2YT4A

Crystal structure of human dgcr8 core
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
213
structure length
196
Chain Sequence
GSHMSVQDKKEFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECENPSEPFGASVTIDGVTYGSGTASSKKLAKNKAARATLEILIPDFVKQSEELEYFNHISIEDSRVYELTSKAGLLSPYQILHECLKRNHGMGDTSIKFEQKSEYVMACGKHTVRGWCKNKRVGKQLASQKILQLLHPHVKNWGSLLRMYGRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of human DGCR8 core
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Protein DGCR8
total genus 52
structure length 196
sequence length 213
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2yt4A02
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2yt4A03
3.30.160.590 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2yt4A01
3ADIA 1ZBTA 4X64E 3T1YE 3OTOE 2L33A 4X8WA 4X65E 4JI1E 4LF7E 2RS7A 3J7Yp 4DR7E 1DI2A 2JY9A 5BR8E 2ZM6E 1STUA 3P1XA 2DIXA 2UUAE 4LF8E 4M30A 4WYQB 1XNRE 2KHXA 2L2MA 4OOGC 4DV0E 3C4TA 2VQEE 2LJHA 4LF9E 4B3ME 4M2ZA 2MDRA 4NXNE 3HTXA 1FKAE 1T4NA 2DMYA 1O0WA 1EKZA 2UUCE 2CPNA 2VQFE 5LMNE 4DR2E 1UHZA 2N3GA 4LF5E 4JI7E 2UUBE 1N34E 4DV2E 4OX9E 2N3HA 4LFAE 2UXCE 2NA2A 1QU6A 1YYOA 2LRSA 2B7VA 2UXBE 1GQEA 2F4VE 4DR3E 4AQYE 4WFTA 4NXME 4B3TE 1WHQA 4YY3E 2EZ6A 2UXDE 4JI4E 4DV1E 2NUFA 1IBME 2RTXA 4DR4E 4GKJE 4DV4E 4YHHE 1T4LB 4KHPE 4LFBE 2RS6A 4X66E 1XMOE 4DUYE 1YYKA 4B3RE 2LTRA 4DKKA 2UU9E 4DV7E 4JI2E 3VYXA 4K0KE 2LUQA 2LUPB 4JYAE 2RSMA 3ADJA 1RQ0A 1HR0E 4JI3E 1N32E 2E5LE 4LF4E 2DB2A 1T4OA 2LBSB 1J5EE 3T1HE 1I94E 2B3TB 3ADGA 2HHHE 4JI0E 1X49A 1RC7A 1HNZE 4DR5E 1XNQE 4JV5E 1YYWA 2L2KB 1UILA 4DUZE 2IHR1 1IBLE 1HNXE 2L3CA 4DR1E 2JVAA 4LFCE 1PKPA 2NUGA 1HNWE 1N36E 5CFFE 4DR6E 1WHNA 4JI6E 3LLHA 2YT4A 1YZ9A 3ADLA 1N33E 2LTSA 4DV6E 1J26A 4GKKE 3VYYA 1IBKE 2L2NA 4LF6E 2L3JA 4X62E 4JI5E 4B3SE 1FJGE 4JI8E 2B7TA 4DV5E 2NUEA 1X48A 1XMQE 4DV3E 1X47A 5LMUE 3C4BA 5IWAE
chains in the Genus database with same CATH superfamily
