2V89A

Crystal structure of rag2-phd finger in complex with h3k4me3 peptide at 1.1a resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
78
structure length
78
Chain Sequence
SPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQIARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VDJ RECOMBINATION-ACTIVATING PROTEIN 2
publication title Rag2 Phd Finger Couples Histone H3 Lysine 4 Trimethylation with V(D)J Recombination.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 13
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.290 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2v89A01
2V83A 2V87A 2V85A 2V88A 2V89A 2JWOA 2V86A
chains in the Genus database with same CATH superfamily
2MC6A 1N36E 1HNXE 1T4LB 1KJKA 2EPXA 4R8OA 1WJPA 1N3GA 2MKNA 2EPRA 2V86A 1RMDA 2B7TA 2WBSA 1PDAA 2DB2A 2R1FA 5A6JA 2EM0A 2YRMA 5KL3A 4B3TE 1TF3A 4LF9E 1UN6B 1T38A 4WYQB 2WZOA 2EMKA 2EJ4A 2HGHA 2LJHA 5AE1A 2FV4B 2LJUA 2I9IA 2EN8A 1J5EE 1X6FA 2EPPA 2EPUA 1QU6A 3IWBA 3JTZA 1FKAE 2IHR1 4LU9A 1KYQA 2MC5A 1A1IA 1ZU1A 4TUGA 1DQ3A 2LCEA 3EPKA 4DV0E 1B69A 1PKPA 1IQOA 4R2SA 2J7JA 3THNA 2EOYA 5AASA 4NXNE 4GKKE 4JI0E 1UBDC 2N8XA 2EOQA 4BCAA 2GHFA 2H36X 4DV2E 2RTXA 3HQ1A 3JU0A 3ZOQB 4GKJE 4DKKA 2EOEA 4RH8A 4L5NC 1DI2A 3DF6A 5AE2A 2R76A 4Q35B 2MKDA 2EOIA 4WSPA 2EM5A 2L3CA 3KZZA 2YTQA 2RPCA 3F6HA 1XNQE 1NCSA 2UXDE 4O43A 4X9JA 2M1SA 1YUIA 1GTKA 3M99B 4ZYEA 4IS1C 3AV0A 2D9HA 2F4VE 2LT7A 3C6KA 4JI3E 3T1YE 4J8ZA 1RC7A 2L92A 2EQ0A 4L8NA 2L8TA 2GPIA 4TUIA 2BBGA 3MHSC 1X48A 2MDRA 3OTOE 2V87A 2EPLX 3HXLA 3AUZA 2KOUA 4R03A 3BIDA 5TSEA 4F9CB 1GZ6A 2LVHA 4DR1E 2UU9E 2NUGA 1MGTA 2V89A 5A6AA 2YPNA 5DNYA 2EM9A 2EOZA 1O0WA 5A2QC 2LV2A 1UHZA 1ZBQA 4WX9A 3IWDA 2EN4A 4LTYA 2EOMA 1L4SA 1JK1A 2EN1A 1T39A 1IMUA 3EQ1A 2KONA 3EPHA 3MHHC 3L00A 2V8QB 2ADRA 5KL5A 4KZSA 4LF7E 2EPOA 4JI2E 2N3GA 4FK5C 1EH7A 3QG5C 4O24A 2DMIA 1RQ0A 1PJTA 5LL6R 2M7QA 1T4OA 3T1HE 4BHBA 2EPKX 1A1LA 3BF2A 4OX9E 2ENAA 5A69A 2EPZA 2EWLA 4R2DA 5LLQA 4DR2E 2HC5A 2JR1A 3HTXA 4JI6E 2V83A 3ADLA 4BC9A 1N32E 2UUBE 2B9DA 3ADGA 4I8OA 2EOFA 3KWRA 4IJDA 4ZYGA 1YSAC 