2V89A

Crystal structure of rag2-phd finger in complex with h3k4me3 peptide at 1.1a resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
78
structure length
78
Chain Sequence
SPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQIARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords VDJ RECOMBINATION-ACTIVATING PROTEIN 2
publication title Rag2 Phd Finger Couples Histone H3 Lysine 4 Trimethylation with V(D)J Recombination.
pubmed doi rcsb
source organism Mus musculus
total genus 13
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.290 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2v89A01
2V83A 2V87A 2V86A 2V88A 2V85A 2V89A 2JWOA
chains in the Genus database with same CATH superfamily
2MDRA 2L33A 2UUCE 2CT1A 2V87A 2EPPA 2JVAA 4BMJA 2EOHA 4X8WA 2YTGA 5BR8E 2LMZA 3OTOE 2KONA 4GKJE 2V89A 3BIDA 1BB8A 4P78A 2R1FA 4X62E 4DV7E 2YRKA 2HGHA 2WBSA 2EN4A 2B7TA 2EL5A 3T1HE 2YWQA 4LFAE 1MGTA 2EM5A 4J8ZA 1PDAA 2VRDA 4O5GA 2EOIA 2EMCA 2MKNA 1IMUA 5DNYA 2N3HA 4DR7E 4JYAE 2WBTA 1XMOE 1STUA 3VHTB 4DR6E 2DMYA 2EM3A 4F9BB 4RHBB 4O24A 1T38A 4BS9A 4NZVA 2DRPA 3RMPA 1G2DC 4R2EA 2YPNA 4O43A 2NUEA 1RQ0A 1WHNA 1TF6A 2WCC3 4DR5E 5LMUE 3HPSA 4K0KE 3K6QA 5ADZA 2LUPB 1YFHA 1ZR9A 2E1MA 2ZM6E 2DSYA 4B3RE 3VK6A 1N3GA 4R2PA 1DI2A 2B7VA 3F6HA 1Z1BA 2UUBE 1EH7A 3ADJA 3MHHC 2DB2A 2JOBA 4B3ME 2EM0A 2EQ0A 2EOEA 3J7Yp 2LRSA 2LVHA 1ZU1A 1SFEA 2EOZA 2EM8A 3EPKA 2I9IA 2V8QB 4WXDA 2UU9E 2DGCA 4LF5E 2EWLA 4IS1C 2YTJA 4LF4E 5A69A 2R76A 2RSMA 2YTNA 2V86A 3P1XA 3ECRA 2V85A 4JI5E 5AE1A 4DV2E 2LV2A 2RPCA 1PJSA 2EN2A 2N8XA 5F3WA 2LTSA 2NA2A 2LUQA 2CSHA 5LLQA 5IV8B 5FLXC 2K7IA 4IJDA 2LCEA 2EPMX 2EPLX 1X6EA 4R8OA 2L3JA 4WYQB 1F2IG 2KHXA 3OMLA 2CPNA 2RSIA 5A6BA 1T4LB 1A1HA 2M1SA 2YRMA 4R2RA 2EPUA 2Q8UA 2EN6A 4Q28A 2EMIA 4GKKE 2LJHA 2V83A 4JI3E 2YTEA 1T4OA 2UXCE 4JI2E 2YT4A 2ODRC 2J7JA 4WXCA 2L2KB 4DR3E 2EM7A 4LFCE 4DUZE 1A1JA 2HC5A 4LF7E 2EP3A 5AC5A 3KWRA 2EN1A 5CFFE 2EOJA 2BB8A 2MKDA 4R2AA 3C6KA 2EN8A 1NCSA 5A6AA 4X66E 1P47A 1SR9A 2EMXA 4TUIA 2I13A 