2MC5A 4X64E 2R1FA 4NZVA 1SFEA 2V87A 3J7Yp 4DR7E 1DI2A 1G2FC 3P1XA 2DIXA 2ENCA 2YTIA 3IWBA 2J7JA 2N8XA 4WYQB 1XNRE 2KHXA 4F9AB 2EPKX 4DV0E 2EM4A 3BIDA 3C6MA 2VRDA 3QG5C 4ZYGA 3KWRA 2V8QB 2M9AA 3HPSA 4BHCA 4RHBB 2YTFA 4B3ME 4F9BB 4M2ZA 2JR1A 4NXNE 1TF3A 1B69A 2EMXA 2EP3A 4F6MA 1T4NA 2EMIA 1O0WA 4WSGA 2H36X 2ADRA 4DR2E 1UHZA 2N3GA 1PJQA 4JI7E 2LCEA 4ZYHA 3AUZA 1ZR9A 2EL4A 4OX9E 2UXCE 4FK5C 2GHFA 4MLVA 4R2QA 2YZTA 1GQEA 2F4VE 2YTDA 2HJJA 4J8ZA 4DR3E 4NHRA 4NXME 2V86A 3KZZA 4JI4E 2DGCA 2NUFA 1EH8A 3F6HA 3HXLA 4YHHE 1JK1A 4KHPE 4R2RA 2YTEA 4LFBE 2YSPA 1YPNA 4DUYE 4DKKA 2FV4B 1A1FA 2EOYA 2EORA 2RSIA 2YU5A 3ZOQB 4JYAE 4LTYA 4MLQA 3MHSC 2V88A 1F2IG 5KL6A 1HR0E 4JI3E 4LF4E 2EMBA 2YWQA 2EN7A 4IJDA 2HHHE 1PJSA 1X49A 3ECRA 1HNZE 4O24A 2EWLA 4DR5E 2D9HA 2EJ4A 3EPKA 2IHR1 2JPAA 1HNXE 2EOMA 2FTXB 2JVAA 4O5GA 2EMWA 2ENAA 4LFCE 1WJPA 1IQSA 2R76A 2JWOA 2G7HA 1X5WA 1TN9A 1ZU1A 2MKDA 3LLHA 1YZ9A 3ADLA 2DRPA 1GTKA 4WXDA 2ODRC 4BC9A 1QNTA 4WSPA 4LF6E 3HPZA 2B7TA 5KL2A 3L00A 2EN2A 2EMLA 5IV8B 4L8NA 1NEIA 1ZBTA 2LO3A 2YTOA 3K6QA 1BBOA 2RS7A 2EN3A 5A2QC 2JY9A 5BR8E 2YRHA 2ZM6E 4P78A 2UUAE 1A1LA 4OOGC 2LT7A 3AV0A 2EPNA 3THNA 1X6FA 2HGHA 3VK6A 4GZNC 1A1KA 4M0VA 1A1IA 2EOEA 3HQ1A 5IXMB 2EMAA 2EPCA 2UUBE 4DV2E 3FIGA 2N3HA 2NA2A 1QU6A 1YUIA 2LRSA 1Z1BA 5TSEA 2PRTA 1TF6A 2B7VA 1YSAC 3BF2A 2UXBE 3LMLA 1EH7A 2EQ3A 2EM2A 2YU8A 5FLXC 1NCSA 4WFTA 4YY3E 2EZ6A 5IT9C 2UXDE 5KL3A 2EOIA 1A1GA 2EPOA 1IBME 2RTXA 4DR4E 3EPLA 4DV4E 1T4LB 2CT1A 5A6AA 5AC5A 2LV2A 1UN6B 1YYKA 1X3CA 2A25A 1GZ6A 3J80C 2ENHA 2EOZA 2UU9E 2MKNA 3VYXA 4K0KE 2DLKA 2LVHA 2RQLA 2NABA 2FGGA 2RSMA 2EN4A 3J81C 1L4SA 1T4OA 2LBSB 2M4IA 4O43A 4O4KA 2YTNA 2EN1A 1DQ3A 4BS9A 1RC7A 4KWYA 1P47A 1XNQE 4JV5E 5AASA 1X6HA 2EOFA 4DR1E 4X9JA 2K4VA 4DR6E 2EMHA 5A6BA 1IQOA 4HTGA 2EPMX 1A1JA 1SR9A 2EPRA 2EOHA 1J26A 4GKKE 4IS1C 3VHTB 4B3SE 3DJWA 4JI8E 1X48A 1BB8A 4DV3E 2WZOA 5LMUE 5T6JA 2WBTA 4L5NC 1A1HA 2GPIA 3IWCA 2E72A 2EMCA 3OTOE 2EPLX 1AH5A 4X8WA 4M9VC 4X65E 4JI1E 1YUJA 4DMIA 4BBYA 3MHHC 4LF8E 5LLQA 2EQ0A 4R2CA 4M30A 2EN8A 2EN6A 1JK2A 2LE2A 2EMFA 5AE3A 2EM0A 2V85A 4BHBA 2EM3A 2MDRA 4P7DA 3J7AG 3UK3C 2MDGA 2ODRD 5LMNE 5AE2A 2JOBA 2EOJA 4GEQB 3JTZA 2EOSA 3C6KA 2CSHA 3KZYA 4R8OA 2EPAA 1RMDA 2YRMA 5KL5A 4AQYE 2E1MA 1LLMC 1WHQA 2CTDA 2EL6A 2L92A 3M99B 1PJTA 4WXCA 1YFHA 2RS6A 4X66E 4B3RE 4R2DA 5A69A 2YTPA 4DV7E 4N4RB 2EM7A 4JI2E 5A6BD 2LUPB 3ADJA 1PDAA 4TUIA 1RQ0A 2DLQA 1AAYA 1N32E 1T38A 