2V89A

Crystal structure of rag2-phd finger in complex with h3k4me3 peptide at 1.1a resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
78
structure length
78
Chain Sequence
SPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQIARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Rag2 Phd Finger Couples Histone H3 Lysine 4 Trimethylation with V(D)J Recombination.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords VDJ RECOMBINATION-ACTIVATING PROTEIN 2
total genus 13
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.290 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2v89A01
2V83A 2V88A 2V85A 2V87A 2V89A 2JWOA 2V86A
chains in the Genus database with same CATH superfamily
1YSAC 2WBUA 1BB8A 5KL3A 2ENAA 3IWDA 1PJTA 2RS6A 2NA2A 1PJSA 1UILA 5KL2A 1TF3A 4R03A 4BBYA 1MEYC 4X65E 2R76A 4N4RB 4OOGC 5IWAE 1FJGE 1AH5A 2JP9A 3DJWA 4X8WA 2MDGA 4JI0E 1EKZA 4BMJA 4HTGA 2MC5A 4JYAE 2EMAA 2NUFA 2EPAA 2D9HA 2GPIA 2B9DA 4I8OA 4B3RE 4MLVA 5AE1A 1P47A 2EOQA 4JI4E 2EMKA 2V89A 2YTEA 2KOUA 2L92A 2F8BA 1EH8A 3VYYA 4DV1E 4R2SA 2CSHA 3MHSC 2YTDA 2EM8A 3LLHA 1N3GA 4F54A 1AAYA 2K7IA 4JV5E 2BB8A 1QNTA 5LMUE 3P1XA 3C6MA 2L2MA 2EN1A 2DMIA 2M4IA 4R2RA 2LE2A 3EPHA 1KJKA 1SR9A 1YYWA 3J80C 4M2ZA 1ZBQA 2K4VA 2GHFA 4WXDA 1J26A 2DLQA 2YTNA 4DR5E 2EM6A 4DV3E 3OTOE 2EM0A 4X9JA 5T6JA 3IWBA 2YSPA 4WPYA 1A1LA 2LT7A 2EN4A 2EE8A 3DF6A 4LF4E 5KL5A 1T4OA 5A6BD 3EPJA 2EL4A 2YTOA 4Q28A 4DV5E 3HPSA 1JK1A 5LMNE 2I13A 3BBGA 1QU6A 5AASA 4MLQA 1UHZA 2EN8A 4L5NC 2VQEE 2UUBE 3FIGA 1HNZE 2G7HA 2F4VE 2ELZA 1MGTA 3J7AG 4BC9A 4X62E 4BHCA 2PRTA 2VE7C 1WHNA 2GLIA 1GTKA 4K0KE 2DGCA 1XMOE 2EQ0A 2ENCA 3C6KA 1T4NA 4WFTA 2B3TB 2V87A 2UXBE 1IQSA 2LMZA 3BGHA 4LF5E 3BF2A 2UUAE 2YRKA 2MC6A 3KWRA 1T4LB 4YY3E 2UXCE 4F6NA 4DV2E 2EOFA 2EM3A 2R1FA 4BC7A 1EH6A 3MHHC 1N36E 2EPCA 4NZVA 4LFCE 4M30A 2HJJA 3F6GA 2LUPB 3JU0A 4F9CB 4LFBE 2EN7A 2LBSB 1SFEA 5F3WA 4NXNE 4LTYA 5AC4A 2EMGA 1G2DC 4R2EA 4JI2E 2RPCA 4TUIA 3BIDA 1NEIA 4RH8A 1GZ6A 4BHBA 2EOZA 1YZ9A 3KZYA 5AE2A 3VHTB 4LFAE 4NHRA 4WYQB 4R2CA 4O4KA 4JI5E 1YFHA 2EM5A 2JR1A 3ADIA 2EPOA 