2V89A

Crystal structure of rag2-phd finger in complex with h3k4me3 peptide at 1.1a resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
78
structure length
78
Chain Sequence
SPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQIARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VDJ RECOMBINATION-ACTIVATING PROTEIN 2
publication title Rag2 Phd Finger Couples Histone H3 Lysine 4 Trimethylation with V(D)J Recombination.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 13
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.290 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2v89A01
2JWOA 2V83A 2V85A 2V87A 2V88A 2V86A 2V89A
chains in the Genus database with same CATH superfamily
5BR8E 4ZYDA 2LT7A 1SR9A 1A1LA 4X9JA 4F6NA 2N3GA 2FV4B 2YSOA 2E5LE 2K4VA 2EMGA 4ZYHA 4DV7E 1AH5A 1HNXE 1ZAAC 2EPPA 4DR7E 4F9AB 4O5GA 2LO3A 4KZSA 2EM9A 4WSPA 2N8XA 2YTPA 2ADRA 2VF1A 2EOZA 2LUPB 2ODRD 4R2QA 2L3CA 2ENAA 2YTIA 2V87A 4LU9A 5LL6R 1EH8A 4I8OA 2YT4A 2M7QA 4X64E 2EPXA 2L2NA 3AV0A 4JI4E 4F6MA 2CSHA 5A2QC 2EOYA 1EKZA 4DV2E 2YTNA 2RPCA 4HTGA 3OMLA 2YTGA 2VQEE 2ELZA 5LLQA 4F9BB 4GZNC 2EOEA 5AE2A 2DB2A 2EMKA 2UUAE 2IHR1 1QU6A 2V8QB 1PJSA 1JK2A 5KL7A 2RQLA 1NEIA 1FJGE 2EL4A 1T4NA 2VE7C 1YYOA 2DGCA 2GHFA 2MDRA 3J7Yp 2LBSB 1TF3A 2EOOA 4WX9A 2VRDA 5AE1A 1A1HA 5A6BD 1ZR9A 3F6GA 4J8ZA 1ZBTA 5KL6A 2EOFA 2JWOA 2EWLA 4LFBE 2YPNA 2EPAA 3EQ1A 3MSWA 4M9VC 2ELYA 4NXNE 1IBME 2YTOA 2KHXA 1UILA 1X48A 3J81C 1PJTA 2WBUA 2R1FA 1KYQA 3ADJA 1HNZE 4JI6E 3JU0A 1G2DC 4LF5E 4JI0E 1HNWE 4IJDA 5ADZA 4LF9E 5KL5A 3HQ1A 2YRHA 5IT9C 1TN9A 2EM8A 2EL5A 2M9AA 4M0VA 2YRMA 4X62E 2NUEA 5A6KA 3C6KA 1X6HA 2MKNA 2EPUA 2EOQA 2R76A 4DR4E 1YFHA 1T38A 2WBTA 2EMCA 4NHRA 4TUIA 1G2FC 1T4OA 4NZVA 2WCC3 3ADGA 5TSEA 4JI2E 4O24A 2LRSA 4JYAE 2YU5A 3RMPA 1HR0E 1SFEA 1XMQE 2V86A 4P78A 1L4SA 3EPHA 2M1SA 4X66E 1UN6B 4BHBA 1WHNA 2ZM6E 4BMJA 4TUGA 2F8BA 2JOXA 2BB8A 2MKDA 4B3RE 2EN1A 2YSPA 2J7JA 4DUZE 3KZYA 2EN6A 1FKAE 1PKPA 2EMYA 5IXMB 3EPJA 3EPKA 2DMIA 2EOSA 2L2MA 2EOHA 1J5EE 3P1XA 3KWRA 2NUGA 2EMFA 4DR2E 3HPZA 4P7DA 2JPAA 3LMLA 3EPLA 2JVAA 