3LMLA 5A6BD 4M30A 5AC5A 2LRSA 2HHHE 1DGCA 4MLVA 5ADZA 2LUQA 5KL7A 5IT9C 4WPYA 2YTIA 1STUA 5CFFE 4DR3E 1G2DC 2DGCA 1ZR9A 2EMWA 2K4VA 4DV6E 2WBTA 2EPAA 3VYXA 2JOBA 5IXMB 2DLKA 2EMIA 2V85A 5KL2A 1J26A 2EOXA 5T6JA 5KL4A 1A1GA 3LLHA 2VF1A 2JWOA 2G7HA 1PJSA 1HNZE 1TF6A 1QNTA 2WCC3 2UUAE 2RS7A 2RSMA 2JPAA 2YRHA 2CPNA 2ENHA 3J7AG 2V88A 4LFAE 3TQMA 3THOB 1GQEA 2EN7A 4ZYHA 2RSIA 3H09A 4M0VA 2LMZA 2YTJA 5FLXC 3RMPA 3K6QA 4LFBE 4BBYA 4R2PA 2YTFA 2EM6A 4OOGC 2B7VA 4DR6E 2NA2A 2B3TB 2EOJA 4LF6E 4HTGA 4LFCE 4AQYE 2DRPA 4RHBB 1EH6A 1EH8A 2EPMX 4F54A 3C6MA 2JXPA 1X49A 2EMZA 4YHHE 1LLMC 4LF5E 1X3CA 4O5GA 2DMYA 2N3HA 2EMFA 4X64E 2ELYA 4DV7E 2JP9A 4R2RA 1WHQA 3EPJA 1X47A 4N4RB 4NHRA 2YRKA 4LF8E 4DV3E 4HEIA 2EOHA 1IBKE 4JV5E 1YYWA 1HR0E 2EQ1A 2RQLA 1X6EA 4JI7E 1ZBTA 2EPCA 2A25A 2CT1A 2YTEA 2YTOA 3HPZA 1HNWE 2K7IA 3OMLA 3C4TA 1N33E 2E72A 2ZM6E 2DLQA 4P78A 2LUPB 2EOOA 2EL6A 3VHTB 2JVAA 1AH5A 4MLQA 1P47A 4F9BB 2UUCE 2EN6A 4DUYE 1WHNA 4JI4E 2RS6A 2EMYA 2LE2A 5LMUE 2L2NA 1YUJA 2EL5A 1IBLE 1SR9A 4DV4E 4M2ZA 1F2IG 2LO3A 3EPLA 2M9AA 2EORA 5IWAE 2NABA 5A6KA 1XNRE 4BC7A 4X8WA 5AE3A 1A1FA 4BMJA 2FTXB 2DSYA 2EL4A 2M4IA 4R2CA 4DR7E 1X5WA 1A1JA 4WFTA 2LTRA 3KZYA 3J7Yp 3BBGA 2EMXA 1PJQA 4DV1E 2ELZA 4DR5E 4DV5E 2LBSB 1IQSA 2YTDA 4KWYA 2L3JA 4B3RE 5KL6A 4X65E 1FJGE 2JY9A 4R2AA 2VQFE 2EQ3A 3MSWA 3VYYA 2YU5A 1A1HA 2EM4A 1ZAAC 2HJJA 2CTDA 4K0KE 2YTPA 2YWQA 4R2EA 2VE7C 4JI1E 2UXCE 4BHCA 4X66E 2L2MA 2YT4A 1YFHA 1I94E 2WBUA 2EM3A 2L33A 4GZNC 3FIGA 1MEYC 5F3WA 3UK3C 5A6BA 2ENCA 1TN9A 1WXRA 4JI5E 2NUEA 1BB8A 4DUZE 2EMHA 1YYKA 5IV8B 2Q8UA 2EP3A 2YTNA 4NZVA 3DJWA 4BS9A 5BR8E 2EM8A 2JOXA 2E5LE 2EM7A 2EMBA 4WSGA 2EZ6A 4F2JC 1YYOA 4X62E 1N34E 3VK6A 4R2QA 3P1XA 4O4KA 4ZYDA 4KHPE 2EN2A 4P7DA 4WXCA 2YZTA 2KHXA 3ADIA 5AC4A 4F9AB 2PRTA 4F6NA 2EN3A 1A1KA 5LMNE 4F6MA 4GEQB 1G2FC 3ECRA 2EMCA 3J81C 1UILA 1T4NA 2UXBE 2YU8A 1BBOA 1EKZA 2FGGA 1X6HA 1NEIA 2EE8A 2CSHA 2DIXA 2I13A 2EOSA 4JI8E 2MDGA 4B3ME 2EM2A 1SFEA 2YSPA 2F8BA 3JAMC 3HPSA 1XMOE 4B3SE 4DMIA 2JYAA 2E1MA 2VQEE 4YY3E 3C4BA 1BBGA 2YTGA 3BGHA 4NXME 2BB8A 2L6MA 4Q28A 1IBME 1YPNA 4LF4E 2GLIA 1YZ9A 4WXDA 1XMQE 3J80C 2YSOA 2EMGA 2L2KB 2ODRD 2LTSA 2EMAA 4M9VC 2VRDA 1JK2A 2EMLA 1Z1BA 3F6GA 4JYAE 2ODRC 1AAYA 1WRJA 3ADJA 2EPNA 3IWCA 2NUFA 4DR4E
chains in the Genus database with same CATH topology
1X49A 2KONA 4YHHE 2MC6A 1N36E 2V8QB 4LF5E 2VE7C 4JI1E 1HNXE 4KZSA 1T4LB 4LF7E 4X66E 2L2MA 2UXCE 2YT4A 4R8OA 2DMYA 1I94E 2N3HA 4JI2E 2L33A 2N3GA 4X64E 4DV7E 3FIGA 5F3WA 2V86A 2B7TA 2DB2A 1WHQA 4B3TE 1RQ0A 1X47A 1WXRA 5LL6R 2M7QA 4JI5E 1T4OA 4LF9E 3T1HE 2NUEA 4WYQB 4LF8E 2WZOA 4DV3E 2EZ6A 4DUZE 1YYKA 1IBKE 4JV5E 1YYWA 1HR0E 1RC7A 2LJHA 5AE1A 4OX9E 4JI7E 2FV4B 1ZBTA 3DJWA 3HPZA 1J5EE 2EWLA 4BS9A 1HNWE 4DR2E 1QU6A 3OMLA 5BR8E 3IWBA 3JTZA 2JR1A 3C4TA 1FKAE 2JOXA 3HTXA 2E5LE 1N33E 2IHR1 4JI6E 2ZM6E 2V83A 3ADLA 4LU9A 4BC9A 1N32E 2MC5A 2B9DA 4P78A 2LUPB 3ADGA 4I8OA 4TUGA 1DQ3A 3KWRA 2UUBE 4DV0E 3LMLA 1YYOA 1PKPA 4X62E 1N34E 2JVAA 4M30A 3VK6A 2LRSA 2HHHE 3P1XA 4F9BB 5AASA 2UUCE 4NXNE 4GKKE 4JI0E 4DUYE 1WHNA 5ADZA 2LUQA 4BCAA 2RS6A 5IT9C 4WPYA 4JI4E 1STUA 4P7DA 2YZTA 5CFFE 4DR3E 2H36X 4DV2E 2KHXA 2K4VA 2RTXA 2LE2A 3HQ1A 3JU0A 3ZOQB 5LMUE 4DV6E 4DKKA 3ADIA 3VYXA 2JOBA 4GKJE 2L2NA 4F9AB 4L5NC 2V85A 1DI2A 3DF6A 1IBLE 1SR9A 5AE2A 4DV4E 5LMNE 1J26A 4GEQB 4M2ZA 3J81C 1UILA 1T4NA 5T6JA 2UXBE 4WSPA 2L3CA 3LLHA 2VF1A 1EKZA 2FGGA 2JWOA 5IWAE 4KHPE 2DIXA 3F6HA 1XNQE 2UXDE 2G7HA 1XNRE 2M1SA 4JI8E 4BC7A 4B3ME 4X8WA 5AE3A 4BMJA 1HNZE 2FTXB 2DSYA 2F8BA 2M4IA 3AV0A 3HPSA 3JAMC 4DR7E 1XMOE 2F4VE 4B3SE 2UUAE 4JI3E 4DMIA 3T1YE 4J8ZA 2E1MA 2RSMA 2L92A 2RS7A 4L8NA 2L8TA 3C4BA 4WFTA 4YY3E 2VQEE 2CPNA 4TUIA 4NXME 2LTRA 3J7Yp 2L6MA 3J7AG 4Q28A 2V88A 1IBME 4LFAE 4LF4E 1X48A 2MDRA 4DV1E 1YZ9A 4DR5E 1GQEA 4DV5E 3OTOE 2LBSB 2L3JA 2V87A 3HXLA 4B3RE 3H09A 1XMQE 3AUZA 2KOUA 4M0VA 4R03A 3J80C 4X65E 2L2KB 2LMZA 2ODRD 2LTSA 4F9CB 5FLXC 3RMPA 3K6QA 1FJGE 2JY9A 1GZ6A 2VQFE 4DR1E 2UU9E 4LFBE 4BBYA 2NUGA 2V89A 5DNYA 3F6GA 3MSWA 2B7VA 1O0WA 4OOGC 3VYYA 4DR6E 5A2QC 2NA2A 2ODRC 4JYAE 2B3TB 4LF6E 1UHZA 4LFCE 3ADJA 1ZBQA 3IWCA 3IWDA 4AQYE 2NUFA 4DR4E 4LTYA 4K0KE 4F54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V83 A;  2V87 A;  2V85 A;  2V88 A;  2V89 A;  2JWO A;  2V86 A; 
