2YT4A

Crystal structure of human dgcr8 core
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
213
structure length
196
Chain Sequence
GSHMSVQDKKEFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECENPSEPFGASVTIDGVTYGSGTASSKKLAKNKAARATLEILIPDFVKQSEELEYFNHISIEDSRVYELTSKAGLLSPYQILHECLKRNHGMGDTSIKFEQKSEYVMACGKHTVRGWCKNKRVGKQLASQKILQLLHPHVKNWGSLLRMYGRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of human DGCR8 core
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Protein DGCR8
total genus 52
structure length 196
sequence length 213
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2yt4A02
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2yt4A03
3.30.160.590 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2yt4A01
4DUYE 2JVAA 2L3JA 4DR6E 2UXCE 1XMQE 4DR3E 4DR5E 1J26A 4LF9E 2LTSA 4B3ME 2EZ6A 3ADJA 3OTOE 3ADIA 3T1HE 1HNWE 1QU6A 2DB2A 1T4NA 1YYOA 4M2ZA 4DR7E 1HR0E 2IHR1 4JI3E 3ADLA 3HTXA 2YT4A 4JI4E 2UUAE 2UXDE 4JI5E 3LLHA 1X47A 2LRSA 2NUGA 4JI2E 1RQ0A 1WHNA 4DV1E 1UILA 5LMNE 3ADGA 1N36E 1N32E 4DR1E 1J5EE 2RTXA 4LFCE 4DUZE 4YY3E 4JI8E 2UXBE 1UHZA 2NA2A 1T4OA 2DIXA 4JI6E 3C4TA 1O0WA 2LBSB 2UUCE 2LTRA 2RS7A 4B3RE 2L2MA 4OOGC 1STUA 4NXME 1X48A 2B7VA 1HNXE 4JV5E 5CFFE 4JI7E 4DV2E 4DV5E 2MDRA 4WFTA 4B3SE 2VQEE 1IBLE 1XNRE 1YYKA 4LF7E 1ZBTA 4K0KE 4LFBE 5IWAE 2N3GA 2LUQA 1WHQA 1X49A 4WYQB 2L33A 5BR8E 4DV0E 2NUEA 4JI0E 3T1YE 2LJHA 4LFAE 5LMUE 1DI2A 3J7Yp 2NUFA 2B7TA 1FJGE 2JY9A 2L2KB 4DR4E 4KHPE 2HHHE 1PKPA 1HNZE 1XMOE 4DR2E 1T4LB 1FKAE 1XNQE 4X62E 4GKKE 2RSMA 2L2NA 4DV6E 2VQFE 1YZ9A 4JYAE 3VYYA 4DKKA 4LF6E 4DV7E 4DV3E 4X66E 4AQYE 1N34E 2UU9E 4LF4E 4M30A 4B3TE 1GQEA 2L3CA 1EKZA 3P1XA 4LF8E 4JI1E 1IBME 1I94E 2N3HA 2KHXA 4DV4E 2UUBE 4X64E 3VYXA 2B3TB 2DMYA 4OX9E 1N33E 2CPNA 4X65E 2ZM6E 2E5LE 4GKJE 2F4VE 3C4BA 1IBKE 1YYWA 1RC7A 2LUPB 2RS6A 4NXNE 4X8WA 4YHHE 4LF5E
chains in the Genus database with same CATH superfamily