3LLHA 1L4SA 1JK2A 2IHR1 1YPNA 4LF6E 3IWBA 4WFTA 5AC4A 1HR0E 3F6GA 3KZYA 4F9AB 3THOB 4HTGA 2EMGA 2EQ1A 1ZBQA 4DV1E 4X65E 3HTXA 2M4IA 4YHHE 2NUFA 4N4RB 3MSWA 1XNQE 3HPZA 1YSAC 2M9AA 1WXRA 1J5EE 1GTKA 2E72A 3DF6A 1YUJA 2ELZA 1RC7A 2UXBE 2EOYA 2PRTA 5LL6R 4DR2E 2E5LE 1UN6B 2EPXA 3MHSC 4JI1E 1IBME 4M2ZA 4ZYEA 1YUIA 2M7QA 2DLQA 2EPOA 1X6HA 4DV0E 2N3GA 4WSGA 3C6MA 4GEQB 1X49A 2YTFA 1YYOA 2EZ6A 1MEYC 5AASA 4NHRA 1A1IA 3TQMA 1HNZE 1UBDC 2ENAA 3HXLA 1YYWA 4KHPE 1XNRE 2EOXA 4R2SA 4L8NA 4AQYE 2VF1A 5KL2A 4LFBE 3QG5C 3IWCA 1HNXE 3EQ1A 3L00A 2L3CA 4DV6E 4LU9A 1FJGE 5KL5A 1KJKA 1GQEA 2YTOA 3C4TA 2EMYA 4F6MA 2HHHE 4ZYHA 4MLQA 1A1LA 4WPYA 2JPAA 2L8TA 2WZOA 3J81C 3J80C 2EMFA 3EPJA 4R2CA 3BBGA 2B9DA 4JI8E 4B3TE 1IBLE 2A25A 2YTPA 1X48A 4DV5E 2EPCA 2EL6A 3EPHA 2ENHA 4WSPA 2EMAA 2EOMA 1AAYA 1TN9A 1FKAE 2MC6A 2JOXA 4F9CB 2L2MA 2F8BA 1GZ6A 2L6MA 3C4BA 1AH5A 3JAMC 2EMWA 2FTXB 2VQFE 2RQLA 1X5WA 5TSEA 1PKPA 4KWYA 2EOSA 4ZYDA 2GPIA 3IWDA 5AE2A 2EM9A 3ADIA 1PJQA 3EPLA 4NXME 2UUAE 2JR1A 1A1GA 1A1FA 2EMLA 2MDGA 4L5NC 1IBKE 1WJPA 2JYAA 4DV4E 3H09A 3VYYA 2BBGA 1PJTA 2EOFA 4F54A 1N34E 1WHQA 2G7HA 1KYQA 2ADRA 1I94E 2NUGA 1IQOA 4BC7A 1EH8A 2EE8A 2EJ4A 4TUGA 2EMBA 1QNTA 2H36X 4MLVA 2EMZA 4JV5E 2EORA 4RH8A 2LO3A 5KL3A 4YY3E 1DQ3A 2EM2A 3M99B 5LMNE 2MC5A 4DUYE 4M9VC 2JWOA 1BBOA 2JP9A 2YSOA 1O0WA 3T1YE 2DIXA 2EM6A 2ODRD 1UILA 2ENCA 2RS7A 3UK3C 4OX9E 2NABA 4JI7E 1YZ9A 2HJJA 2LJUA 1EH6A 4JI6E 4JI4E 3HQ1A 1IQSA 2V88A 2CTDA 2EPKX 1JK1A 2F4VE 2EMHA 2EPNA 3BF2A 2GLIA 5IT9C 3VYXA 4BCAA 5T6JA 2EN3A 2YSPA 2DLKA 2LBSB 4M30A 4ZYGA 4R2DA 2B3TB 1A1KA 1HNWE 1N36E 2EL4A 4O4KA 4X64E 4DR4E 2YTQA 3THNA 1G2FC 4M0VA 2FGGA 1NEIA 2JXPA 1N33E 1T4NA 2DMIA 4DMIA 2VQEE 4KZSA 1ZAAC 4LTYA 4HEIA 2EOOA 3FIGA 2EN7A 2L92A 4P7DA 4DKKA 5A6KA 1X6FA 1DGCA 4FK5C 5IXMB 3DJWA 5KL7A 1X3CA 2YU5A 4BHCA 4F6NA 2EPRA 2WBUA 2YU8A 2KOUA 4R2QA 4R03A 5AE3A 2YTIA 4BC9A 2GHFA 1LLMC 2D9HA 2ELYA 2EOQA 5A6BD 4GZNC 4WX9A 4X9JA 2EPAA 3JTZA 5A2QC 2FV4B 3ADGA 1ZBTA 2EQ3A 2YRHA 1RMDA 3ADLA 4BBYA 2LT7A 2LTRA 