4JI5E 4BC7A 1YYWA 3K6QA 5AASA 3BIDA 4LF6E 4GKJE 1IBLE 4F54A 3L00A 5AE3A 4WXDA 3H09A 4BS9A 3VHTB 4DV4E 4JI8E 4ZYGA 5LMNE 1GQEA 2EPNA 4F2JC 2YWQA 5LMUE 2ENCA 4RH8A 1MEYC 2L8TA 4DV3E 3BF2A 1DI2A 1X6EA 3IWDA 4R2AA 4R2CA 3ADLA 1XNQE 4B3TE 3J7AG 4IS1C 2L3JA 2JXPA 4BBYA 1RMDA 1BBGA 4DR5E 1JK1A 4BC9A 4LF4E 4Q28A 3FIGA 2LUQA 2KOUA 3VK6A 2YTQA 1EH6A 2UUBE 2UUCE 2EE8A 2EQ1A 1A1KA 1YUJA 2V85A 1BBOA 1N34E 4DMIA 3VYXA 2DLKA 3QG5C 1B69A 2HJJA 3AUZA 4AQYE 1GZ6A 4ZYEA 2EN2A 2B7VA 3IWBA 2NA2A 2EMBA 2EMWA 2NABA 2EL6A 3MHSC 4JV5E 3JTZA 4LFCE 5KL2A 1RC7A 4R2PA 1YZ9A 2EN4A 2EQ3A 1IBKE 2JY9A 1A1IA 3UK3C 4WYQB 2EN8A 2EMHA 1WJPA 2HGHA 2BBGA 2EM0A 1YSAC 2V83A 2EMIA 4FK5C 4YHHE 5DNYA 2EM7A 4DR3E 2ODRC 5CFFE 2NUFA 4JI3E 5IWAE 3C4BA 4M2ZA 1Z1BA 4WPYA 2KONA 2EOIA 2L6MA 2UXCE 1F2IG 4DV6E 2EORA 1XNRE 3M99B 4O4KA 1YPNA 2EZ6A 3DJWA 2D9HA 2LVHA 4OX9E 2EM5A 1X49A 1X5WA 2E72A 1ZBQA 2HHHE 3HTXA 1N33E 2LTRA 2RS7A 2GPIA 4B3ME 4R2DA 2EN7A 2EM2A 4JI1E 2YTFA 2A25A 2DIXA 2MC6A 5AC4A 2EOXA 1PDAA 4JI7E 2YTEA 4DR1E 2RSMA 1PJQA 3DF6A 2M4IA 4M30A 2EMZA 2B9DA 5KL4A 2L92A 2ENHA 2V88A 4WXCA 2YZTA 2EM4A 2CT1A 4X65E 5FLXC 3C6MA 1MGTA 3THOB 2EN3A 2EQ0A 1QNTA 1DQ3A 2EM3A 1WXRA 2L2KB 2I9IA 1T4LB 2LV2A 1IQOA 4OOGC 2WBSA 3T1YE 2FGGA 2DSYA 4R03A 4O43A 3HXLA 4BCAA 1N36E 1DGCA 4BHCA 2EMAA 5T6JA 2DRPA 2EPCA 2CTDA 1A1GA 5A6AA 1LLMC 1NCSA 4WFTA 4DKKA 1AAYA 1ZU1A 1TF6A 3BBGA 2FTXB 4N4RB 4LF8E 4YY3E 3LLHA 5F3WA 1IQSA 2MDGA 2RS6A 1WRJA 2YRKA 2CPNA 2B7TA 4DV1E 3IWCA 3KZZA 1EH7A 4MLQA 2EJ4A 2JP9A 4F9CB 4DR6E 2YU8A 1STUA 1A1JA 3JAMC 4L5NC 2EPRA 1N3GA 4X8WA 2JOBA 4K0KE 3THNA 2LMZA 2YTJA 3C4TA 1KJKA 1N32E 4GKKE 5A69A 3MHHC 2RSIA 2V89A 3T1HE 3J80C 2EOJA 2I13A 3ADIA 4KWYA 4L8NA 2EPZA 4MLVA 2LJHA 2DLQA 1UHZA 1IMUA 2DMYA 1O0WA 4Q35B 2EOMA 4LTYA 2EPMX 3OTOE 4LFAE 2WZOA 2YTDA 1RQ0A 2HC5A 5A6BA 5IV8B 1X47A 2UXDE 2EMXA 2RTXA 1BB8A 3HPSA 2VQFE 2EMLA 4LF7E 1A1FA 5A6JA 2EPOA 4R2SA 3F6HA 2EPKX 2JR1A 2K7IA 2GLIA 1P47A 1GTKA 2Q8UA 2N3HA 4DV5E 1I94E 2EPLX 4R8OA 3ECRA 2LJUA 4GEQB 5KL3A 2LCEA 4WSGA 1X6FA 2EM6A 4B3SE 1YYKA 2L33A 3TQMA 2JYAA 1WHQA 2E1MA 1T39A 4DV0E 1UBDC 4DUYE 2LE2A 1J26A 3VYYA 2F4VE 4NXME 4R2RA 5AC5A 2UU9E 2G7HA 1X3CA 2MC5A 2PRTA 4KHPE 1XMOE 3BGHA 3ZOQB 4R2EA 4HEIA 2LTSA 1YUIA 2B3TB 2H36X 2UXBE 2EP3A 4RHBB