2VF1A 1PJSA 2JVAA 2YTQA 5IT9C 2M9AA 2JOBA 2LTSA 2MKDA 4N4RB 4IS1C 2LT7A 2YRMA 4NHRA 4P7DA 1X5WA 1T4NA 2EMFA 4BHBA 2ENAA 1A1KA 2JOXA 1X6FA 2VRDA 5AE2A 5A2QC 5IV8B 1T39A 4DR7E 4JI3E 1EH7A 1AH5A 3DF6A 2UUAE 2YSOA 1X47A 2EOXA 2DLKA 2V83A 2LO3A 4WSPA 3IWCA 3J81C 3BGHA 3C6KA 2MC5A 4MLVA 2EN6A 2N8XA 4WXCA 2EOIA 4BBYA 2L2MA 4OOGC 1T38A 5CFFE 2MDRA 2ELYA 2VQEE 1ZBTA 1EH8A 2EMLA 3EQ1A 4LFBE 5LL6R 3M99B 4WX9A 2N3GA 1X49A 4WYQB 1IQOA 2EPXA 5BR8E 4DV0E 1NEIA 4BMJA 2LJHA 4O43A 5A69A 2B7TA 2EPAA 4F2JC 2E72A 2HJJA 2L2KB 5A6AA 5FLXC 1RMDA 5A6KA 5KL3A 2G7HA 1XMOE 1T4LB 2EPCA 4MLQA 1P47A 2EMHA 1DGCA 2V8QB 1MEYC 4F9BB 2EM6A 2RSMA 4P78A 2YTOA 5A6JA 3VYYA 4DKKA 1TF6A 4M30A 4F6MA 1IQSA 2L3CA 2EWLA 2EM9A 1KJKA 2WCC3 4LF8E 1I94E 2EPOA 2V86A 4ZYEA 4F9AB 2F8BA 2CPNA 4X65E 2E5LE 1IBKE 2EL5A 3TQMA 4X8WA 1Z1BA 2JWOA 2V87A 2EORA 3QG5C 2V88A 1WRJA 3H09A 2L3JA 2YTFA 1XMQE 2M4IA 4DR5E 3JTZA 3ECRA 4LF9E 1N3GA 2CTDA 3ADJA 4R2EA 2J7JA 3KZZA 1HNWE 2EN4A 5LLQA 2WZOA 1ZU1A 2LV2A 2GLIA 4O24A 4M2ZA 2LE2A 2IHR1 2YT4A 3THOB 4JI5E 2NUGA 2EPZA 2DGCA 1BBGA 4FK5C 2BB8A 3MHHC 5LMNE 2EQ0A 2BBGA 3ADGA 2V89A 4R2CA 1J5EE 2MKNA 3HQ1A 2RTXA 4LFCE 2PRTA 1TN9A 2EMXA 4JI8E 2EM8A 2YTEA 2ADRA 2CT1A 5AE1A 4BHCA 4L8NA 2L6MA 1O0WA 3KWRA 1A1JA 2EN2A 2LBSB 5AC4A 3J80C 4WSGA 4NXME 4JV5E 2ODRD 1X3CA 2EOYA 4DV2E 4B3SE 1NCSA 1KYQA 1IBLE 4K0KE 4LF7E 5AASA 3EPJA 4M9VC 2DSYA 2L33A 2DRPA 1MGTA 2M1SA 2NUEA 2JR1A 3T1YE 4R2PA 1FJGE 2K4VA 3MSWA 1JK2A 2HC5A 5KL7A 2JY9A 4J8ZA 4KHPE 2EMIA 2YU8A 5KL4A 1AAYA 2YRHA 2EMZA 2EPRA 2JPAA 1XNQE 2E1MA 2WBSA 2LJUA 4X62E 4GKKE 3KZYA 4TUIA 3RMPA 3HPZA 3HXLA 4F6NA 2L2NA 4DV6E 2VQFE 4JYAE 2EPUA 2EOMA 4X66E 3OMLA 1GQEA 2JYAA 4R8OA 2ODRC 5T6JA 3J7AG 4O5GA 4JI1E 1IBME 2VE7C 2N3HA 4R2AA 1G2DC 3IWDA 2DMYA 4OX9E 1N33E 5A6BD 4GKJE 2K7IA 1YYWA 2F4VE 1L4SA 3C6MA 3L00A 2LUPB 4WPYA 2EL6A 3BBGA 2A25A 4LF5E 4DUYE 2YTDA 3VK6A 1YSAC 2UXCE 4BC9A 4DR3E 2YU5A 2FTXB 4Q28A 3EPLA 5F3WA 4B3ME 2EZ6A 3BF2A 2EPPA 2EMAA 2EQ3A 1A1LA 4KWYA 3OTOE 3ADIA 2Q8UA 3T1HE 1QU6A 2DB2A 2YWQA 1YYOA 1ZAAC 2EPNA 2EE8A 4DMIA 1HR0E 3ADLA 2D9HA 3ZOQB 4L5NC 5AE3A 2MC6A 2LRSA 2MDGA 1RQ0A 1WHNA 5KL5A 1UILA 2CSHA 4GEQB 1A1IA 2EOOA 4NZVA 4R2DA 1PJTA 1N36E 1JK1A 1N32E 4DR1E 1EH6A 2YTIA 4DUZE 2UXBE 2NABA 1UHZA 1A1GA 2NA2A 2H36X 2WBTA 2B9DA 3C4TA 2ELZA 4RHBB 4B3RE 2EOHA 3F6GA 2EM4A 5ADZA 1STUA 1X48A 2EOZA 1XNRE 5DNYA 1YYKA 3VHTB 2WBUA 4ZYGA 3IWBA 3F6HA 4HTGA 2EM3A 2EOQA 4BS9A 1WHQA 2KONA 