2L2NA 2YTDA 2EPZA 3LMLA 1EKZA 1J26A 2RTXA 1B69A 1YYKA 4Q35B 3J7AG 4DR1E 3ZOQB 2RS6A 4NXNE 2UXDE 1UHZA 2LE2A 5A6JA 2VE7C 2JY9A 5KL6A 3AUZA 4I8OA 5IWAE 2EM4A 4F2JC 2EMKA 4JI0E 1T39A 1QU6A 1N32E 1BBGA 4OOGC 1X47A 4BHBA 1XMQE 3AV0A 5KL4A 4LF9E 2K4VA 4DV3E 2YZTA 4LF8E 3JU0A 1TF3A 3BGHA 4B3SE 1WRJA 3KZZA
chains in the Genus database with same CATH topology
2MDRA 2L33A 2UUCE 4GEQB 1O0WA 5F3WA 1X49A 2V87A 2LTSA 2NA2A 3T1YE 2DIXA 2LUQA 2ODRD 1YYOA 2EZ6A 1UILA 2RS7A 5AASA 4OX9E 5FLXC 1HNZE 3HXLA 2JVAA 1YYWA 4BMJA 4JI7E 4X8WA 5BR8E 1XNRE 1YZ9A 2LMZA 4KHPE 3OTOE 2KONA 4GKJE 2V89A 4L8NA 4AQYE 4P78A 2VF1A 4X62E 4DV7E 4R8OA 4JI4E 4JI6E 3HQ1A 4LFBE 2L3JA 3IWCA 2B7TA 3T1HE 1HNXE 2V88A 4WYQB 2L3CA 2KHXA 3OMLA 4LFAE 2CPNA 4DV6E 2F4VE 4J8ZA 4LU9A 1T4LB 1FJGE 2M1SA 5IT9C 3VYXA 1GQEA 4BCAA 5T6JA 3C4TA 5DNYA 4Q28A 2N3HA 4DR7E 2LBSB 2HHHE 4M30A 4GKKE 4JYAE 2B3TB 2LJHA 2V83A 1N36E 4JI3E 1T4OA 4WPYA 1HNWE 2UXCE 2L8TA 4JI2E 2YT4A 2WZOA 2ODRC 4X64E 3J81C 3J80C 1XMOE 4M0VA 1STUA 2FGGA 4DR6E 2DMYA 4F9BB 2B9DA 4JI8E 2L2KB 4B3TE 4DR3E 1T4NA 1N33E 1IBLE 4DMIA 4LFCE 2VQEE 4BS9A 4DUZE 4KZSA 4LTYA 3RMPA 4LF7E 1X48A 3FIGA 2L92A 4DKKA 4P7DA 4DV5E 3KWRA 2UXDE 5CFFE 1RQ0A 1WHNA 2NUEA 3DJWA 4WSPA 4DR5E 5LMUE 3HPSA 1FKAE 4K0KE 3K6QA 2KOUA 5ADZA 4R03A 2MC6A 2LUPB 5AE3A 2JOXA 4BC9A 4F9CB 2L2MA 2E1MA 2ZM6E 2DSYA 4B3RE 2F8BA 3VK6A 4X66E 1SR9A 4TUIA 3LLHA 1GZ6A 2L6MA 3C4BA 2IHR1 1DI2A 4NXNE 3JTZA 3JAMC 2B7VA 2FTXB 3F6HA 5A2QC 2FV4B 3ADGA 2VQFE 1ZBTA 3IWBA 2UUBE 1PKPA 3ADJA 4LF6E 4WFTA 3IWDA 5AE2A 2DB2A 2JOBA 1HR0E 3F6GA 4B3ME 3ADIA 4F9AB 3ADLA 4BBYA 4NXME 4DR4E 3J7Yp 2UUAE 2JR1A 2LRSA 2LTRA 2L2NA 4L5NC 1XNQE 1IBKE 3LMLA 1EKZA 1ZBQA 4DV1E 4DV4E 1J26A 2RTXA 3H09A 4X65E 3VYYA 3HTXA 2V8QB 2M4IA 2UU9E 4YHHE 2NUFA 1YYKA 3J7AG 3MSWA 4DR1E 3HPZA 4LF5E 2EWLA 4F54A 3ZOQB 2RS6A 1WXRA 1N34E 1WHQA 1UHZA 2LE2A 2G7HA 1J5EE 1I94E 2VE7C 3DF6A 4LF4E 2JY9A 2NUGA 1RC7A 2UXBE 3AUZA 2RSMA 4I8OA 5IWAE 4BC7A 2V86A 5LL6R 3P1XA 4JI0E 4DR2E 4TUGA 1QU6A 2H36X 2E5LE 1N32E 4OOGC 2V85A 4JV5E 4JI5E 4JI1E 5AE1A 1X47A 4DV2E 1IBME 4M2ZA 1XMQE 3AV0A 4LF9E 2K4VA 2M7QA 2YZTA 4YY3E 4DV3E 1DQ3A 4LF8E 3JU0A 5LMNE 4B3SE 2MC5A 4DUYE 2JWOA 4DV0E 2N3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V83 A;  2V87 A;  2V86 A;  2V88 A;  2V85 A;  2V89 A;  2JWO A; 