chains in the Genus database with same CATH topology
3HXLA 5BR8E 4BCAA 5IT9C 1N36E 1SR9A 2B7VA 3IWBA 2N3GA 2NA2A 4M0VA 2FV4B 5T6JA 4X62E 2E5LE 2K4VA 3JTZA 4DV7E 4LFCE 2NUEA 4JV5E 1RC7A 1HNXE 4DR7E 1YZ9A 4F9AB 4WFTA 4DR4E 1IBKE 4DKKA 4TUIA 4KZSA 2JY9A 1T4OA 2FTXB 4LF8E 4WSPA 3ADGA 4YY3E 4JI2E 3LLHA 2LRSA 5F3WA 4JYAE 4WYQB 4JI3E 3RMPA 1HR0E 2VF1A 3AUZA 1XMQE 2V86A 4P78A 2RS6A 2LUPB 2ODRD 2CPNA 2L3CA 2B7TA 4DV1E 2V83A 3IWCA 4YHHE 2M1SA 2V87A 4LU9A 5LL6R 4F9CB 4X66E 4DR6E 2UXBE 1STUA 4I8OA 1WHNA 5DNYA 3JAMC 2YT4A 2M7QA 4DR3E 2ODRC 4L5NC 5CFFE 4BMJA 4X64E 5IWAE 2ZM6E 2NUFA 4TUGA 3C4BA 3AV0A 2L2NA 2F8BA 2JOBA 2JOXA 4X8WA 4JI4E 2LMZA 4M2ZA 4K0KE 4B3RE 5A2QC 3C4TA 4WPYA 2KONA 4DUZE 1N32E 4GKKE 2L6MA 1FKAE 1EKZA 2UXCE 1PKPA 4DV6E 1XNRE 2V89A 3T1HE 3J80C 3DJWA 4DV2E 2EZ6A 3ADIA 4OX9E 4L8NA 1X49A 2LJHA 1UHZA 3HTXA 1ZBQA 2L2MA 3OMLA 1J5EE 2DMYA 1O0WA 3P1XA 4LTYA 2HHHE 2LTRA 3OTOE 2VQEE 1N33E 2RS7A 3KWRA 4B3ME 4LFAE 2NUGA 4DR2E 2WZOA 3HPZA 4F9BB 1RQ0A 4P7DA 5AE2A 3LMLA 2DB2A 4JI1E 2JVAA 1X47A 2UUAE 4JI5E 2IHR1 1QU6A 4BC7A 2UXDE 1YYWA 2RTXA 2V8QB 2DIXA 3K6QA 3HPSA 5AASA 2VQFE 4AQYE 4LF6E 1FJGE 1T4NA 2MC6A 2VE7C 4F54A 1IBLE 4GKJE 4LF7E 5AE3A 1YYOA 4JI7E 3H09A 4BS9A 2MDRA 4DV4E 4JI8E 3F6HA 3J7Yp 5LMNE 4DR1E 2LBSB 2JR1A 1GQEA 2RSMA 5AE1A 2N3HA 5LMUE 4DV5E 1I94E 3DF6A 2M4IA 3F6GA 4J8ZA 1ZBTA 4R8OA 2L8TA 4M30A 4GEQB 4DV3E 2B9DA 2JWOA 1DI2A 2EWLA 4LFBE 2L92A 3IWDA 4B3SE 3MSWA 1YYKA 2V88A 3ADLA 2L33A 1XNQE 2YZTA 4NXNE 4B3TE 3J7AG 1WHQA 1IBME 2E1MA 2L3JA 2KHXA 1UILA 4DV0E 4X65E 4BBYA 1X48A 5FLXC 3J81C 4DUYE 2LE2A 4BC9A 4DR5E 4LF4E 1J26A 4Q28A 3VYYA 3FIGA 2F4VE 2LUQA 4NXME 2KOUA 2UU9E 2G7HA 3VK6A 2MC5A 1DQ3A 1WXRA 2UUBE 4KHPE 2L2KB 1XMOE 3ADJA 2UUCE 1HNZE 3ZOQB 3JU0A 1T4LB 4OOGC 4JI6E 4JI0E 4LF5E 1HNWE 2V85A 1N34E 4DMIA 2LTSA 3T1YE 3VYXA 5ADZA 2B3TB 2FGGA 2H36X 4LF9E 2DSYA 1GZ6A 4R03A 3HQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JWO A;  2V83 A;  2V85 A;  2V87 A;  2V88 A;  2V86 A;  2V89 A; 