5BR8E 2EMHA 1IBLE 2EOXA 2I9IA 3EPLA 2N8XA 2EOSA 2EPXA 1YUJA 2LJHA 2LCEA 2JWOA 4BS9A 2HHHE 2EOOA 2M7QA 5A2QC 2YU5A 1ZBTA 4JI1E 1NCSA 2YTGA 2V8QB 4KHPE 3KZZA 2HC5A 3L00A 3RMPA 1RC7A 1STUA 2WBTA 2EPRA 3T1YE 2ELYA 1ZAAC 2LTRA 2M1SA 3ZOQB 4ZYHA 2YU8A 4JI3E 3C4TA 2HGHA 4DR4E 2UU9E 4GEQB 4DR6E 2UXDE 4DMIA 2FV4B 4DUYE 5IT9C 4F9AB 1F2IG 4GZNC 2MKDA 2DLKA 4IS1C 2YZTA 4DKKA 2RS7A 4HEIA 5AE3A 4DR2E 1HR0E 3QG5C 3LMLA 4F2JC 5KL7A 2J7JA 4F9BB 2DIXA 2H36X 4M9VC 3EQ1A 2M9AA 2EZ6A 2B7TA 2EMZA 2JY9A 4R2AA 1RQ0A 2EMCA 2EN6A 2E5LE 2DB2A 5IV8B 4WSPA 5LLQA 2JPAA 2EPKX 3IWCA 2N3GA 2WZOA 3THNA 3JTZA 5A69A 4O5GA 2L3CA 1ZU1A 3ADGA 4AQYE 2EPMX 2UUCE 4O43A 1A1HA 3AUZA 2ADRA 5CFFE 4O24A 4DV7E 2E1MA 2ENHA 1DI2A 3HPZA 3HTXA 2IHR1 1O0WA 4DR1E 2LVHA 1BBOA 1YUIA 2VF1A 4LF7E 3HQ1A 4FK5C 5A6BA 1BBGA 2FTXB 2YTPA 2EOMA 2VRDA 3OMLA 1IBKE 2YTJA 4X66E 5DNYA 2EJ4A 2EMBA 4J8ZA 1WRJA 1WHQA 2EMWA 4P7DA 3THOB 2YRHA 4Q35B 4R2DA 1TN9A 2LV2A 2LO3A 2JOXA 1XNRE 2YT4A 2DSYA 4LU9A 2EM4A 4ZYGA 4R2QA 5FLXC 1A1FA 4WX9A 1FKAE 2NUEA 5LL6R 3K6QA 2RSIA 3VYXA 4OX9E 3EPKA 2ODRC 2JOBA 2RTXA 4R2PA 1N34E 2EWLA 1YYOA 1X49A 3AV0A 2ZM6E 3JAMC 3MSWA 3F6HA 1EH7A 4DR3E 2L8TA 1X6EA 1X5WA 1N33E 2EQ1A 1UBDC 1UN6B 3M99B 1X48A 1PJQA 4ZYDA 2RSMA 2ODRD 1DGCA 3J81C 2L2NA 2L6MA 1HNWE 1RMDA 5KL4A 4JI7E 2LRSA 4WXCA 2N3HA 3ADLA 4P78A 2A25A 5AC5A 2CPNA 5ADZA 4IJDA 4DUZE 1XNQE 1IQOA 1G2FC 2EPNA 2JVAA 3TQMA 3HXLA 5IXMB 2EM9A 2YWQA 2VQFE 2RQLA 1T39A 2EMXA 2BBGA 2YTFA 1JK2A 2EMYA 4YHHE 2LUQA 1I94E 1J5EE 2EN2A 1WJPA 2NABA 3J7Yp 1WXRA 3H09A 4X64E 2EOYA 2L33A 3VK6A 4B3SE 2WCC3 4BCAA 4DV0E 4F6MA 2YRMA 2LTSA 2EPLX 1X3CA 4NXME 2EL6A 1X6FA 2EOHA 2WBSA 4LF8E 2CT1A 1DQ3A 2EMFA 2L2KB 1IBME 2EQ3A 2FGGA 2Q8UA 2EPPA 2EOEA 2EL5A 1LLMC 1Z1BA 2EPZA 3UK3C 1X47A 2MDRA 2EOJA 4LF6E 1N32E 2DMYA 2EPUA 2V88A 1L4SA 4R8OA 1A1KA 1GQEA 5A6JA 2YTIA 2EORA 1XMQE 1X6HA 1TF6A 5A6AA 1IMUA 4WSGA 2V86A 1A1GA 3C4BA 4DR7E 4M0VA 2NUGA 2E72A 4RHBB 4DV6E 1B69A 2EN3A 4GKKE 1PKPA 2LJUA 4L8NA 3T1HE 2KHXA 2EOIA 4ZYEA 4LF9E 2JXPA 4DV4E 2EMIA 1HNXE 2V83A 2JYAA 2CTDA 2MKNA 1ZR9A 2YSOA 5KL6A 2EP3A 2EM2A 4TUGA 1T38A 2L3JA 4B3TE 4KWYA 4KZSA 1A1IA 2EM7A 5A6KA 3ADJA 4JI6E 3ECRA 1YYKA 2YTQA 4JI8E 4GKJE 2KONA 2YPNA 1A1JA 2EMLA 2DRPA 2V85A 1KYQA 4B3ME 1PDAA 1YPNA 2B7VA 5TSEA