3AUZA 1YFHA 4LTYA 4LFAE 1DI2A 3J7Yp 2YTJA 3DJWA 2EMBA 2EM7A 1X6EA 1GZ6A 1PDAA 1DQ3A 3UK3C 1HNZE 1UBDC 4DR2E 2DLQA 1ZR9A 2DMIA 1YZ9A 2YZTA 2EN8A 1QNTA 2L92A 3LMLA 4DV7E 4LF6E 4TUGA 1N34E 4F54A 1EKZA 2R76A 3P1XA 1UN6B 2YTPA 2EP3A 2YTGA 4X64E 3VYXA 2I9IA 2B3TB 2EMWA 4RH8A 1TF3A 2YRKA 5KL2A 2YPNA 1RC7A 4R2RA 4WXDA 2FV4B 2RSIA 4BCAA 4DR6E 2KOUA 2EM0A 2LMZA 1J26A 2EL4A 5A6BA 1G2FC 2LVHA 1A1HA 3HPSA 1SFEA 3MHSC 2YTNA 2EMYA 1SR9A 3HTXA 2EPLX 2EOSA 4JI4E 1WJPA 2UXDE 1X6HA 3LLHA 2HGHA 4JI2E 4KZSA 2EOFA 4DV1E 2YSPA 1ZBQA 4X9JA 2EMKA 2FGGA 4YY3E 4IJDA 2ENHA 3JAMC 1LLMC 4GZNC 1T4OA 2EN1A 2DIXA 1WXRA 4JI6E 3THNA 2EJ4A 2V85A 4HEIA 4BC7A 2LCEA 2LTRA 2RS7A 2UUCE 2JXPA 2ENCA 1BBOA 1HNXE 2B7VA 2EM5A 4JI7E 4R2QA 4DV5E 4WFTA 1B69A 2JP9A 1PJQA 5IWAE 2EPKX 2LUQA 1YUIA 1IMUA 4R2SA 2L8TA 4R03A 4JI0E 5LMUE 4F9CB 2NUFA 1F2IG 3FIGA 4M0VA 4DR4E 2I13A 2HHHE 3EPKA 2EMGA 1PKPA 5TSEA 3BIDA 2M7QA 1FKAE 2RPCA 1GTKA 2EOJA 3AV0A 2EMCA 4ZYDA 3K6QA 2R1FA 2GHFA 2RQLA 4O4KA 5IXMB 4DV3E 2EN3A 2EOEA 4AQYE 4Q35B 2UU9E 4LF4E 1BB8A 4B3TE 3JU0A 2EN7A 1YUJA 4LU9A 2GPIA 2KHXA 4DV4E 2EPMX 2UUBE 2EQ1A 5KL6A 1YPNA 3EPHA 2ZM6E 4ZYHA 1A1FA 3C4BA 2EM2A 2RS6A 4I8OA 4NXNE 5AC5A 4YHHE
chains in the Genus database with same CATH topology
2FV4B 2VF1A 4DUYE 2JVAA 3H09A 4BCAA 3VK6A 2L3JA 4DR6E 2KOUA 2UXCE 1XMQE 2M4IA 4BC9A 4DR3E 4DR5E 2LMZA 3JTZA 4Q28A 2FTXB 5IT9C 4LF9E 1J26A 2JOBA 2LTSA 5F3WA 4B3ME 2EZ6A 3ADJA 3HPSA 3OTOE 3ADIA 3T1HE 1HNWE 1QU6A 4P7DA 2DB2A 2WZOA 1T4NA 1YYOA 2JOXA 4M2ZA 2LE2A 1SR9A 4DMIA 5AE2A 5A2QC 1HR0E 4DR7E 1YYKA 2IHR1 4JI3E 3ADLA 3HTXA 3DF6A 2YT4A 3ZOQB 2UUAE 4L5NC 5AE3A 4JI4E 2MC6A 4JI5E 2UXDE 3LLHA 1X47A 2LRSA 2NUGA 4JI2E 1RQ0A 4KZSA 1WHNA 4DV1E 1UILA 5LMNE 4GEQB 4JYAE 1ZBQA 3ADGA 2V89A 1N36E 1N32E 2FGGA 2V83A 4DR1E 1J5EE 3HQ1A 4WSPA 2RTXA 3IWCA 3J81C 4DUZE 4LFCE 4YY3E 4JI8E 2MC5A 3JAMC 2UXBE 1UHZA 2NA2A 2H36X 1T4OA 5AE1A 2B9DA 2DIXA 4L8NA 2L6MA 3C4TA 1WXRA 1O0WA 3KWRA 4JI6E 2V85A 2LBSB 4BC7A 4BBYA 3J80C 2LTRA 2RS7A 2UUCE 4B3RE 3F6GA 5ADZA 2L2MA 4OOGC 1STUA 4NXME 1X48A 2B7VA 2ODRD 1HNXE 4JV5E 5CFFE 4JI7E 4DV2E 4DV5E 2MDRA 4WFTA 5DNYA 2VQEE 1IBLE 4B3SE 1XNRE 4LF7E 1ZBTA 5AASA 4K0KE 4LFBE 3IWBA 