#chains in the Genus database with same CATH topology
 5BR8 E;  4ZYD A;  2LT7 A;  1SR9 A;  1A1L A;  4X9J A;  4F6N A;  2N3G A;  2FV4 B;  2YSO A;  2E5L E;  2K4V A;  2EMG A;  4ZYH A;  4DV7 E;  1AH5 A;  1HNX E;  1ZAA C;  2EPP A;  4DR7 E;  4F9A B;  4O5G A;  2LO3 A;  4KZS A;  2EM9 A;  4WSP A;  2N8X A;  2YTP A;  2ADR A;  2VF1 A;  2EOZ A;  2LUP B;  2ODR D;  4R2Q A;  2L3C A;  2ENA A;  2YTI A;  2V87 A;  4LU9 A;  5LL6 R;  1EH8 A;  4I8O A;  2YT4 A;  2M7Q A;  4X64 E;  2EPX A;  2L2N A;  3AV0 A;  4JI4 E;  4F6M A;  2CSH A;  5A2Q C;  2EOY A;  1EKZ A;  4DV2 E;  2YTN A;  2RPC A;  4HTG A;  3OML A;  2YTG A;  2VQE E;  2ELZ A;  5LLQ A;  4F9B B;  4GZN C;  2EOE A;  5AE2 A;  2DB2 A;  2EMK A;  2UUA E;  2IHR 1;  1QU6 A;  2V8Q B;  1PJS A;  1JK2 A;  5KL7 A;  2RQL A;  1NEI A;  1FJG E;  2EL4 A;  1T4N A;  2VE7 C;  1YYO A;  2DGC A;  2GHF A;  2MDR A;  3J7Y p;  2LBS B;  1TF3 A;  2EOO A;  4WX9 A;  2VRD A;  5AE1 A;  1A1H A;  5A6B D;  1ZR9 A;  3F6G A;  4J8Z A;  1ZBT A;  5KL6 A;  2EOF A;  2JWO A;  2EWL A;  4LFB E;  2YPN A;  2EPA A;  3EQ1 A;  3MSW A;  4M9V C;  2ELY A;  4NXN E;  1IBM E;  2YTO A;  2KHX A;  1UIL A;  1X48 A;  3J81 C;  1PJT A;  2WBU A;  2R1F A;  1KYQ A;  3ADJ A;  1HNZ E;  4JI6 E;  3JU0 A;  1G2D C;  4LF5 E;  4JI0 E;  1HNW E;  4IJD A;  5ADZ A;  4LF9 E;  5KL5 A;  3HQ1 A;  2YRH A;  5IT9 C;  1TN9 A;  2EM8 A;  2EL5 A;  2M9A A;  4M0V A;  2YRM A;  4X62 E;  2NUE A;  5A6K A;  3C6K A;  1X6H A;  2MKN A;  2EPU A;  2EOQ A;  2R76 A;  4DR4 E;  1YFH A;  1T38 A;  2WBT A;  2EMC A;  4NHR A;  4TUI A;  1G2F C;  1T4O A;  4NZV A;  2WCC 3;  3ADG A;  5TSE A;  4JI2 E;  4O24 A;  2LRS A;  4JYA E;  2YU5 A;  3RMP A;  1HR0 E;  1SFE A;  1XMQ E;  2V86 A;  4P78 A;  1L4S A;  3EPH A;  2M1S A;  4X66 E;  1UN6 B;  4BHB A;  1WHN A;  2ZM6 E;  4BMJ A;  4TUG A;  2F8B A;  2JOX A;  2BB8 A;  2MKD A;  4B3R E;  2EN1 A;  2YSP A;  2J7J A;  4DUZ E;  3KZY A;  2EN6 A;  1FKA E;  1PKP A;  2EMY A;  5IXM B;  3EPJ A;  3EPK A;  2DMI A;  2EOS A;  2L2M A;  2EOH A;  1J5E E;  3P1X A;  3KWR A;  2NUG A;  2EMF A;  4DR2 