2EOQA 4F9CB 2EOOA 2MC6A 1KYQA 5AE1A 4WPYA 2B3TB 2JYAA 4JI0E 2EM9A 2YSOA 3TQMA 2VE7C 2L2KB 4DUZE 2EM6A 4RH8A 2EMYA 2KOUA 5KL4A 1ZBQA 2NUGA 2EMGA 2K7IA 5CFFE 2L8TA 2YTQA 3JAMC 1MEYC 3IWDA 4BCAA 1N33E 2LTSA 5KL7A 2GLIA 2YPNA 3VYYA 2L2NA 2L3JA 4X62E 4JI5E 2EM8A 1FJGE 2EPPA 2NUEA 1XMQE 2YTGA 4F2JC 2JOXA 5F3WA 4BMJA 3C4BA 5IWAE 3ADIA 4R2EA 3T1YE 2L33A 2EMKA 4KZSA 4LF7E 2M1SA 2YTJA 1WXRA 4F6NA 1STUA 1N3GA 2I9IA 2L2MA 2EQ1A 2ELYA 2V89A 3C4TA 3EQ1A 2VQEE 2LJHA 4LF9E 2EOXA 2RPCA 4R2SA 4I8OA 3RMPA 3HTXA 2LMZA 4HEIA 2DMIA 5LL6R 1FKAE 2DMYA 5A6JA 2EPZA 4Q35B 1EKZA 2UUCE 2CPNA 2VQFE 1ZAAC 2YRKA 4LF5E 1N34E 5A6KA 1G2DC 2EMZA 4LFAE 2Q8UA 4TUGA 1YYOA 3OMLA 3EPHA 3DF6A 2LJUA 2KONA 1KJKA 1MGTA 4B3TE 2EE8A 4DV1E 2VF1A 2EM5A 4GKJE 1WRJA 4F54A 5AC4A 3BBGA 1XMOE 2L6MA 4ZYDA 4R2AA 2LTRA 1T39A 4BC7A 2BB8A 2JP9A 3H09A 1X6EA 2DSYA 2LUQA 4LU9A 3F6GA 2EPXA 3BGHA 2EL5A 2E5LE 5ADZA 2DB2A 2WBSA 4R03A 1UBDC 1J5EE 3T1HE 1I94E 3ADGA 2JXPA 2HC5A 2I13A 2ELZA 1YYWA 1UILA 1IBLE 2WBUA 2L3CA 4R2PA 2F8BA 4ZYEA 1HNWE 1PKPA 3JU0A 1N36E 3EPJA 1WHNA 1EH6A 4JI6E 1BBGA 2YT4A 5DNYA 2WCC3 3THOB 4DV6E 2BBGA 2M7QA 1IBKE 1DGCA 2EPUA 3MSWA 2V83A 2B9DA 4DV5E 4Q28A 1IMUA 1X47A 4WX9A
chains in the Genus database with same CATH topology
2MC5A 3IWCA 3ADIA 1ZBTA 4X64E 3T1YE 3OTOE 2L33A 4X8WA 4KZSA 3K6QA 4X65E 4JI1E 4LF7E 2M1SA 2V87A 2RS7A 3J7Yp 4DR7E 5A2QC 2JY9A 1DI2A 5BR8E 1WXRA 2ZM6E 4DMIA 1STUA 3P1XA 2DIXA 4P78A 2UUAE 4BBYA 4LF8E 3IWBA 4M30A 4WYQB 1XNRE 2KHXA 2L2MA 4F9AB 4OOGC 4DV0E 2LE2A 3AV0A 2V89A 3C4TA 3KWRA 2V8QB 2LJHA 5AE3A 3HPSA 2VQEE 4LF9E 2V85A 4B3ME 4F9BB 4M2ZA 4I8OA 2JR1A 2MDRA 4NXNE 3RMPA 3HTXA 2LMZA 3VK6A 4P7DA 3J7AG 4M0VA 5LL6R 1FKAE 1T4NA 2DMYA 1O0WA 3HQ1A 2H36X 2ODRD 1EKZA 2CPNA 2UUCE 2VQFE 5LMNE 4DR2E 1UHZA 5AE2A 2JOBA 2N3GA 4LF5E 4JI7E 2UUBE 4L8NA 1N34E 3AUZA 4DV2E 3FIGA 2N3HA 3JTZA 4GEQB 2NA2A 4TUGA 1QU6A 4LFAE 4OX9E 1YYOA 2UXCE 2LRSA 3OMLA 3DF6A 2B7VA 2YZTA 4BMJA 4R8OA 2UXBE 3LMLA 1GQEA 2KONA 2F4VE 4J8ZA 5FLXC 4DR3E 4AQYE 2E1MA 4WFTA 4NXME 4B3TE 2V86A 1WHQA 4YY3E 2EZ6A 2L92A 5IT9C 2UXDE 4JI4E 4DV1E 2VF1A 2NUFA 1IBME 2RTXA 3F6HA 3HXLA 4DR4E 4DV4E 4YHHE 1T4LB 4GKJE 4KHPE 4F54A 4LFBE 2RS6A 4X66E 