3F6HA 5LL6R 5IWAE 2N3GA 2DSYA 1WHQA 1X49A 2LUQA 4WYQB 2L33A 2KONA 4BS9A 2M1SA 5BR8E 4DV0E 2NUEA 2JR1A 2L8TA 4R03A 3AUZA 4BMJA 3T1YE 2LJHA 4LTYA 5LMUE 4F9CB 4JI0E 3J7Yp 4LFAE 2NUFA 1DI2A 3DJWA 2B7TA 2K4VA 1FJGE 3FIGA 4M0VA 3MSWA 2JY9A 1GZ6A 4J8ZA 2L2KB 2HHHE 4DR4E 4KHPE 5FLXC 1DQ3A 1PKPA 1HNZE 2G7HA 1XMOE 2M7QA 4DR2E 1T4LB 1FKAE 1XNQE 2E1MA 4X62E 2V8QB 3AV0A 4GKKE 4F9BB 4TUIA 3RMPA 2RSMA 3HPZA 3HXLA 4P78A 2L2NA 4DV6E 2YZTA 3K6QA 2VQFE 3VYYA 1YZ9A 4DKKA 2L92A 3LMLA 4LF6E 4DV7E 4TUGA 4DV3E 4X66E 4AQYE 1N34E 2UU9E 4LF4E 4M30A 3OMLA 4F54A 4B3TE 1GQEA 2EWLA 3JU0A 4R8OA 3P1XA 2L3CA 2ODRC 5T6JA 1EKZA 3J7AG 4LU9A 4LF8E 4JI1E 1IBME 1I94E 2VE7C 2N3HA 2KHXA 4DV4E 2UUBE 4X64E 2V86A 4F9AB 3VYXA 2F8BA 2B3TB 3IWDA 2DMYA 4OX9E 1N33E 2CPNA 4X65E 2ZM6E 2E5LE 4GKJE 2F4VE 3C4BA 1IBKE 1YYWA 1RC7A 2LUPB 4WPYA 2RS6A 4I8OA 4NXNE 4X8WA 2JWOA 2V87A 4YHHE 4LF5E 2V88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUY E;  2JVA A;  2L3J A;  4DR6 E;  2UXC E;  1XMQ E;  4DR3 E;  4DR5 E;  1J26 A;  4LF9 E;  2LTS A;  4B3M E;  2EZ6 A;  3ADJ A;  3OTO E;  3ADI A;  3T1H E;  1HNW E;  1QU6 A;  2DB2 A;  1T4N A;  1YYO A;  4M2Z A;  4DR7 E;  1HR0 E;  2IHR 1;  4JI3 E;  3ADL A;  3HTX A;  2YT4 A;  4JI4 E;  2UUA E;  2UXD E;  4JI5 E;  3LLH A;  1X47 A;  2LRS A;  2NUG A;  4JI2 E;  1RQ0 A;  1WHN A;  4DV1 E;  1UIL A;  5LMN E;  3ADG A;  1N36 E;  1N32 E;  4DR1 E;  1J5E E;  2RTX A;  4LFC E;  4DUZ E;  4YY3 E;  4JI8 E;  2UXB E;  1UHZ A;  2NA2 A;  1T4O A;  2DIX A;  4JI6 E;  3C4T A;  1O0W A;  2LBS B;  2UUC E;  2LTR A;  2RS7 A;  4B3R E;  2L2M A;  4OOG C;  1STU A;  4NXM E;  1X48 A;  2B7V A;  1HNX E;  4JV5 E;  5CFF E;  4JI7 E;  4DV2 E;  4DV5 E;  2MDR A;  4WFT A;  4B3S E;  2VQE E;  1IBL E;  1XNR E;  1YYK A;  4LF7 E;  1ZBT A;  4K0K E;  4LFB E;  5IWA E;  2N3G A;  2LUQ A;  1WHQ A;  1X49 A;  4WYQ B;  2L33 A;  5BR8 E;  4DV0 E;  2NUE A;  4JI0 E;  3T1Y E;  2LJH A;  4LFA E;  5LMU E;  1DI2 A;  3J7Y p;  2NUF A;  2B7T A;  1FJG E;  2JY9 A;  2L2K B;  4DR4 E;  4KHP E;  2HHH E;  1PKP A;  1HNZ E;  1XMO E;  4DR2 E;  1T4L B;  1FKA E;  1XNQ E;  4X62 E;  4GKK E;  2RSM A;  2L2N A;  4DV6 E;  2VQF E;  1YZ9 A;  4JYA E;  3VYY A;  4DKK A;  4LF6 E;  