#chains in the Genus database with same CATH topology
 2MDR A;  2L33 A;  2UUC E;  2CT1 A;  2V87 A;  2EPP A;  2JVA A;  4BMJ A;  2EOH A;  4X8W A;  2YTG A;  5BR8 E;  2LMZ A;  3OTO E;  2KON A;  4GKJ E;  2V89 A;  3BID A;  1BB8 A;  4P78 A;  2R1F A;  4X62 E;  4DV7 E;  2YRK A;  2HGH A;  2WBS A;  2EN4 A;  2B7T A;  2EL5 A;  3T1H E;  2YWQ A;  4LFA E;  1MGT A;  2EM5 A;  4J8Z A;  1PDA A;  2VRD A;  4O5G A;  2EOI A;  2EMC A;  2MKN A;  1IMU A;  5DNY A;  2N3H A;  4DR7 E;  4JYA E;  2WBT A;  1XMO E;  1STU A;  3VHT B;  4DR6 E;  2DMY A;  2EM3 A;  4F9B B;  4RHB B;  4O24 A;  1T38 A;  4BS9 A;  4NZV A;  2DRP A;  3RMP A;  1G2D C;  4R2E A;  2YPN A;  4O43 A;  2NUE A;  1RQ0 A;  1WHN A;  1TF6 A;  2WCC 3;  4DR5 E;  5LMU E;  3HPS A;  4K0K E;  3K6Q A;  5ADZ A;  2LUP B;  1YFH A;  1ZR9 A;  2E1M A;  2ZM6 E;  2DSY A;  4B3R E;  3VK6 A;  1N3G A;  4R2P A;  1DI2 A;  2B7V A;  3F6H A;  1Z1B A;  2UUB E;  1EH7 A;  3ADJ A;  3MHH C;  2DB2 A;  2JOB A;  4B3M E;  2EM0 A;  2EQ0 A;  2EOE A;  3J7Y p;  2LRS A;  2LVH A;  1ZU1 A;  1SFE A;  2EOZ A;  2EM8 A;  3EPK A;  2I9I A;  2V8Q B;  4WXD A;  2UU9 E;  2DGC A;  4LF5 E;  2EWL A;  4IS1 C;  2YTJ A;  4LF4 E;  5A69 A;  2R76 A;  2RSM A;  2YTN A;  2V86 A;  3P1X A;  3ECR A;  2V85 A;  4JI5 E;  5AE1 A;  4DV2 E;  2LV2 A;  2RPC A;  1PJS A;  2EN2 A;  2N8X A;  5F3W A;  2LTS A;  2NA2 A;  2LUQ A;  2CSH A;  5LLQ A;  5IV8 B;  5FLX C;  2K7I A;  4IJD A;  2LCE A;  2EPM X;  2EPL X;  1X6E A;  4R8O A;  2L3J A;  4WYQ B;  1F2I G;  2KHX A;  3OML A;  2CPN A;  2RSI A;  5A6B A;  1T4L B;  1A1H A;  2M1S A;  2YRM A;  4R2R A;  2EPU A;  2Q8U A;  2EN6 A;  4Q28 A;  2EMI A;  4GKK E;  2LJH A;  2V83 A;  4JI3 E;  2YTE A;  1T4O A;  2UXC E;  4JI2 E;  2YT4 A;  2ODR C;  2J7J A;  4WXC A;  2L2K B;  4DR3 E;  2EM7 