E;  3HPZ A;  4P7D A;  2JPA A;  3LML A;  3EPL A;  2JVA A;  4JI5 E;  4BC7 A;  1YYW A;  3K6Q A;  5AAS A;  3BID A;  4LF6 E;  4GKJ E;  1IBL E;  4F54 A;  3L00 A;  5AE3 A;  4WXD A;  3H09 A;  4BS9 A;  3VHT B;  4DV4 E;  4JI8 E;  4ZYG A;  5LMN E;  1GQE A;  2EPN A;  4F2J C;  2YWQ A;  5LMU E;  2ENC A;  4RH8 A;  1MEY C;  2L8T A;  4DV3 E;  3BF2 A;  1DI2 A;  1X6E A;  3IWD A;  4R2A A;  4R2C A;  3ADL A;  1XNQ E;  4B3T E;  3J7A G;  4IS1 C;  2L3J A;  2JXP A;  4BBY A;  1RMD A;  1BBG A;  4DR5 E;  1JK1 A;  4BC9 A;  4LF4 E;  4Q28 A;  3FIG A;  2LUQ A;  2KOU A;  3VK6 A;  2YTQ A;  1EH6 A;  2UUB E;  2UUC E;  2EE8 A;  2EQ1 A;  1A1K A;  1YUJ A;  2V85 A;  1BBO A;  1N34 E;  4DMI A;  3VYX A;  2DLK A;  3QG5 C;  1B69 A;  2HJJ A;  3AUZ A;  4AQY E;  1GZ6 A;  4ZYE A;  2EN2 A;  2B7V A;  3IWB A;  2NA2 A;  2EMB A;  2EMW A;  2NAB A;  2EL6 A;  3MHS C;  4JV5 E;  3JTZ A;  4LFC E;  5KL2 A;  1RC7 A;  4R2P A;  1YZ9 A;  2EN4 A;  2EQ3 A;  1IBK E;  2JY9 A;  1A1I A;  3UK3 C;  4WYQ B;  2EN8 A;  2EMH A;  1WJP A;  2HGH A;  2BBG A;  2EM0 A;  1YSA C;  2V83 A;  2EMI A;  4FK5 C;  4YHH E;  5DNY A;  2EM7 A;  4DR3 E;  2ODR C;  5CFF E;  2NUF A;  4JI3 E;  5IWA E;  3C4B A;  4M2Z A;  1Z1B A;  4WPY A;  2KON A;  2EOI A;  2L6M A;  2UXC E;  1F2I G;  4DV6 E;  2EOR A;  1XNR E;  3M99 B;  4O4K A;  1YPN A;  2EZ6 A;  3DJW A;  2D9H A;  2LVH A;  4OX9 E;  2EM5 A;  1X49 A;  1X5W A;  2E72 A;  1ZBQ A;  2HHH E;  3HTX A;  1N33 E;  2LTR A;  2RS7 A;  2GPI A;  4B3M E;  4R2D A;  2EN7 A;  2EM2 A;  4JI1 E;  2YTF A;  2A25 A;  2DIX A;  2MC6 A;  5AC4 A;  2EOX A;  1PDA A;  4JI7 E;  2YTE A;  4DR1 E;  2RSM A;  1PJQ A;  3DF6 A;  2M4I A;  4M30 A;  2EMZ A;  2B9D A;  5KL4 A;  2L92 A;  2ENH A;  2V88 A;  4WXC A;  2YZT A;  2EM4 A;  2CT1 A;  4X65 E;  5FLX C;  3C6M A;  1MGT A;  3THO B;  2EN3 A;  2EQ0 A;  1QNT A;  1DQ3 A;  2EM3 A;  1WXR A;  2L2K B;  2I9I A;  1T4L B;  2LV2 A;  1IQO A;  4OOG C;  2WBS A;  3T1Y E;  2FGG A;  2DSY A;  4R03 A;  4O43 A;  3HXL A;  4BCA A;  1N36 E;  1DGC A;  4BHC A;  2EMA A;  5T6J A;  2DRP A;  2EPC A;  2CTD A;  1A1G A;  5A6A A;  1LLM C;  1NCS A;  4WFT A;  