#chains in the Genus database with same CATH topology
 2MC6 A;  1N36 E;  1HNX E;  1T4L B;  1KJK A;  2EPX A;  4R8O A;  1WJP A;  1N3G A;  2MKN A;  2EPR A;  2V86 A;  1RMD A;  2B7T A;  2WBS A;  1PDA A;  2DB2 A;  2R1F A;  5A6J A;  2EM0 A;  2YRM A;  5KL3 A;  4B3T E;  1TF3 A;  4LF9 E;  1UN6 B;  1T38 A;  4WYQ B;  2WZO A;  2EMK A;  2EJ4 A;  2HGH A;  2LJH A;  5AE1 A;  2FV4 B;  2LJU A;  2I9I A;  2EN8 A;  1J5E E;  1X6F A;  2EPP A;  2EPU A;  1QU6 A;  3IWB A;  3JTZ A;  1FKA E;  2IHR 1;  4LU9 A;  1KYQ A;  2MC5 A;  1A1I A;  1ZU1 A;  4TUG A;  1DQ3 A;  2LCE A;  3EPK A;  4DV0 E;  1B69 A;  1PKP A;  1IQO A;  4R2S A;  2J7J A;  3THN A;  2EOY A;  5AAS A;  4NXN E;  4GKK E;  4JI0 E;  1UBD C;  2N8X A;  2EOQ A;  4BCA A;  2GHF A;  2H36 X;  4DV2 E;  2RTX A;  3HQ1 A;  3JU0 A;  3ZOQ B;  4GKJ E;  4DKK A;  2EOE A;  4RH8 A;  4L5N C;  1DI2 A;  3DF6 A;  5AE2 A;  2R76 A;  4Q35 B;  2MKD A;  2EOI A;  4WSP A;  2EM5 A;  2L3C A;  3KZZ A;  2YTQ A;  2RPC A;  3F6H A;  1XNQ E;  1NCS A;  2UXD E;  4O43 A;  4X9J A;  2M1S A;  1YUI A;  1GTK A;  3M99 B;  4ZYE A;  4IS1 C;  3AV0 A;  2D9H A;  2F4V E;  2LT7 A;  3C6K A;  4JI3 E;  3T1Y E;  4J8Z A;  1RC7 A;  2L92 A;  2EQ0 A;  4L8N A;  2L8T A;  2GPI A;  4TUI A;  2BBG A;  3MHS C;  1X48 A;  2MDR A;  3OTO E;  2V87 A;  2EPL X;  3HXL A;  3AUZ A;  2KOU A;  4R03 A;  3BID A;  5TSE A;  4F9C B;  1GZ6 A;  2LVH A;  4DR1 E;  2UU9 E;  2NUG A;  1MGT A;  2V89 A;  5A6A A;  2YPN A;  5DNY A;  2EM9 A;  2EOZ A;  1O0W A;  5A2Q C;  2LV2 A;  1UHZ A;  1ZBQ A;  4WX9 A;  3IWD A;  2EN4 A;  4LTY A;  2EOM A;  1L4S A;  1JK1 A;  2EN1 A;  1T39 A;  1IMU A;  3EQ1 A;  2KON A;  3EPH A;  3MHH C;  3L00 A;  2V8Q B;  2ADR A;  5KL5 A;  4KZS A;  4LF7 E;  2EPO A;  4JI2 E;  2N3G A;  4FK5 C;  1EH7 A;  3QG5 C;  4O24 A;  2DMI A;  1RQ0 A;  1PJT A;  5LL6 R;  2M7Q A;  1T4O A;  3T1H E;  4BHB A;  2EPK X;  1A1L A;  3BF2 A;  4OX9 E;  2ENA A;  5A69 A;  2EPZ A;  2EWL A;  4R2D A;  5LLQ A;  4DR2 E;  2HC5 A;  2JR1 A;  3HTX A;  4JI6 E;  2V83 A;  3ADL A;  4BC9 A;  1N32 E;  2UUB E;  2B9D A;  3ADG