chains in the Genus database with same CATH topology
1T4NA 4WFTA 4DUZE 4GKKE 2YZTA 1XNQE 4DKKA 2RS7A 5AE3A 4DR2E 2B3TB 2V87A 2UXBE 1HR0E 2JVAA 3HXLA 3IWDA 2RS6A 3LMLA 2NA2A 2LMZA 4LF5E 1UILA 4F9BB 2UUAE 2VQFE 4R03A 1T4LB 2MC6A 2DIXA 2H36X 3KWRA 4BBYA 4YY3E 2UXCE 4X65E 4OOGC 4DV2E 5IWAE 2EZ6A 2B7TA 1FJGE 4YHHE 2JY9A 2LUQA 1I94E 1RQ0A 3DJWA 4X8WA 1J5EE 4JI0E 1EKZA 2E5LE 2DB2A 4WSPA 4BMJA 4BC7A 2MC5A 3J7Yp 1WXRA 1N36E 4JYAE 3H09A 4X64E 2NUFA 4LFCE 4M30A 2L33A 3F6GA 2LUPB 3IWCA 3JU0A 4F9CB 2N3GA 2B9DA 2WZOA 4I8OA 3JTZA 4B3RE 4LFBE 2LBSB 5F3WA 3VK6A 4NXNE 2L3CA 4LTYA 4B3SE 5AE1A 3ADGA 4BCAA 4DV0E 4AQYE 2UUCE 2LTSA 4JI4E 3AUZA 4JI2E 4NXME 5CFFE 4DV7E 2V89A 4LF8E 4TUIA 2KOUA 2E1MA 1DI2A 2L92A 2F8BA 3HPZA 1DQ3A 3VYYA 1GZ6A 3HTXA 2L2KB 2IHR1 1IBME 1O0WA 1YZ9A 4DV1E 4DR1E 5AE2A 4KHPE 4LFAE 4WYQB 2FGGA 4JI5E 3LLHA 2VF1A 4LF7E 3HQ1A 4F54A 2JR1A 1X47A 2FTXB 2MDRA 4LF6E 1N32E 3ADIA 4JV5E 2DMYA 2V88A 3OMLA 5BR8E 1IBKE 1IBLE 4R8OA 5LMUE 1GQEA 4X66E 3P1XA 5DNYA 4J8ZA 1XMQE 1WHQA 2L2MA 4P7DA 2LJHA 2M4IA 2LE2A 2JOXA 1XNRE 1SR9A 1YYWA 2JWOA 2YT4A 2DSYA 1ZBQA 4LU9A 4BS9A 3J80C 2K4VA 5FLXC 2HHHE 4M2ZA 4DR5E 1J26A 2V86A 3C4BA 4DR7E 1FKAE 2NUEA 4M0VA 2NUGA 5LL6R 3K6QA 2M7QA 4DV3E 4DV6E 5A2QC 4OX9E 3VYXA 1ZBTA 2ODRC 2JOBA 2RTXA 3OTOE 1N34E 4JI1E 2EWLA 1PKPA 5T6JA 1YYOA 1X49A 2V8QB 3AV0A 3IWBA 4L8NA 2ZM6E 3T1HE 4WPYA 2KHXA 3JAMC 3MSWA 4LF9E 4DV4E 3F6HA 4DR3E 3DF6A 2L8TA 3RMPA 4LF4E 1N33E 1HNXE 1RC7A 2V83A 1STUA 1T4OA 1X48A 3T1YE 2LTRA 2M1SA 4Q28A 4DV5E 3HPSA 2RSMA 5LMNE 2ODRD 1QU6A 3ZOQB 5AASA 4TUGA 2L3JA 4B3TE 3J81C 1UHZA 4KZSA 4L5NC 2VQEE 2UUBE 2L2NA 3FIGA 1HNZE 4JI3E 3C4TA 2G7HA 3ADJA 2F4VE 4JI6E 2L6MA 4DR4E 1HNWE 3J7AG 4GKJE 4BC9A 4JI8E 4X62E 2UU9E 1YYKA 2KONA 4GEQB 4DR6E 2UXDE 2VE7C 1WHNA 4DMIA 2FV4B 4DUYE 4JI7E 4B3ME 2V85A 2LRSA 4K0KE 1XMOE 2N3HA 5IT9C 4F9AB 3ADLA 4P78A 2B7VA 2CPNA 5ADZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V83 A;  2V88 A;  2V85 A;  2V87 A;  2V89 A;  2JWO A;  2V86 A; 