4DKK A;  1AAY A;  1ZU1 A;  1TF6 A;  3BBG A;  2FTX B;  4N4R B;  4LF8 E;  4YY3 E;  3LLH A;  5F3W A;  1IQS A;  2MDG A;  2RS6 A;  1WRJ A;  2YRK A;  2CPN A;  2B7T A;  4DV1 E;  3IWC A;  3KZZ A;  1EH7 A;  4MLQ A;  2EJ4 A;  2JP9 A;  4F9C B;  4DR6 E;  2YU8 A;  1STU A;  1A1J A;  3JAM C;  4L5N C;  2EPR A;  1N3G A;  4X8W A;  2JOB A;  4K0K E;  3THN A;  2LMZ A;  2YTJ A;  3C4T A;  1KJK A;  1N32 E;  4GKK E;  5A69 A;  3MHH C;  2RSI A;  2V89 A;  3T1H E;  3J80 C;  2EOJ A;  2I13 A;  3ADI A;  4KWY A;  4L8N A;  2EPZ A;  4MLV A;  2LJH A;  2DLQ A;  1UHZ A;  1IMU A;  2DMY A;  1O0W A;  4Q35 B;  2EOM A;  4LTY A;  2EPM X;  3OTO E;  4LFA E;  2WZO A;  2YTD A;  1RQ0 A;  2HC5 A;  5A6B A;  5IV8 B;  1X47 A;  2UXD E;  2EMX A;  2RTX A;  1BB8 A;  3HPS A;  2VQF E;  2EML A;  4LF7 E;  1A1F A;  5A6J A;  2EPO A;  4R2S A;  3F6H A;  2EPK X;  2JR1 A;  2K7I A;  2GLI A;  1P47 A;  1GTK A;  2Q8U A;  2N3H A;  4DV5 E;  1I94 E;  2EPL X;  4R8O A;  3ECR A;  2LJU A;  4GEQ B;  5KL3 A;  2LCE A;  4WSG A;  1X6F A;  2EM6 A;  4B3S E;  1YYK A;  2L33 A;  3TQM A;  2JYA A;  1WHQ A;  2E1M A;  1T39 A;  4DV0 E;  1UBD C;  4DUY E;  2LE2 A;  1J26 A;  3VYY A;  2F4V E;  4NXM E;  4R2R A;  5AC5 A;  2UU9 E;  2G7H A;  1X3C A;  2MC5 A;  2PRT A;  4KHP E;  1XMO E;  3BGH A;  3ZOQ B;  4R2E A;  4HEI A;  2LTS A;  1YUI A;  2B3T B;  2H36 X;  2UXB E;  2EP3 A;  4RHB B; 
#chains in the Genus database with same CATH homology
 3HXL A;  5BR8 E;  4BCA A;  5IT9 C;  1N36 E;  1SR9 A;  2B7V A;  3IWB A;  2N3G A;  2NA2 A;  4M0V A;  2FV4 B;  5T6J A;  4X62 E;  2E5L E;  2K4V A;  3JTZ A;  4DV7 E;  4LFC E;  2NUE A;  4JV5 E;  1RC7 A;  1HNX E;  4DR7 E;  1YZ9 A;  4F9A B;  4WFT A;  4DR4 E;  1IBK E;  4DKK A;  4TUI A;  4KZS A;  2JY9 A;  1T4O A;  2FTX B;  4LF8 E;  4WSP A;  3ADG A;  4YY3 E;  4JI2 E;  3LLH A;  2LRS A;  5F3W A;  4JYA E;  4WYQ B;  4JI3 E;  3RMP A;  1HR0 E;  2VF1 A;  3AUZ A;  1XMQ E;  2V86 A;  4P78 A;  2RS6 A;  2LUP B;  2ODR D;  2CPN A;  2L3C A;  2B7T A;  4DV1 E;  2V83 A;  3IWC A;  4YHH E;  2M1S A;  2V87 A;  4LU9 A;  5LL6 R;  4F9C B;  4X66 E;  4DR6 E;  2UXB E;  1STU A;  4I8O A;  