A;  4LFC E;  4DUZ E;  1A1J A;  2HC5 A;  4LF7 E;  2EP3 A;  5AC5 A;  3KWR A;  2EN1 A;  5CFF E;  2EOJ A;  2BB8 A;  2MKD A;  4R2A A;  3C6K A;  2EN8 A;  1NCS A;  5A6A A;  4X66 E;  1P47 A;  1SR9 A;  2EMX A;  4TUI A;  2I13 A;  3LLH A;  1L4S A;  1JK2 A;  2IHR 1;  1YPN A;  4LF6 E;  3IWB A;  4WFT A;  5AC4 A;  1HR0 E;  3F6G A;  3KZY A;  4F9A B;  3THO B;  4HTG A;  2EMG A;  2EQ1 A;  1ZBQ A;  4DV1 E;  4X65 E;  3HTX A;  2M4I A;  4YHH E;  2NUF A;  4N4R B;  3MSW A;  1XNQ E;  3HPZ A;  1YSA C;  2M9A A;  1WXR A;  1J5E E;  1GTK A;  2E72 A;  3DF6 A;  1YUJ A;  2ELZ A;  1RC7 A;  2UXB E;  2EOY A;  2PRT A;  5LL6 R;  4DR2 E;  2E5L E;  1UN6 B;  2EPX A;  3MHS C;  4JI1 E;  1IBM E;  4M2Z A;  4ZYE A;  1YUI A;  2M7Q A;  2DLQ A;  2EPO A;  1X6H A;  4DV0 E;  2N3G A;  4WSG A;  3C6M A;  4GEQ B;  1X49 A;  2YTF A;  1YYO A;  2EZ6 A;  1MEY C;  5AAS A;  4NHR A;  1A1I A;  3TQM A;  1HNZ E;  1UBD C;  2ENA A;  3HXL A;  1YYW A;  4KHP E;  1XNR E;  2EOX A;  4R2S A;  4L8N A;  4AQY E;  2VF1 A;  5KL2 A;  4LFB E;  3QG5 C;  3IWC A;  1HNX E;  3EQ1 A;  3L00 A;  2L3C A;  4DV6 E;  4LU9 A;  1FJG E;  5KL5 A;  1KJK A;  1GQE A;  2YTO A;  3C4T A;  2EMY A;  4F6M A;  2HHH E;  4ZYH A;  4MLQ A;  1A1L A;  4WPY A;  2JPA A;  2L8T A;  2WZO A;  3J81 C;  3J80 C;  2EMF A;  3EPJ A;  4R2C A;  3BBG A;  2B9D A;  4JI8 E;  4B3T E;  1IBL E;  2A25 A;  2YTP A;  1X48 A;  4DV5 E;  2EPC A;  2EL6 A;  3EPH A;  2ENH A;  4WSP A;  2EMA A;  2EOM A;  1AAY A;  1TN9 A;  1FKA E;  2MC6 A;  2JOX A;  4F9C B;  2L2M A;  2F8B A;  1GZ6 A;  2L6M A;  3C4B A;  1AH5 A;  3JAM C;  2EMW A;  2FTX B;  2VQF E;  2RQL A;  1X5W A;  5TSE A;  1PKP A;  4KWY A;  2EOS A;  4ZYD A;  2GPI A;  3IWD A;  5AE2 A;  2EM9 A;  3ADI A;  1PJQ A;  3EPL A;  4NXM E;  2UUA E;  2JR1 A;  1A1G A;  1A1F A;  2EML A;  2MDG A;  4L5N C;  1IBK E;  1WJP A;  2JYA A;  4DV4 E;  3H09 A;  3VYY A;  2BBG A;  1PJT A;  2EOF A;  4F54 A;  1N34 E;  1WHQ A;  2G7H A;  1KYQ A;  2ADR A;  1I94 E;  2NUG A;  1IQO A;  4BC7 A;  1EH8 A;  2EE8 A;  2EJ4 A;  4TUG A;  2EMB A;  1QNT A;  