#chains in the Genus database with same CATH topology
 1YSA C;  2WBU A;  1BB8 A;  5KL3 A;  2ENA A;  3IWD A;  1PJT A;  2RS6 A;  2NA2 A;  1PJS A;  1UIL A;  5KL2 A;  1TF3 A;  4R03 A;  4BBY A;  1MEY C;  4X65 E;  2R76 A;  4N4R B;  4OOG C;  5IWA E;  1FJG E;  1AH5 A;  2JP9 A;  3DJW A;  4X8W A;  2MDG A;  4JI0 E;  1EKZ A;  4BMJ A;  4HTG A;  2MC5 A;  4JYA E;  2EMA A;  2NUF A;  2EPA A;  2D9H A;  2GPI A;  2B9D A;  4I8O A;  4B3R E;  4MLV A;  5AE1 A;  1P47 A;  2EOQ A;  4JI4 E;  2EMK A;  2V89 A;  2YTE A;  2KOU A;  2L92 A;  2F8B A;  1EH8 A;  3VYY A;  4DV1 E;  4R2S A;  2CSH A;  3MHS C;  2YTD A;  2EM8 A;  3LLH A;  1N3G A;  4F54 A;  1AAY A;  2K7I A;  4JV5 E;  2BB8 A;  1QNT A;  5LMU E;  3P1X A;  3C6M A;  2L2M A;  2EN1 A;  2DMI A;  2M4I A;  4R2R A;  2LE2 A;  3EPH A;  1KJK A;  1SR9 A;  1YYW A;  3J80 C;  4M2Z A;  1ZBQ A;  2K4V A;  2GHF A;  4WXD A;  1J26 A;  2DLQ A;  2YTN A;  4DR5 E;  2EM6 A;  4DV3 E;  3OTO E;  2EM0 A;  4X9J A;  5T6J A;  3IWB A;  2YSP A;  4WPY A;  1A1L A;  2LT7 A;  2EN4 A;  2EE8 A;  3DF6 A;  4LF4 E;  5KL5 A;  1T4O A;  5A6B D;  3EPJ A;  2EL4 A;  2YTO A;  4Q28 A;  4DV5 E;  3HPS A;  1JK1 A;  5LMN E;  2I13 A;  3BBG A;  1QU6 A;  5AAS A;  4MLQ A;  1UHZ A;  2EN8 A;  4L5N C;  2VQE E;  2UUB E;  3FIG A;  1HNZ E;  2G7H A;  2F4V E;  2ELZ A;  1MGT A;  3J7A G;  4BC9 A;  4X62 E;  4BHC A;  2PRT A;  2VE7 C;  1WHN A;  2GLI A;  1GTK A;  4K0K E;  2DGC A;  1XMO E;  2EQ0 A;  2ENC A;  3C6K A;  1T4N A;  4WFT A;  2B3T B;  2V87 A;  2UXB E;  1IQS A;  2LMZ A;  3BGH A;  4LF5 E;  3BF2 A;  2UUA E;  2YRK A;  2MC6 A;  3KWR A;  1T4L B;  4YY3 E;  2UXC E;  4F6N A;  4DV2 E;  2EOF A;  2EM3 A;  2R1F A;  4BC7 A;  1EH6 A;  3MHH C;  1N36 E;  2EPC A;  4NZV A;  4LFC E;  4M30 A;  2HJJ A;  3F6G A;  2LUP B;  3JU0 A;  4F9C B;  4LFB E;  2EN7 A;  2LBS B;  1SFE A;  5F3W A;  4NXN E;  4LTY A;  5AC4 A;  2EMG A;  1G2D C;  4R2E A;  4JI2 E;  2RPC A;  4TUI A;  3BID A;  1NEI A;  4RH8 A;  1GZ6 A;  4BHB A;  2EOZ A;  1YZ9 A;  3KZY A;  5AE2 A;  3VHT B;  4LFA E;  4NHR A;  4WYQ B;  4R2C A;  4O4K