A;  4I8O A;  2M7Q A;  3LLH A;  4X8W A;  4BMJ A;  4R03 A;  5AE2 A;  4GKJ E;  4DMI A;  1RQ0 A;  1XMO E;  2L92 A;  2EWL A;  2V85 A;  5AAS A;  1X49 A;  4DKK A;  3HTX A;  4M2Z A;  4AQY E;  1T4O A;  4P7D A;  1YYW A;  4DV3 E;  2MC6 A;  2V89 A;  3ADJ A;  4F9C B;  3ADL A;  4DR7 E;  4JV5 E;  1YYO A;  4LF8 E;  2UUC E;  2M4I A;  2L2M A;  4F9A B;  1WHN A;  4BC7 A;  3F6G A;  2E5L E;  4YHH E;  5CFF E;  1J5E E;  5ADZ A;  4B3R E;  2IHR 1;  4P78 A;  1IBL E;  4X66 E;  2G7H A;  2K4V A;  2RSM A;  2MC5 A;  4LFB E;  1ZBT A;  5F3W A;  4JYA E;  2NUE A;  1N33 E;  4TUG A;  2L8T A;  1FJG E;  3DJW A;  4KZS A;  2NUF A;  3JTZ A;  2FV4 B;  4DR3 E;  1SR9 A;  1XMQ E;  4LF5 E;  3ADI A;  4B3T E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...