2H36 X;  4MLV A;  2EMZ A;  4JV5 E;  2EOR A;  4RH8 A;  2LO3 A;  5KL3 A;  4YY3 E;  1DQ3 A;  2EM2 A;  3M99 B;  5LMN E;  2MC5 A;  4DUY E;  4M9V C;  2JWO A;  1BBO A;  2JP9 A;  2YSO A;  1O0W A;  3T1Y E;  2DIX A;  2EM6 A;  2ODR D;  1UIL A;  2ENC A;  2RS7 A;  3UK3 C;  4OX9 E;  2NAB A;  4JI7 E;  1YZ9 A;  2HJJ A;  2LJU A;  1EH6 A;  4JI6 E;  4JI4 E;  3HQ1 A;  1IQS A;  2V88 A;  2CTD A;  2EPK X;  1JK1 A;  2F4V E;  2EMH A;  2EPN A;  3BF2 A;  2GLI A;  5IT9 C;  3VYX A;  4BCA A;  5T6J A;  2EN3 A;  2YSP A;  2DLK A;  2LBS B;  4M30 A;  4ZYG A;  4R2D A;  2B3T B;  1A1K A;  1HNW E;  1N36 E;  2EL4 A;  4O4K A;  4X64 E;  4DR4 E;  2YTQ A;  3THN A;  1G2F C;  4M0V A;  2FGG A;  1NEI A;  2JXP A;  1N33 E;  1T4N A;  2DMI A;  4DMI A;  2VQE E;  4KZS A;  1ZAA C;  4LTY A;  4HEI A;  2EOO A;  3FIG A;  2EN7 A;  2L92 A;  4P7D A;  4DKK A;  5A6K A;  1X6F A;  1DGC A;  4FK5 C;  5IXM B;  3DJW A;  5KL7 A;  1X3C A;  2YU5 A;  4BHC A;  4F6N A;  2EPR A;  2WBU A;  2YU8 A;  2KOU A;  4R2Q A;  4R03 A;  5AE3 A;  2YTI A;  4BC9 A;  2GHF A;  1LLM C;  2D9H A;  2ELY A;  2EOQ A;  5A6B D;  4GZN C;  4WX9 A;  4X9J A;  2EPA A;  3JTZ A;  5A2Q C;  2FV4 B;  3ADG A;  1ZBT A;  2EQ3 A;  2YRH A;  1RMD A;  3ADL A;  4BBY A;  2LT7 A;  2LTR A;  2L2N A;  2YTD A;  2EPZ A;  3LML A;  1EKZ A;  1J26 A;  2RTX A;  1B69 A;  1YYK A;  4Q35 B;  3J7A G;  4DR1 E;  3ZOQ B;  2RS6 A;  4NXN E;  2UXD E;  1UHZ A;  2LE2 A;  5A6J A;  2VE7 C;  2JY9 A;  5KL6 A;  3AUZ A;  4I8O A;  5IWA E;  2EM4 A;  4F2J C;  2EMK A;  4JI0 E;  1T39 A;  1QU6 A;  1N32 E;  1BBG A;  4OOG C;  1X47 A;  4BHB A;  1XMQ E;  3AV0 A;  5KL4 A;  4LF9 E;  2K4V A;  4DV3 E;  2YZT A;  4LF8 E;  3JU0 A;  1TF3 A;  3BGH A;  4B3S E;  1WRJ A;  3KZZ A; 
#chains in the Genus database with same CATH homology