A;  4JI5 E;  1YFH A;  2EM5 A;  2JR1 A;  3ADI A;  2EPO A;  5BR8 E;  2EMH A;  1IBL E;  2EOX A;  2I9I A;  3EPL A;  2N8X A;  2EOS A;  2EPX A;  1YUJ A;  2LJH A;  2LCE A;  2JWO A;  4BS9 A;  2HHH E;  2EOO A;  2M7Q A;  5A2Q C;  2YU5 A;  1ZBT A;  4JI1 E;  1NCS A;  2YTG A;  2V8Q B;  4KHP E;  3KZZ A;  2HC5 A;  3L00 A;  3RMP A;  1RC7 A;  1STU A;  2WBT A;  2EPR A;  3T1Y E;  2ELY A;  1ZAA C;  2LTR A;  2M1S A;  3ZOQ B;  4ZYH A;  2YU8 A;  4JI3 E;  3C4T A;  2HGH A;  4DR4 E;  2UU9 E;  4GEQ B;  4DR6 E;  2UXD E;  4DMI A;  2FV4 B;  4DUY E;  5IT9 C;  4F9A B;  1F2I G;  4GZN C;  2MKD A;  2DLK A;  4IS1 C;  2YZT A;  4DKK A;  2RS7 A;  4HEI A;  5AE3 A;  4DR2 E;  1HR0 E;  3QG5 C;  3LML A;  4F2J C;  5KL7 A;  2J7J A;  4F9B B;  2DIX A;  2H36 X;  4M9V C;  3EQ1 A;  2M9A A;  2EZ6 A;  2B7T A;  2EMZ A;  2JY9 A;  4R2A A;  1RQ0 A;  2EMC A;  2EN6 A;  2E5L E;  2DB2 A;  5IV8 B;  4WSP A;  5LLQ A;  2JPA A;  2EPK X;  3IWC A;  2N3G A;  2WZO A;  3THN A;  3JTZ A;  5A69 A;  4O5G A;  2L3C A;  1ZU1 A;  3ADG A;  4AQY E;  2EPM X;  2UUC E;  4O43 A;  1A1H A;  3AUZ A;  2ADR A;  5CFF E;  4O24 A;  4DV7 E;  2E1M A;  2ENH A;  1DI2 A;  3HPZ A;  3HTX A;  2IHR 1;  1O0W A;  4DR1 E;  2LVH A;  1BBO A;  1YUI A;  2VF1 A;  4LF7 E;  3HQ1 A;  4FK5 C;  5A6B A;  1BBG A;  2FTX B;  2YTP A;  2EOM A;  2VRD A;  3OML A;  1IBK E;  2YTJ A;  4X66 E;  5DNY A;  2EJ4 A;  2EMB A;  4J8Z A;  1WRJ A;  1WHQ A;  2EMW A;  4P7D A;  3THO B;  2YRH A;  4Q35 B;  4R2D A;  1TN9 A;  2LV2 A;  2LO3 A;  2JOX A;  1XNR E;  2YT4 A;  2DSY A;  4LU9 A;  2EM4 A;  4ZYG A;  4R2Q A;  5FLX C;  1A1F A;  4WX9 A;  1FKA E;  2NUE A;  5LL6 R;  3K6Q A;  2RSI A;  3VYX A;  4OX9 E;  3EPK A;  2ODR C;  2JOB A;  2RTX A;  4R2P A;  1N34 E;  2EWL A;  1YYO A;  1X49 A;  3AV0 A;  2ZM6 E;  3JAM C;  3MSW A;  3F6H A;  1EH7 A;  4DR3 E;  2L8T A;  1X6E A;  1X5W A;  1N33 E;  2EQ1 A;  1UBD C;  1UN6 B;  3M99 B;  1X48 A;  1PJQ A;  4ZYD A;  2RSM A;  2ODR D;  1DGC A;  3J81 C;  2L2N A;  2L6M A;  1HNW E;  1RMD A;  5KL4 A;  4JI7 E;  2LRS A;  4WXC A;  2N3H A;  3ADL A;  4P78 A;  2A25 A;  5AC5 A;  2CPN A;  5ADZ A;  4IJD A;  4DUZ E;  1XNQ E;  1IQO A;  1G2F C;  2EPN A;  2JVA A;  3TQM A;  3HXL A;  5IXM B;  2EM9 A;  2YWQ A;  2VQF E;  2RQL A;  1T39 A;  2EMX A;  2BBG A;  2YTF A;  1JK2 A;  2EMY A;  4YHH E;  2LUQ A;  1I94 E;  1J5E E;  2EN2 A;  1WJP A;  2NAB A;  3J7Y p;  1WXR A;  3H09 A;  4X64 E;  2EOY A;  2L33 A;  3VK6 A;  4B3S E;  2WCC 3;  4BCA A;  4DV0 E;  4F6M A;  2YRM A;  2LTS A;  2EPL X;  1X3C A;  4NXM E;  2EL6 A;  1X6F A;  2EOH A;  2WBS A;  4LF8 E;  2CT1 A;  1DQ3 A;  2EMF A;  2L2K B;  1IBM E;  2EQ3 A;  2FGG A;  2Q8U A;  2EPP A;  2EOE A;  2EL5 A;  1LLM C;  1Z1B A;  2EPZ A;  3UK3 C;  1X47 A;  2MDR A;  2EOJ A;  4LF6 E;  1N32 E;  2DMY A;  2EPU A;  2V88 A;  1L4S A;  4R8O A;  1A1K A;  1GQE A;  5A6J A;  2YTI A;  2EOR A;  1XMQ E;  1X6H A;  1TF6 A;  5A6A A;  1IMU A;  4WSG A;  2V86 A;  1A1G A;  3C4B A;  4DR7 E;  4M0V A;  2NUG A;  2E72 A;  4RHB B;  4DV6 E;  1B69 A;  2EN3 A;  4GKK E;  1PKP A;  2LJU A;  4L8N A;  3T1H E;  2KHX A;  2EOI A;  4ZYE A;  4LF9 E;  2JXP A;  4DV4 E;  2EMI A;  1HNX E;  2V83 A;  2JYA A;  2CTD A;  2MKN A;  1ZR9 A;  2YSO A;  5KL6 A;  2EP3 A;  2EM2 A;  4TUG A;  1T38 A;  2L3J A;  4B3T E;  4KWY A;  4KZS A;  1A1I A;  2EM7 A;  5A6K A;  3ADJ A;  4JI6 E;  3ECR A;  1YYK A;  2YTQ A;  4JI8 E;  4GKJ E;  2KON A;  2YPN A;  1A1J A;  2EML A;  2DRP A;  2V85 A;  1KYQ A;  4B3M E;  1PDA A;  1YPN A;  2B7V A;  5TSE A; 
#chains in the Genus database with same CATH homology
 1T4N A;  4WFT A;  4DUZ E;  4GKK E;  2YZT A;  1XNQ E;  4DKK A;  2RS7 A;  5AE3 A;  4DR2 E;  2B3T B;  2V87 A;  2UXB E;  1HR0 E;  2JVA A;  3HXL A;  3IWD A;  2RS6 A;  3LML A;  2NA2 A;  2LMZ A;  4LF5 E;  1UIL A;  4F9B B;  2UUA E;  2VQF E;  4R03 A;  1T4L B;  2MC6 A;  2DIX A;  2H36 X;  3KWR A;  4BBY A;  4YY3 E;  2UXC E;  4X65 E;  4OOG C;  4DV2 E;  5IWA E;  2EZ6 A;  2B7T A;  1FJG E;  4YHH E;  2JY9 A;  2LUQ A;  1I94 E;  1RQ0 A;  3DJW A;  4X8W A;  1J5E E;  4JI0 E;  1EKZ A;  2E5L E;  2DB2 A;  4WSP A;  4BMJ A;  4BC7 A;  2MC5 A;  3J7Y p;  1WXR A;  1N36 E;  4JYA E;  3H09 A;  4X64 E;  2NUF A;  4LFC E;  4M30 A;  2L33 A;  3F6G A;  2LUP B;  3IWC A;  3JU0 A;  4F9C B;  