1XMOE 4DUYE 2L6MA 1GZ6A 1YYKA 2LTRA 4B3RE 4BC7A 3J80C 4DKKA 2UU9E 4DV7E 4JI2E 2FV4B 3VYXA 3H09A 4K0KE 2DSYA 3ZOQB 2LUQA 2LUPB 4JYAE 4LU9A 4LTYA 2FGGA 2RSMA 2V88A 3ADJA 3F6GA 4TUIA 1RQ0A 3J81C 1HR0E 4JI3E 1N32E 2E5LE 4LF4E 5ADZA 2DB2A 4F9CB 4R03A 2MC6A 1T4OA 2LBSB 2M4IA 1J5EE 5AE1A 3T1HE 1I94E 2B3TB 3ADGA 4WPYA 2HHHE 1DQ3A 4JI0E 1X49A 4BS9A 1RC7A 1HNZE 2EWLA 4DR5E 1XNQE 4JV5E 5AASA 1YYWA 2VE7C 2L2KB 1UILA 4DUZE 2IHR1 1IBLE 1HNXE 2L3CA 4DR1E 2FTXB 2JVAA 2KOUA 2F8BA 4LFCE 1PKPA 1ZBQA 2NUGA 2K4VA 1HNWE 3JU0A 1N36E 5CFFE 4DR6E 1WHNA 2JWOA 2G7HA 2L8TA 3JAMC 4JI6E 3LLHA 2YT4A 1YZ9A 5DNYA 3ADLA 3IWDA 4BCAA 1N33E 4BC9A 2ODRC 2LTSA 1SR9A 4DV6E 1J26A 4GKKE 2M7QA 3VYYA 1IBKE 2L2NA 4WSPA 4LF6E 2L3JA 4X62E 3MSWA 4JI5E 3HPZA 4B3SE 3DJWA 2V83A 2B9DA 2B7TA 4JI8E 4DV5E 1X48A 1XMQE 1FJGE 4Q28A 2NUEA 4DV3E 1X47A 2JOXA 2WZOA 5LMUE 5T6JA 3C4BA 4L5NC 5IWAE 5F3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ADI A;  1ZBT A;  4X64 E;  3T1Y E;  3OTO E;  2L33 A;  4X8W A;  4X65 E;  4JI1 E;  4LF7 E;  2RS7 A;  3J7Y p;  4DR7 E;  1DI2 A;  2JY9 A;  5BR8 E;  2ZM6 E;  1STU A;  3P1X A;  2DIX A;  2UUA E;  4LF8 E;  4M30 A;  4WYQ B;  1XNR E;  2KHX A;  2L2M A;  4OOG C;  4DV0 E;  3C4T A;  2VQE E;  2LJH A;  4LF9 E;  4B3M E;  4M2Z A;  2MDR A;  4NXN E;  3HTX A;  1FKA E;  1T4N A;  2DMY A;  1O0W A;  1EKZ A;  2UUC E;  2CPN A;  2VQF E;  5LMN E;  4DR2 E;  1UHZ A;  2N3G A;  4LF5 E;  4JI7 E;  2UUB E;  1N34 E;  4DV2 E;  4OX9 E;  2N3H A;  4LFA E;  2UXC E;  2NA2 A;  1QU6 A;  1YYO A;  2LRS A;  2B7V A;  2UXB E;  1GQE A;  2F4V E;  4DR3 E;  4AQY E;  4WFT A;  4NXM E;  4B3T E;  1WHQ A;  4YY3 E;  2EZ6 A;  2UXD E;  4JI4 E;  4DV1 E;  2NUF A;  1IBM E;  2RTX A;  4DR4 E;  4GKJ E;  4DV4 E;  4YHH E;  1T4L B;  4KHP E;  4LFB E;  2RS6 A;  4X66 E;  1XMO E;  4DUY E;  1YYK A;  4B3R E;  2LTR A;  4DKK A;  2UU9 E;  4DV7 E;  4JI2 E;  3VYX A;  4K0K E;  2LUQ A;  2LUP B;  4JYA E;  2RSM A;  3ADJ A;  1RQ0 A;  1HR0 E;  4JI3 E;  1N32 E;  2E5L E;  4LF4 E;  2DB2 A;  1T4O A;  2LBS B;  1J5E E;  3T1H E;  1I94 E;  2B3T B;  3ADG A;  2HHH E;  4JI0 E;  1X49 A;  1RC7 A;  1HNZ E;  4DR5 E;  1XNQ E;  4JV5 E;  1YYW A;  2L2K B;  1UIL A;  4DUZ E;  2IHR 1;  