4DV7 E;  4DV3 E;  4X66 E;  4AQY E;  1N34 E;  2UU9 E;  4LF4 E;  4M30 A;  4B3T E;  1GQE A;  2L3C A;  1EKZ A;  3P1X A;  4LF8 E;  4JI1 E;  1IBM E;  1I94 E;  2N3H A;  2KHX A;  4DV4 E;  2UUB E;  4X64 E;  3VYX A;  2B3T B;  2DMY A;  4OX9 E;  1N33 E;  2CPN A;  4X65 E;  2ZM6 E;  2E5L E;  4GKJ E;  2F4V E;  3C4B A;  1IBK E;  1YYW A;  1RC7 A;  2LUP B;  2RS6 A;  4NXN E;  4X8W A;  4YHH E;  4LF5 E; 
#chains in the Genus database with same CATH topology
 2VF1 A;  1PJS A;  2JVA A;  2YTQ A;  5IT9 C;  2M9A A;  2JOB A;  2LTS A;  2MKD A;  4N4R B;  4IS1 C;  2LT7 A;  2YRM A;  4NHR A;  4P7D A;  1X5W A;  1T4N A;  2EMF A;  4BHB A;  2ENA A;  1A1K A;  2JOX A;  1X6F A;  2VRD A;  5AE2 A;  5A2Q C;  5IV8 B;  1T39 A;  4DR7 E;  4JI3 E;  1EH7 A;  1AH5 A;  3DF6 A;  2UUA E;  2YSO A;  1X47 A;  2EOX A;  2DLK A;  2V83 A;  2LO3 A;  4WSP A;  3IWC A;  3J81 C;  3BGH A;  3C6K A;  2MC5 A;  4MLV A;  2EN6 A;  2N8X A;  4WXC A;  2EOI A;  4BBY A;  2L2M A;  4OOG C;  1T38 A;  5CFF E;  2MDR A;  2ELY A;  2VQE E;  1ZBT A;  1EH8 A;  2EML A;  3EQ1 A;  4LFB E;  5LL6 R;  3M99 B;  4WX9 A;  2N3G A;  1X49 A;  4WYQ B;  1IQO A;  2EPX A;  5BR8 E;  4DV0 E;  1NEI A;  4BMJ A;  2LJH A;  4O43 A;  5A69 A;  2B7T A;  2EPA A;  4F2J C;  2E72 A;  2HJJ A;  2L2K B;  5A6A A;  5FLX C;  1RMD A;  5A6K A;  5KL3 A;  2G7H A;  1XMO E;  1T4L B;  2EPC A;  4MLQ A;  1P47 A;  2EMH A;  1DGC A;  2V8Q B;  1MEY C;  4F9B B;  2EM6 A;  2RSM A;  4P78 A;  2YTO A;  5A6J A;  3VYY A;  4DKK A;  1TF6 A;  4M30 A;  4F6M A;  1IQS A;  2L3C A;  2EWL A;  2EM9 A;  1KJK A;  2WCC 3;  4LF8 E;  1I94 E;  2EPO A;  2V86 A;  4ZYE A;  4F9A B;  2F8B A;  2CPN A;  4X65 E;  2E5L E;  1IBK E;  2EL5 A;  3TQM A;  4X8W A;  1Z1B A;  2JWO A;  2V87 A;  2EOR A;  3QG5 C;  2V88 A;  1WRJ A;  3H09 A;  2L3J A;  2YTF A;  1XMQ E;  2M4I A;  4DR5 E;  3JTZ A;  3ECR A;  4LF9 E;  1N3G A;  2CTD A;  3ADJ A;  4R2E A;  2J7J A;  3KZZ A;  1HNW E;  2EN4 A;  5LLQ A;  2WZO A;  1ZU1 A;  2LV2 A;  2GLI A;  4O24 A;  4M2Z A;  2LE2 A;  2IHR 1;  2YT4 A;  3THO B;  4JI5 E;  2NUG A;  2EPZ A;  2DGC A;  1BBG A;  4FK5 C;  2BB8 A;  3MHH C;  5LMN E;  2EQ0 A;  2BBG A;  3ADG A;  2V89 A;  4R2C A;  1J5E E;  2MKN A;  3HQ1 A;  2RTX A;  4LFC E;  2PRT A;  1TN9 A;  2EMX A;  4JI8 E;  2EM8 A;  2YTE A;  2ADR A;  2CT1 A;  5AE1 A;  4BHC A;  4L8N A;  2L6M A;  1O0W A;  3KWR A;  1A1J A;  2EN2 A;  2LBS B;  5AC4 A;  3J80 C;  4WSG A;  4NXM E;  4JV5 E;  2ODR D;  1X3C A;  2EOY A;  4DV2 E;  4B3S E;  1NCS A;  1KYQ A;  1IBL E;  4K0K E;  4LF7 E;  5AAS A;  3EPJ A;  4M9V C;  2DSY A;  2L33 A;  2DRP A;  1MGT A;  2M1S A;  2NUE A;  2JR1 A;  3T1Y E;  4R2P A;  1FJG E;  2K4V A;  3MSW A;  1JK2 A;  2HC5 A;  5KL7 A;  2JY9 A;  4J8Z A;  4KHP E;  2EMI A;  2YU8 A;  5KL4 A;  1AAY A;  2YRH A;  2EMZ A;  2EPR A;  2JPA A;  1XNQ E;  2E1M A;  2WBS A;  2LJU A;  4X62 E;  4GKK E;  3KZY A;  4TUI A;  3RMP A;  3HPZ A;  3HXL A;  4F6N A;  2L2N A;  4DV6 E;  2VQF E;  4JYA E;  2EPU A;  2EOM A;  4X66 E;  3OML A;  1GQE A;  2JYA A;  4R8O A;  2ODR C;  5T6J A;  3J7A G;  4O5G A;  4JI1 E;  1IBM E;  2VE7 C;  2N3H A;  4R2A A;  1G2D C;  3IWD A;  2DMY A;  4OX9 E;  1N33 E;  5A6B D;  4GKJ E;  2K7I A;  1YYW A;  2F4V E;  1L4S A;  3C6M A;  3L00 A;  2LUP B;  4WPY A;  2EL6 A;  3BBG A;  2A25 A;  4LF5 E;  4DUY E;  2YTD A;  3VK6 A;  1YSA C;  2UXC E;  4BC9 A;  4DR3 E;  2YU5 A;  2FTX B;  4Q28 A;  3EPL A;  5F3W A;  4B3M E;  2EZ6 A;  3BF2 A;  2EPP A;  2EMA A;  2EQ3 A;  1A1L A;  4KWY A;  3OTO E;  3ADI A;  2Q8U A;  3T1H E;  1QU6 A;  2DB2 A;  2YWQ A;  1YYO A;  1ZAA C;  2EPN A;  2EE8 A;  4DMI A;  1HR0 E;  3ADL A;  2D9H A;  3ZOQ B;  4L5N C;  5AE3 A;  2MC6 A;  2LRS A;  2MDG A;  1RQ0 A;  1WHN A;  5KL5 A;  1UIL A;  2CSH A;  4GEQ B;  1A1I A;  2EOO A;  4NZV A;  4R2D A;  1PJT A;  1N36 E;  1JK1 A;  1N32 E;  4DR1 E;  1EH6 A;  2YTI A;  4DUZ E;  2UXB E;  2NAB A;  1UHZ A;  1A1G A;  2NA2 A;  2H36 X;  2WBT A;  2B9D A;  3C4T A;  2ELZ A;  4RHB B;  4B3R E;  2EOH A;  3F6G A;  2EM4 A;  5ADZ A;  1STU A;  1X48 A;  2EOZ A;  1XNR E;  5DNY A;  1YYK A;  3VHT B;  2WBU A;  4ZYG A;  3IWB A;  3F6H A;  4HTG A;  2EM3 A;  2EOQ A;  4BS9 A;  1WHQ A;  2KON A;  3AUZ A;  1YFH A;  4LTY A;  4LFA E;  1DI2 A;  3J7Y p;  2YTJ A;  3DJW A;  2EMB A;  2EM7 A;  1X6E A;  1GZ6 A;  1PDA A;  1DQ3 A;  3UK3 C;  1HNZ E;  1UBD C;  4DR2 E;  2DLQ A;  1ZR9 A;  2DMI A;  1YZ9 A;  2YZT A;  2EN8 A;  1QNT A;  2L92 A;  3LML A;  4DV7 E;  