2N3G A;  2B9D A;  2WZO A;  4I8O A;  3JTZ A;  4B3R E;  4LFB E;  2LBS B;  5F3W A;  3VK6 A;  4NXN E;  2L3C A;  4LTY A;  4B3S E;  5AE1 A;  3ADG A;  4BCA A;  4DV0 E;  4AQY E;  2UUC E;  2LTS A;  4JI4 E;  3AUZ A;  4JI2 E;  4NXM E;  5CFF E;  4DV7 E;  2V89 A;  4LF8 E;  4TUI A;  2KOU A;  2E1M A;  1DI2 A;  2L92 A;  2F8B A;  3HPZ A;  1DQ3 A;  3VYY A;  1GZ6 A;  3HTX A;  2L2K B;  2IHR 1;  1IBM E;  1O0W A;  1YZ9 A;  4DV1 E;  4DR1 E;  5AE2 A;  4KHP E;  4LFA E;  4WYQ B;  2FGG A;  4JI5 E;  3LLH A;  2VF1 A;  4LF7 E;  3HQ1 A;  4F54 A;  2JR1 A;  1X47 A;  2FTX B;  2MDR A;  4LF6 E;  1N32 E;  3ADI A;  4JV5 E;  2DMY A;  2V88 A;  3OML A;  5BR8 E;  1IBK E;  1IBL E;  4R8O A;  5LMU E;  1GQE A;  4X66 E;  3P1X A;  5DNY A;  4J8Z A;  1XMQ E;  1WHQ A;  2L2M A;  4P7D A;  2LJH A;  2M4I A;  2LE2 A;  2JOX A;  1XNR E;  1SR9 A;  1YYW A;  2JWO A;  2YT4 A;  2DSY A;  1ZBQ A;  4LU9 A;  4BS9 A;  3J80 C;  2K4V A;  5FLX C;  2HHH E;  4M2Z A;  4DR5 E;  1J26 A;  2V86 A;  3C4B A;  4DR7 E;  1FKA E;  2NUE A;  4M0V A;  2NUG A;  5LL6 R;  3K6Q A;  2M7Q A;  4DV3 E;  4DV6 E;  5A2Q C;  4OX9 E;  3VYX A;  1ZBT A;  2ODR C;  2JOB A;  2RTX A;  3OTO E;  1N34 E;  4JI1 E;  2EWL A;  1PKP A;  5T6J A;  1YYO A;  1X49 A;  2V8Q B;  3AV0 A;  3IWB A;  4L8N A;  2ZM6 E;  3T1H E;  4WPY A;  2KHX A;  3JAM C;  3MSW A;  4LF9 E;  4DV4 E;  3F6H A;  4DR3 E;  3DF6 A;  2L8T A;  3RMP A;  4LF4 E;  1N33 E;  1HNX E;  1RC7 A;  2V83 A;  1STU A;  1T4O A;  1X48 A;  3T1Y E;  2LTR A;  2M1S A;  4Q28 A;  4DV5 E;  3HPS A;  2RSM A;  5LMN E;  2ODR D;  1QU6 A;  3ZOQ B;  5AAS A;  4TUG A;  2L3J A;  4B3T E;  3J81 C;  1UHZ A;  4KZS A;  4L5N C;  2VQE E;  2UUB E;  2L2N A;  3FIG A;  1HNZ E;  4JI3 E;  3C4T A;  2G7H A;  3ADJ A;  2F4V E;  4JI6 E;  2L6M A;  4DR4 E;  1HNW E;  3J7A G;  4GKJ E;  4BC9 A;  4JI8 E;  4X62 E;  2UU9 E;  1YYK A;  2KON A;  4GEQ B;  4DR6 E;  2UXD E;  2VE7 C;  1WHN A;  4DMI A;  2FV4 B;  4DUY E;  4JI7 E;  4B3M E;  2V85 A;  2LRS A;  4K0K E;  1XMO E;  2N3H A;  5IT9 C;  4F9A B;  3ADL A;  4P78 A;  2B7V A;  2CPN A;  5ADZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...