A;  4I8O A;  2EOF A;  3KWR A;  4IJD A;  4ZYG A;  1YSA C;  3LML A;  5A6B D;  4M30 A;  5AC5 A;  2LRS A;  2HHH E;  1DGC A;  4MLV A;  5ADZ A;  2LUQ A;  5KL7 A;  5IT9 C;  4WPY A;  2YTI A;  1STU A;  5CFF E;  4DR3 E;  1G2D C;  2DGC A;  1ZR9 A;  2EMW A;  2K4V A;  4DV6 E;  2WBT A;  2EPA A;  3VYX A;  2JOB A;  5IXM B;  2DLK A;  2EMI A;  2V85 A;  5KL2 A;  1J26 A;  2EOX A;  5T6J A;  5KL4 A;  1A1G A;  3LLH A;  2VF1 A;  2JWO A;  2G7H A;  1PJS A;  1HNZ E;  1TF6 A;  1QNT A;  2WCC 3;  2UUA E;  2RS7 A;  2RSM A;  2JPA A;  2YRH A;  2CPN A;  2ENH A;  3J7A G;  2V88 A;  4LFA E;  3TQM A;  3THO B;  1GQE A;  2EN7 A;  4ZYH A;  2RSI A;  3H09 A;  4M0V A;  2LMZ A;  2YTJ A;  5FLX C;  3RMP A;  3K6Q A;  4LFB E;  4BBY A;  4R2P A;  2YTF A;  2EM6 A;  4OOG C;  2B7V A;  4DR6 E;  2NA2 A;  2B3T B;  2EOJ A;  4LF6 E;  4HTG A;  4LFC E;  4AQY E;  2DRP A;  4RHB B;  1EH6 A;  1EH8 A;  2EPM X;  4F54 A;  3C6M A;  2JXP A;  1X49 A;  2EMZ A;  4YHH E;  1LLM C;  4LF5 E;  1X3C A;  4O5G A;  2DMY A;  2N3H A;  2EMF A;  4X64 E;  2ELY A;  4DV7 E;  2JP9 A;  4R2R A;  1WHQ A;  3EPJ A;  1X47 A;  4N4R B;  4NHR A;  2YRK A;  4LF8 E;  4DV3 E;  4HEI A;  2EOH A;  1IBK E;  4JV5 E;  1YYW A;  1HR0 E;  2EQ1 A;  2RQL A;  1X6E A;  4JI7 E;  1ZBT A;  2EPC A;  2A25 A;  2CT1 A;  2YTE A;  2YTO A;  3HPZ A;  1HNW E;  2K7I A;  3OML A;  3C4T A;  1N33 E;  2E72 A;  2ZM6 E;  2DLQ A;  4P78 A;  2LUP B;  2EOO A;  2EL6 A;  3VHT B;  2JVA A;  1AH5 A;  4MLQ A;  1P47 A;  4F9B B;  2UUC E;  2EN6 A;  4DUY E;  1WHN A;  4JI4 E;  2RS6 A;  2EMY A;  2LE2 A;  5LMU E;  2L2N A;  1YUJ A;  2EL5 A;  1IBL E;  1SR9 A;  4DV4 E;  4M2Z A;  1F2I G;  2LO3 A;  3EPL A;  2M9A A;  2EOR A;  5IWA E;  2NAB A;  5A6K A;  1XNR E;  4BC7 A;  4X8W A;  5AE3 A;  1A1F A;  4BMJ A;  2FTX B;  2DSY A;  2EL4 A;  2M4I A;  4R2C A;  4DR7 E;  1X5W A;  1A1J A;  4WFT A;  2LTR A;  3KZY A;  3J7Y p;  3BBG A;  2EMX A;  1PJQ A;  4DV1 E;  2ELZ A;  4DR5 E;  4DV5 E;  2LBS B;  1IQS A;  2YTD A;  4KWY A;  2L3J A;  4B3R E;  5KL6 A;  4X65 E;  1FJG E;  2JY9 A;  4R2A A;  2VQF E;  2EQ3 A;  3MSW A;  3VYY A;  2YU5 A;  1A1H A;  2EM4 A;  