1IBL E;  1HNX E;  2L3C A;  4DR1 E;  2JVA A;  4LFC E;  1PKP A;  2NUG A;  1HNW E;  1N36 E;  5CFF E;  4DR6 E;  1WHN A;  4JI6 E;  3LLH A;  2YT4 A;  1YZ9 A;  3ADL A;  1N33 E;  2LTS A;  4DV6 E;  1J26 A;  4GKK E;  3VYY A;  1IBK E;  2L2N A;  4LF6 E;  2L3J A;  4X62 E;  4JI5 E;  4B3S E;  1FJG E;  4JI8 E;  2B7T A;  4DV5 E;  2NUE A;  1X48 A;  1XMQ E;  4DV3 E;  1X47 A;  5LMU E;  3C4B A;  5IWA E; 
#chains in the Genus database with same CATH topology
 2MC5 A;  4X64 E;  2R1F A;  4NZV A;  1SFE A;  2V87 A;  3J7Y p;  4DR7 E;  1DI2 A;  1G2F C;  3P1X A;  2DIX A;  2ENC A;  2YTI A;  3IWB A;  2J7J A;  2N8X A;  4WYQ B;  1XNR E;  2KHX A;  4F9A B;  2EPK X;  4DV0 E;  2EM4 A;  3BID A;  3C6M A;  2VRD A;  3QG5 C;  4ZYG A;  3KWR A;  2V8Q B;  2M9A A;  3HPS A;  4BHC A;  4RHB B;  2YTF A;  4B3M E;  4F9B B;  4M2Z A;  2JR1 A;  4NXN E;  1TF3 A;  1B69 A;  2EMX A;  2EP3 A;  4F6M A;  1T4N A;  2EMI A;  1O0W A;  4WSG A;  2H36 X;  2ADR A;  4DR2 E;  1UHZ A;  2N3G A;  1PJQ A;  4JI7 E;  2LCE A;  4ZYH A;  3AUZ A;  1ZR9 A;  2EL4 A;  4OX9 E;  2UXC E;  4FK5 C;  2GHF A;  4MLV A;  4R2Q A;  2YZT A;  1GQE A;  2F4V E;  2YTD A;  2HJJ A;  4J8Z A;  4DR3 E;  4NHR A;  4NXM E;  2V86 A;  3KZZ A;  4JI4 E;  2DGC A;  2NUF A;  1EH8 A;  3F6H A;  3HXL A;  4YHH E;  1JK1 A;  4KHP E;  4R2R A;  2YTE A;  4LFB E;  2YSP A;  1YPN A;  4DUY E;  4DKK A;  2FV4 B;  1A1F A;  2EOY A;  2EOR A;  2RSI A;  2YU5 A;  3ZOQ B;  4JYA E;  4LTY A;  4MLQ A;  3MHS C;  2V88 A;  1F2I G;  5KL6 A;  1HR0 E;  4JI3 E;  4LF4 E;  2EMB A;  2YWQ A;  2EN7 A;  4IJD A;  2HHH E;  1PJS A;  1X49 A;  3ECR A;  1HNZ E;  4O24 A;  2EWL A;  4DR5 E;  2D9H A;  2EJ4 A;  3EPK A;  2IHR 1;  2JPA A;  1HNX E;  2EOM A;  2FTX B;  2JVA A;  4O5G A;  2EMW A;  2ENA A;  4LFC E;  1WJP A;  1IQS A;  2R76 A;  2JWO A;  2G7H A;  1X5W A;  1TN9 A;  1ZU1 A;  2MKD A;  3LLH A;  1YZ9 A;  3ADL A;  2DRP A;  1GTK A;  4WXD A;  2ODR C;  4BC9 A;  1QNT A;  4WSP A;  4LF6 E;  3HPZ A;  2B7T A;  5KL2 A;  3L00 A;  2EN2 A;  2EML A;  5IV8 B;  4L8N A;  1NEI A;  1ZBT A;  2LO3 A;  2YTO A;  3K6Q A;  1BBO A;  2RS7 A;  2EN3 A;  5A2Q C;  2JY9 A;  5BR8 E;  2YRH A;  2ZM6 E;  4P78 A;  2UUA E;  1A1L A;  4OOG C;  2LT7 A;  3AV0 A;  