1WHN A;  5DNY A;  3JAM C;  2YT4 A;  2M7Q A;  4DR3 E;  2ODR C;  4L5N C;  5CFF E;  4BMJ A;  4X64 E;  5IWA E;  2ZM6 E;  2NUF A;  4TUG A;  3C4B A;  3AV0 A;  2L2N A;  2F8B A;  2JOB A;  2JOX A;  4X8W A;  4JI4 E;  2LMZ A;  4M2Z A;  4K0K E;  4B3R E;  5A2Q C;  3C4T A;  4WPY A;  2KON A;  4DUZ E;  1N32 E;  4GKK E;  2L6M A;  1FKA E;  1EKZ A;  2UXC E;  1PKP A;  4DV6 E;  1XNR E;  2V89 A;  3T1H E;  3J80 C;  3DJW A;  4DV2 E;  2EZ6 A;  3ADI A;  4OX9 E;  4L8N A;  1X49 A;  2LJH A;  1UHZ A;  3HTX A;  1ZBQ A;  2L2M A;  3OML A;  1J5E E;  2DMY A;  1O0W A;  3P1X A;  4LTY A;  2HHH E;  2LTR A;  3OTO E;  2VQE E;  1N33 E;  2RS7 A;  3KWR A;  4B3M E;  4LFA E;  2NUG A;  4DR2 E;  2WZO A;  3HPZ A;  4F9B B;  1RQ0 A;  4P7D A;  5AE2 A;  3LML A;  2DB2 A;  4JI1 E;  2JVA A;  1X47 A;  2UUA E;  4JI5 E;  2IHR 1;  1QU6 A;  4BC7 A;  2UXD E;  1YYW A;  2RTX A;  2V8Q B;  2DIX A;  3K6Q A;  3HPS A;  5AAS A;  2VQF E;  4AQY E;  4LF6 E;  1FJG E;  1T4N A;  2MC6 A;  2VE7 C;  4F54 A;  1IBL E;  4GKJ E;  4LF7 E;  5AE3 A;  1YYO A;  4JI7 E;  3H09 A;  4BS9 A;  2MDR A;  4DV4 E;  4JI8 E;  3F6H A;  3J7Y p;  5LMN E;  4DR1 E;  2LBS B;  2JR1 A;  1GQE A;  2RSM A;  5AE1 A;  2N3H A;  5LMU E;  4DV5 E;  1I94 E;  3DF6 A;  2M4I A;  3F6G A;  4J8Z A;  1ZBT A;  4R8O A;  2L8T A;  4M30 A;  4GEQ B;  4DV3 E;  2B9D A;  2JWO A;  1DI2 A;  2EWL A;  4LFB E;  2L92 A;  3IWD A;  4B3S E;  3MSW A;  1YYK A;  2V88 A;  3ADL A;  2L33 A;  1XNQ E;  2YZT A;  4NXN E;  4B3T E;  3J7A G;  1WHQ A;  1IBM E;  2E1M A;  2L3J A;  2KHX A;  1UIL A;  4DV0 E;  4X65 E;  4BBY A;  1X48 A;  5FLX C;  3J81 C;  4DUY E;  2LE2 A;  4BC9 A;  4DR5 E;  4LF4 E;  1J26 A;  4Q28 A;  3VYY A;  3FIG A;  2F4V E;  2LUQ A;  4NXM E;  2KOU A;  2UU9 E;  2G7H A;  3VK6 A;  2MC5 A;  1DQ3 A;  1WXR A;  2UUB E;  4KHP E;  2L2K B;  1XMO E;  3ADJ A;  2UUC E;  1HNZ E;  3ZOQ B;  3JU0 A;  1T4L B;  4OOG C;  4JI6 E;  4JI0 E;  4LF5 E;  1HNW E;  2V85 A;  1N34 E;  4DMI A;  2LTS A;  3T1Y E;  3VYX A;  5ADZ A;  2B3T B;  2FGG A;  2H36 X;  4LF9 E;  2DSY A;  1GZ6 A;  4R03 A;  3HQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...