4LF6 E;  4TUG A;  1N34 E;  4F54 A;  1EKZ A;  2R76 A;  3P1X A;  1UN6 B;  2YTP A;  2EP3 A;  2YTG A;  4X64 E;  3VYX A;  2I9I A;  2B3T B;  2EMW A;  4RH8 A;  1TF3 A;  2YRK A;  5KL2 A;  2YPN A;  1RC7 A;  4R2R A;  4WXD A;  2FV4 B;  2RSI A;  4BCA A;  4DR6 E;  2KOU A;  2EM0 A;  2LMZ A;  1J26 A;  2EL4 A;  5A6B A;  1G2F C;  2LVH A;  1A1H A;  3HPS A;  1SFE A;  3MHS C;  2YTN A;  2EMY A;  1SR9 A;  3HTX A;  2EPL X;  2EOS A;  4JI4 E;  1WJP A;  2UXD E;  1X6H A;  3LLH A;  2HGH A;  4JI2 E;  4KZS A;  2EOF A;  4DV1 E;  2YSP A;  1ZBQ A;  4X9J A;  2EMK A;  2FGG A;  4YY3 E;  4IJD A;  2ENH A;  3JAM C;  1LLM C;  4GZN C;  1T4O A;  2EN1 A;  2DIX A;  1WXR A;  4JI6 E;  3THN A;  2EJ4 A;  2V85 A;  4HEI A;  4BC7 A;  2LCE A;  2LTR A;  2RS7 A;  2UUC E;  2JXP A;  2ENC A;  1BBO A;  1HNX E;  2B7V A;  2EM5 A;  4JI7 E;  4R2Q A;  4DV5 E;  4WFT A;  1B69 A;  2JP9 A;  1PJQ A;  5IWA E;  2EPK X;  2LUQ A;  1YUI A;  1IMU A;  4R2S A;  2L8T A;  4R03 A;  4JI0 E;  5LMU E;  4F9C B;  2NUF A;  1F2I G;  3FIG A;  4M0V A;  4DR4 E;  2I13 A;  2HHH E;  3EPK A;  2EMG A;  1PKP A;  5TSE A;  3BID A;  2M7Q A;  1FKA E;  2RPC A;  1GTK A;  2EOJ A;  3AV0 A;  2EMC A;  4ZYD A;  3K6Q A;  2R1F A;  2GHF A;  2RQL A;  4O4K A;  5IXM B;  4DV3 E;  2EN3 A;  2EOE A;  4AQY E;  4Q35 B;  2UU9 E;  4LF4 E;  1BB8 A;  4B3T E;  3JU0 A;  2EN7 A;  1YUJ A;  4LU9 A;  2GPI A;  2KHX A;  4DV4 E;  2EPM X;  2UUB E;  2EQ1 A;  5KL6 A;  1YPN A;  3EPH A;  2ZM6 E;  4ZYH A;  1A1F A;  3C4B A;  2EM2 A;  2RS6 A;  4I8O A;  4NXN E;  5AC5 A;  4YHH E; 
#chains in the Genus database with same CATH homology
 2FV4 B;  2VF1 A;  4DUY E;  2JVA A;  3H09 A;  4BCA A;  3VK6 A;  2L3J A;  4DR6 E;  2KOU A;  2UXC E;  1XMQ E;  2M4I A;  4BC9 A;  4DR3 E;  4DR5 E;  2LMZ A;  3JTZ A;  4Q28 A;  2FTX B;  5IT9 C;  4LF9 E;  1J26 A;  2JOB A;  2LTS A;  5F3W A;  4B3M E;  2EZ6 A;  3ADJ A;  3HPS A;  3OTO E;  3ADI A;  3T1H E;  1HNW E;  1QU6 A;  4P7D A;  2DB2 A;  2WZO A;  1T4N A;  1YYO A;  2JOX A;  4M2Z A;  2LE2 A;  1SR9 A;  4DMI A;  5AE2 A;  5A2Q C;  1HR0 E;  4DR7 E;  1YYK A;  2IHR 1;  4JI3 E;  3ADL A;  3HTX A;  3DF6 A;  2YT4 A;  3ZOQ B;  2UUA E;  4L5N C;  5AE3 A;  4JI4 E;  2MC6 A;  4JI5 E;  2UXD