2EPN A;  3THN A;  1X6F A;  2HGH A;  3VK6 A;  4GZN C;  1A1K A;  4M0V A;  1A1I A;  2EOE A;  3HQ1 A;  5IXM B;  2EMA A;  2EPC A;  2UUB E;  4DV2 E;  3FIG A;  2N3H A;  2NA2 A;  1QU6 A;  1YUI A;  2LRS A;  1Z1B A;  5TSE A;  2PRT A;  1TF6 A;  2B7V A;  1YSA C;  3BF2 A;  2UXB E;  3LML A;  1EH7 A;  2EQ3 A;  2EM2 A;  2YU8 A;  5FLX C;  1NCS A;  4WFT A;  4YY3 E;  2EZ6 A;  5IT9 C;  2UXD E;  5KL3 A;  2EOI A;  1A1G A;  2EPO A;  1IBM E;  2RTX A;  4DR4 E;  3EPL A;  4DV4 E;  1T4L B;  2CT1 A;  5A6A A;  5AC5 A;  2LV2 A;  1UN6 B;  1YYK A;  1X3C A;  2A25 A;  1GZ6 A;  3J80 C;  2ENH A;  2EOZ A;  2UU9 E;  2MKN A;  3VYX A;  4K0K E;  2DLK A;  2LVH A;  2RQL A;  2NAB A;  2FGG A;  2RSM A;  2EN4 A;  3J81 C;  1L4S A;  1T4O A;  2LBS B;  2M4I A;  4O43 A;  4O4K A;  2YTN A;  2EN1 A;  1DQ3 A;  4BS9 A;  1RC7 A;  4KWY A;  1P47 A;  1XNQ E;  4JV5 E;  5AAS A;  1X6H A;  2EOF A;  4DR1 E;  4X9J A;  2K4V A;  4DR6 E;  2EMH A;  5A6B A;  1IQO A;  4HTG A;  2EPM X;  1A1J A;  1SR9 A;  2EPR A;  2EOH A;  1J26 A;  4GKK E;  4IS1 C;  3VHT B;  4B3S E;  3DJW A;  4JI8 E;  1X48 A;  1BB8 A;  4DV3 E;  2WZO A;  5LMU E;  5T6J A;  2WBT A;  4L5N C;  1A1H A;  2GPI A;  3IWC A;  2E72 A;  2EMC A;  3OTO E;  2EPL X;  1AH5 A;  4X8W A;  4M9V C;  4X65 E;  4JI1 E;  1YUJ A;  4DMI A;  4BBY A;  3MHH C;  4LF8 E;  5LLQ A;  2EQ0 A;  4R2C A;  4M30 A;  2EN8 A;  2EN6 A;  1JK2 A;  2LE2 A;  2EMF A;  5AE3 A;  2EM0 A;  2V85 A;  4BHB A;  2EM3 A;  2MDR A;  4P7D A;  3J7A G;  3UK3 C;  2MDG A;  2ODR D;  5LMN E;  5AE2 A;  2JOB A;  2EOJ A;  4GEQ B;  3JTZ A;  2EOS A;  3C6K A;  2CSH A;  3KZY A;  4R8O A;  2EPA A;  1RMD A;  2YRM A;  5KL5 A;  4AQY E;  2E1M A;  1LLM C;  1WHQ A;  2CTD A;  2EL6 A;  2L92 A;  3M99 B;  1PJT A;  4WXC A;  1YFH A;  2RS6 A;  4X66 E;  4B3R E;  4R2D A;  5A69 A;  2YTP A;  4DV7 E;  4N4R B;  2EM7 A;  4JI2 E;  5A6B D;  2LUP B;  3ADJ A;  1PDA A;  4TUI A;  1RQ0 A;  2DLQ A;  1AAY A;  1N32 E;  1T38 A;  2EOQ A;  4F9C B;  2EOO A;  2MC6 A;  1KYQ A;  5AE1 A;  4WPY A;  2B3T B;  2JYA A;  4JI0 E;  2EM9 A;  2YSO A;  3TQM A;  2VE7 C;  2L2K B;  4DUZ E;  2EM6 A;  4RH8 A;  2EMY A;  2KOU A;  5KL4 A;  1ZBQ A;  2NUG A;  2EMG A;  2K7I A;  5CFF E;  2L8T A;  2YTQ A;  3JAM C;  1MEY C;  3IWD A;  4BCA A;  1N33 E;  2LTS A;  5KL7 A;  2GLI A;  2YPN A;  3VYY A;  2L2N A;  2L3J A;  4X62 E;  4JI5 E;  2EM8 A;  1FJG E;  2EPP A;  2NUE A;  1XMQ E;  2YTG A;  4F2J C;  2JOX A;  5F3W A;  4BMJ A;  3C4B A;  5IWA E;  3ADI A;  4R2E A;  3T1Y E;  2L33 A;  2EMK A;  4KZS A;  4LF7 E;  2M1S A;  2YTJ A;  1WXR A;  4F6N A;  1STU A;  1N3G A;  2I9I A;  2L2M A;  2EQ1 A;  2ELY A;  2V89 A;  3C4T A;  3EQ1 A;  2VQE E;  2LJH A;  4LF9 E;  2EOX A;  2RPC A;  4R2S A;  4I8O A;  3RMP A;  3HTX A;  2LMZ A;  4HEI A;  2DMI A;  5LL6 R;  1FKA E;  2DMY A;  5A6J A;  2EPZ A;  4Q35 B;  1EKZ A;  2UUC E;  2CPN A;  2VQF E;  1ZAA C;  2YRK A;  4LF5 E;  1N34 E;  5A6K A;  1G2D C;  2EMZ A;  4LFA E;  2Q8U A;  4TUG A;  1YYO A;  3OML A;  3EPH A;  3DF6 A;  2LJU A;  2KON A;  1KJK A;  1MGT A;  4B3T E;  2EE8 A;  4DV1 E;  2VF1 A;  2EM5 A;  4GKJ E;  1WRJ A;  4F54 A;  5AC4 A;  3BBG A;  1XMO E;  2L6M A;  4ZYD A;  4R2A A;  2LTR A;  1T39 A;  4BC7 A;  2BB8 A;  2JP9 A;  3H09 A;  1X6E A;  2DSY A;  2LUQ A;  4LU9 A;  3F6G A;  2EPX A;  3BGH A;  2EL5 A;  2E5L E;  5ADZ A;  2DB2 A;  2WBS A;  4R03 A;  1UBD C;  1J5E E;  3T1H E;  1I94 E;  3ADG A;  2JXP A;  2HC5 A;  2I13 A;  2ELZ A;  1YYW A;  1UIL A;  1IBL E;  2WBU A;  2L3C A;  4R2P A;  2F8B A;  4ZYE A;  1HNW E;  1PKP A;  3JU0 A;  1N36 E;  3EPJ A;  1WHN A;  1EH6 A;  4JI6 E;  1BBG A;  2YT4 A;  5DNY A;  2WCC 3;  3THO B;  4DV6 E;  2BBG A;  2M7Q A;  1IBK E;  1DGC A;  2EPU A;  3MSW A;  2V83 A;  2B9D A;  4DV5 E;  4Q28 A;  1IMU A;  1X47 A;  4WX9 A; 
#chains in the Genus database with same CATH homology
 2MC5 A;  3IWC A;  3ADI A;  1ZBT A;  4X64 E;  3T1Y E;  3OTO E;  2L33 A;  4X8W A;  4KZS A;  3K6Q A;  4X65 E;  4JI1 E;  4LF7 E;  2M1S A;  2V87 A;  2RS7 A;  3J7Y p;  4DR7 E;  5A2Q C;  2JY9 A;  1DI2 A;  5BR8 E;  1WXR A;  2ZM6 E;  4DMI A;  1STU A;  3P1X A;  2DIX A;  4P78 A;  2UUA E;  4BBY A;  4LF8 E;  3IWB A;  4M30 A;  4WYQ B;  1XNR E;  2KHX A;  2L2M A;  4F9A B;  4OOG C;  4DV0 E;  2LE2 A;  3AV0 A;  2V89 A;  3C4T A;  3KWR A;  2V8Q B;  2LJH A;  5AE3 A;  3HPS A;  2VQE E;  4LF9 E;  2V85 A;  4B3M E;  4F9B B;  4M2Z A;  4I8O A;  2JR1 A;  2MDR A;  4NXN E;  3RMP A;  3HTX A;  2LMZ A;  3VK6 A;  4P7D A;  3J7A G;  4M0V A;  5LL6 R;  1FKA E;  1T4N A;  2DMY A;  1O0W A;  3HQ1 A;  2H36 X;  2ODR D;  1EKZ A;  2CPN A;  2UUC E;  2VQF E;  5LMN E;  4DR2 E;  1UHZ A;  5AE2 A;  2JOB A;  2N3G A;  4LF5 E;  4JI7 E;  2UUB E;  4L8N A;  1N34 E;  3AUZ A;  4DV2 E;  3FIG A;  2N3H A;  3JTZ A;  4GEQ B;  2NA2 A;  4TUG A;  1QU6 A;  4LFA E;  4OX9 E;  1YYO A;  2UXC E;  2LRS A;  3OML A;  3DF6 A;  2B7V A;  2YZT A;  4BMJ A;  4R8O A;  2UXB E;  3LML A;  1GQE A;  2KON A;  2F4V E;  4J8Z A;  5FLX C;  4DR3 E;  4AQY E;  2E1M A;  4WFT A;  4NXM E;  4B3T E;  2V86 A;  1WHQ A;  4YY3 E;  2EZ6 A;  2L92 A;  5IT9 C;  2UXD E;  4JI4 E;  4DV1 E;  2VF1 A;  2NUF A;  1IBM E;  2RTX A;  3F6H A;  3HXL A;  4DR4 E;  4DV4 E;  4YHH E;  1T4L B;  4GKJ E;  4KHP E;  4F54 A;  4LFB E;  2RS6 A;  4X66 E;  1XMO E;  4DUY E;  2L6M A;  1GZ6 A;  1YYK A;  2LTR A;  4B3R E;  4BC7 A;  3J80 C;  4DKK A;  2UU9 E;  4DV7 E;  4JI2 E;  2FV4 B;  3VYX A;  3H09 A;  4K0K E;  2DSY A;  3ZOQ B;  2LUQ A;  2LUP B;  4JYA E;  4LU9 A;  4LTY A;  2FGG A;  2RSM A;  2V88 A;  3ADJ A;  3F6G A;  4TUI A;  1RQ0 A;  3J81 C;  1HR0 E;  4JI3 E;  1N32 E;  2E5L E;  4LF4 E;  5ADZ A;  2DB2 A;  4F9C B;  4R03 A;  2MC6 A;  1T4O A;  2LBS B;  2M4I A;  1J5E E;  5AE1 A;  3T1H E;  1I94 E;  2B3T B;  3ADG A;  4WPY A;  2HHH E;  1DQ3 A;  4JI0 E;  1X49 A;  4BS9 A;  1RC7 A;  1HNZ E;  2EWL A;  4DR5 E;  1XNQ E;  4JV5 E;  5AAS A;  1YYW A;  2VE7 C;  2L2K B;  1UIL A;  4DUZ E;  2IHR 1;  1IBL E;  1HNX E;  2L3C A;  4DR1 E;  2FTX B;  2JVA A;  2KOU A;  2F8B A;  4LFC E;  1PKP A;  1ZBQ A;  2NUG A;  2K4V A;  1HNW E;  3JU0 A;  1N36 E;  5CFF E;  4DR6 E;  1WHN A;  2JWO A;  2G7H A;  2L8T A;  3JAM C;  4JI6 E;  3LLH A;  2YT4 A;  1YZ9 A;  5DNY A;  3ADL A;  3IWD A;  4BCA A;  1N33 E;  4BC9 A;  2ODR C;  2LTS A;  1SR9 A;  4DV6 E;  1J26 A;  4GKK E;  2M7Q A;  3VYY A;  1IBK E;  2L2N A;  4WSP A;  4LF6 E;  2L3J A;  4X62 E;  3MSW A;  4JI5 E;  3HPZ A;  4B3S E;  3DJW A;  2V83 A;  2B9D A;  2B7T A;  4JI8 E;  4DV5 E;  1X48 A;  1XMQ E;  1FJG E;  4Q28 A;  2NUE A;  4DV3 E;  1X47 A;  2JOX A;  2WZO A;  5LMU E;  5T6J A;  3C4B A;  4L5N C;  5IWA E;  5F3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...