1ZAA C;  2HJJ A;  2CTD A;  4K0K E;  2YTP A;  2YWQ A;  4R2E A;  2VE7 C;  4JI1 E;  2UXC E;  4BHC A;  4X66 E;  2L2M A;  2YT4 A;  1YFH A;  1I94 E;  2WBU A;  2EM3 A;  2L33 A;  4GZN C;  3FIG A;  1MEY C;  5F3W A;  3UK3 C;  5A6B A;  2ENC A;  1TN9 A;  1WXR A;  4JI5 E;  2NUE A;  1BB8 A;  4DUZ E;  2EMH A;  1YYK A;  5IV8 B;  2Q8U A;  2EP3 A;  2YTN A;  4NZV A;  3DJW A;  4BS9 A;  5BR8 E;  2EM8 A;  2JOX A;  2E5L E;  2EM7 A;  2EMB A;  4WSG A;  2EZ6 A;  4F2J C;  1YYO A;  4X62 E;  1N34 E;  3VK6 A;  4R2Q A;  3P1X A;  4O4K A;  4ZYD A;  4KHP E;  2EN2 A;  4P7D A;  4WXC A;  2YZT A;  2KHX A;  3ADI A;  5AC4 A;  4F9A B;  2PRT A;  4F6N A;  2EN3 A;  1A1K A;  5LMN E;  4F6M A;  4GEQ B;  1G2F C;  3ECR A;  2EMC A;  3J81 C;  1UIL A;  1T4N A;  2UXB E;  2YU8 A;  1BBO A;  1EKZ A;  2FGG A;  1X6H A;  1NEI A;  2EE8 A;  2CSH A;  2DIX A;  2I13 A;  2EOS A;  4JI8 E;  2MDG A;  4B3M E;  2EM2 A;  1SFE A;  2YSP A;  2F8B A;  3JAM C;  3HPS A;  1XMO E;  4B3S E;  4DMI A;  2JYA A;  2E1M A;  2VQE E;  4YY3 E;  3C4B A;  1BBG A;  2YTG A;  3BGH A;  4NXM E;  2BB8 A;  2L6M A;  4Q28 A;  1IBM E;  1YPN A;  4LF4 E;  2GLI A;  1YZ9 A;  4WXD A;  1XMQ E;  3J80 C;  2YSO A;  2EMG A;  2L2K B;  2ODR D;  2LTS A;  2EMA A;  4M9V C;  2VRD A;  1JK2 A;  2EML A;  1Z1B A;  3F6G A;  4JYA E;  2ODR C;  1AAY A;  1WRJ A;  3ADJ A;  2EPN A;  3IWC A;  2NUF A;  4DR4 E; 
#chains in the Genus database with same CATH homology
 1X49 A;  2KON A;  4YHH E;  2MC6 A;  1N36 E;  2V8Q B;  4LF5 E;  2VE7 C;  4JI1 E;  1HNX E;  4KZS A;  1T4L B;  4LF7 E;  4X66 E;  2L2M A;  2UXC E;  2YT4 A;  4R8O A;  2DMY A;  1I94 E;  2N3H A;  4JI2 E;  2L33 A;  2N3G A;  4X64 E;  4DV7 E;  3FIG A;  5F3W A;  2V86 A;  2B7T A;  2DB2 A;  1WHQ A;  4B3T E;  1RQ0 A;  1X47 A;  1WXR A;  5LL6 R;  2M7Q A;  4JI5 E;  1T4O A;  4LF9 E;  3T1H E;  2NUE A;  4WYQ B;  4LF8 E;  2WZO A;  4DV3 E;  2EZ6 A;  4DUZ E;  1YYK A;  1IBK E;  4JV5 E;  1YYW A;  1HR0 E;  1RC7 A;  2LJH A;  5AE1 A;  4OX9 E;  4JI7 E;  2FV4 B;  1ZBT A;  3DJW A;  3HPZ A;  1J5E E;  2EWL A;  4BS9 A;  1HNW E;  4DR2 E;  1QU6 A;  3OML A;  5BR8 E;  3IWB A;  3JTZ A;  