E;  3LLH A;  1X47 A;  2LRS A;  2NUG A;  4JI2 E;  1RQ0 A;  4KZS A;  1WHN A;  4DV1 E;  1UIL A;  5LMN E;  4GEQ B;  4JYA E;  1ZBQ A;  3ADG A;  2V89 A;  1N36 E;  1N32 E;  2FGG A;  2V83 A;  4DR1 E;  1J5E E;  3HQ1 A;  4WSP A;  2RTX A;  3IWC A;  3J81 C;  4DUZ E;  4LFC E;  4YY3 E;  4JI8 E;  2MC5 A;  3JAM C;  2UXB E;  1UHZ A;  2NA2 A;  2H36 X;  1T4O A;  5AE1 A;  2B9D A;  2DIX A;  4L8N A;  2L6M A;  3C4T A;  1WXR A;  1O0W A;  3KWR A;  4JI6 E;  2V85 A;  2LBS B;  4BC7 A;  4BBY A;  3J80 C;  2LTR A;  2RS7 A;  2UUC E;  4B3R E;  3F6G A;  5ADZ A;  2L2M A;  4OOG C;  1STU A;  4NXM E;  1X48 A;  2B7V A;  2ODR D;  1HNX E;  4JV5 E;  5CFF E;  4JI7 E;  4DV2 E;  4DV5 E;  2MDR A;  4WFT A;  5DNY A;  2VQE E;  1IBL E;  4B3S E;  1XNR E;  4LF7 E;  1ZBT A;  5AAS A;  4K0K E;  4LFB E;  3IWB A;  3F6H A;  5LL6 R;  5IWA E;  2N3G A;  2DSY A;  1WHQ A;  1X49 A;  2LUQ A;  4WYQ B;  2L33 A;  2KON A;  4BS9 A;  2M1S A;  5BR8 E;  4DV0 E;  2NUE A;  2JR1 A;  2L8T A;  4R03 A;  3AUZ A;  4BMJ A;  3T1Y E;  2LJH A;  4LTY A;  5LMU E;  4F9C B;  4JI0 E;  3J7Y p;  4LFA E;  2NUF A;  1DI2 A;  3DJW A;  2B7T A;  2K4V A;  1FJG E;  3FIG A;  4M0V A;  3MSW A;  2JY9 A;  1GZ6 A;  4J8Z A;  2L2K B;  2HHH E;  4DR4 E;  4KHP E;  5FLX C;  1DQ3 A;  1PKP A;  1HNZ E;  2G7H A;  1XMO E;  2M7Q A;  4DR2 E;  1T4L B;  1FKA E;  1XNQ E;  2E1M A;  4X62 E;  2V8Q B;  3AV0 A;  4GKK E;  4F9B B;  4TUI A;  3RMP A;  2RSM A;  3HPZ A;  3HXL A;  4P78 A;  2L2N A;  4DV6 E;  2YZT A;  3K6Q A;  2VQF E;  3VYY A;  1YZ9 A;  4DKK A;  2L92 A;  3LML A;  4LF6 E;  4DV7 E;  4TUG A;  4DV3 E;  4X66 E;  4AQY E;  1N34 E;  2UU9 E;  4LF4 E;  4M30 A;  3OML A;  4F54 A;  4B3T E;  1GQE A;  2EWL A;  3JU0 A;  4R8O A;  3P1X A;  2L3C A;  2ODR C;  5T6J A;  1EKZ A;  3J7A G;  4LU9 A;  4LF8 E;  4JI1 E;  1IBM E;  1I94 E;  2VE7 C;  2N3H A;  2KHX A;  4DV4 E;  2UUB E;  4X64 E;  2V86 A;  4F9A B;  3VYX A;  2F8B A;  2B3T B;  3IWD A;  2DMY A;  4OX9 E;  1N33 E;  2CPN A;  4X65 E;  2ZM6 E;  2E5L E;  4GKJ E;  2F4V E;  3C4B A;  1IBK E;  1YYW A;  1RC7 A;  2LUP B;  4WPY A;  2RS6 A;  4I8O A;  4NXN E;  4X8W A;  2JWO A;  2V87 A;  4YHH E;  4LF5 E;  2V88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...