2JR1 A;  3C4T A;  1FKA E;  2JOX A;  3HTX A;  2E5L E;  1N33 E;  2IHR 1;  4JI6 E;  2ZM6 E;  2V83 A;  3ADL A;  4LU9 A;  4BC9 A;  1N32 E;  2MC5 A;  2B9D A;  4P78 A;  2LUP B;  3ADG A;  4I8O A;  4TUG A;  1DQ3 A;  3KWR A;  2UUB E;  4DV0 E;  3LML A;  1YYO A;  1PKP A;  4X62 E;  1N34 E;  2JVA A;  4M30 A;  3VK6 A;  2LRS A;  2HHH E;  3P1X A;  4F9B B;  5AAS A;  2UUC E;  4NXN E;  4GKK E;  4JI0 E;  4DUY E;  1WHN A;  5ADZ A;  2LUQ A;  4BCA A;  2RS6 A;  5IT9 C;  4WPY A;  4JI4 E;  1STU A;  4P7D A;  2YZT A;  5CFF E;  4DR3 E;  2H36 X;  4DV2 E;  2KHX A;  2K4V A;  2RTX A;  2LE2 A;  3HQ1 A;  3JU0 A;  3ZOQ B;  5LMU E;  4DV6 E;  4DKK A;  3ADI A;  3VYX A;  2JOB A;  4GKJ E;  2L2N A;  4F9A B;  4L5N C;  2V85 A;  1DI2 A;  3DF6 A;  1IBL E;  1SR9 A;  5AE2 A;  4DV4 E;  5LMN E;  1J26 A;  4GEQ B;  4M2Z A;  3J81 C;  1UIL A;  1T4N A;  5T6J A;  2UXB E;  4WSP A;  2L3C A;  3LLH A;  2VF1 A;  1EKZ A;  2FGG A;  2JWO A;  5IWA E;  4KHP E;  2DIX A;  3F6H A;  1XNQ E;  2UXD E;  2G7H A;  1XNR E;  2M1S A;  4JI8 E;  4BC7 A;  4B3M E;  4X8W A;  5AE3 A;  4BMJ A;  1HNZ E;  2FTX B;  2DSY A;  2F8B A;  2M4I A;  3AV0 A;  3HPS A;  3JAM C;  4DR7 E;  1XMO E;  2F4V E;  4B3S E;  2UUA E;  4JI3 E;  4DMI A;  3T1Y E;  4J8Z A;  2E1M A;  2RSM A;  2L92 A;  2RS7 A;  4L8N A;  2L8T A;  3C4B A;  4WFT A;  4YY3 E;  2VQE E;  2CPN A;  4TUI A;  4NXM E;  2LTR A;  3J7Y p;  2L6M A;  3J7A G;  4Q28 A;  2V88 A;  1IBM E;  4LFA E;  4LF4 E;  1X48 A;  2MDR A;  4DV1 E;  1YZ9 A;  4DR5 E;  1GQE A;  4DV5 E;  3OTO E;  2LBS B;  2L3J A;  2V87 A;  3HXL A;  4B3R E;  3H09 A;  1XMQ E;  3AUZ A;  2KOU A;  4M0V A;  4R03 A;  3J80 C;  4X65 E;  2L2K B;  2LMZ A;  2ODR D;  2LTS A;  4F9C B;  5FLX C;  3RMP A;  3K6Q A;  1FJG E;  2JY9 A;  1GZ6 A;  2VQF E;  4DR1 E;  2UU9 E;  4LFB E;  4BBY A;  2NUG A;  2V89 A;  5DNY A;  3F6G A;  3MSW A;  2B7V A;  1O0W A;  4OOG C;  3VYY A;  4DR6 E;  5A2Q C;  2NA2 A;  2ODR C;  4JYA E;  2B3T B;  4LF6 E;  1UHZ A;  4LFC E;  3ADJ A;  1ZBQ A;  3IWC A;  3IWD A;  4AQY E;  2NUF A;  4DR4 E;  4LTY A;  4K0K E;  4F54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...