 2MDR A;  2L33 A;  2UUC E;  4GEQ B;  1O0W A;  5F3W A;  1X49 A;  2V87 A;  2LTS A;  2NA2 A;  3T1Y E;  2DIX A;  2LUQ A;  2ODR D;  1YYO A;  2EZ6 A;  1UIL A;  2RS7 A;  5AAS A;  4OX9 E;  5FLX C;  1HNZ E;  3HXL A;  2JVA A;  1YYW A;  4BMJ A;  4JI7 E;  4X8W A;  5BR8 E;  1XNR E;  1YZ9 A;  2LMZ A;  4KHP E;  3OTO E;  2KON A;  4GKJ E;  2V89 A;  4L8N A;  4AQY E;  4P78 A;  2VF1 A;  4X62 E;  4DV7 E;  4R8O A;  4JI4 E;  4JI6 E;  3HQ1 A;  4LFB E;  2L3J A;  3IWC A;  2B7T A;  3T1H E;  1HNX E;  2V88 A;  4WYQ B;  2L3C A;  2KHX A;  3OML A;  4LFA E;  2CPN A;  4DV6 E;  2F4V E;  4J8Z A;  4LU9 A;  1T4L B;  1FJG E;  2M1S A;  5IT9 C;  3VYX A;  1GQE A;  4BCA A;  5T6J A;  3C4T A;  5DNY A;  4Q28 A;  2N3H A;  4DR7 E;  2LBS B;  2HHH E;  4M30 A;  4GKK E;  4JYA E;  2B3T B;  2LJH A;  2V83 A;  1N36 E;  4JI3 E;  1T4O A;  4WPY A;  1HNW E;  2UXC E;  2L8T A;  4JI2 E;  2YT4 A;  2WZO A;  2ODR C;  4X64 E;  3J81 C;  3J80 C;  1XMO E;  4M0V A;  1STU A;  2FGG A;  4DR6 E;  2DMY A;  4F9B B;  2B9D A;  4JI8 E;  2L2K B;  4B3T E;  4DR3 E;  1T4N A;  1N33 E;  1IBL E;  4DMI A;  4LFC E;  2VQE E;  4BS9 A;  4DUZ E;  4KZS A;  4LTY A;  3RMP A;  4LF7 E;  1X48 A;  3FIG A;  2L92 A;  4DKK A;  4P7D A;  4DV5 E;  3KWR A;  2UXD E;  5CFF E;  1RQ0 A;  1WHN A;  2NUE A;  3DJW A;  4WSP A;  4DR5 E;  5LMU E;  3HPS A;  1FKA E;  4K0K E;  3K6Q A;  2KOU A;  5ADZ A;  4R03 A;  2MC6 A;  2LUP B;  5AE3 A;  2JOX A;  4BC9 A;  4F9C B;  2L2M A;  2E1M A;  2ZM6 E;  2DSY A;  4B3R E;  2F8B A;  3VK6 A;  4X66 E;  1SR9 A;  4TUI A;  3LLH A;  1GZ6 A;  2L6M A;  3C4B A;  2IHR 1;  1DI2 A;  4NXN E;  3JTZ A;  3JAM C;  2B7V A;  2FTX B;  3F6H A;  5A2Q C;  2FV4 B;  3ADG A;  2VQF E;  1ZBT A;  3IWB A;  2UUB E;  1PKP A;  3ADJ A;  4LF6 E;  4WFT A;  3IWD A;  5AE2 A;  2DB2 A;  2JOB A;  1HR0 E;  3F6G A;  4B3M E;  3ADI A;  4F9A B;  3ADL A;  4BBY A;  4NXM E;  4DR4 E;  3J7Y p;  2UUA E;  2JR1 A;  2LRS A;  2LTR A;  2L2N A;  4L5N C;  1XNQ E;  1IBK E;  3LML A;  1EKZ A;  1ZBQ A;  4DV1 E;  4DV4 E;  1J26 A;  2RTX A;  3H09 A;  4X65 E;  3VYY A;  3HTX A;  2V8Q B;  2M4I A;  2UU9 E;  4YHH E;  2NUF A;  1YYK A;  3J7A G;  3MSW A;  4DR1 E;  3HPZ A;  4LF5 E;  2EWL A;  4F54 A;  3ZOQ B;  2RS6 A;  1WXR A;  1N34 E;  1WHQ A;  1UHZ A;  2LE2 A;  2G7H A;  1J5E E;  1I94 E;  2VE7 C;  3DF6 A;  4LF4 E;  2JY9 A;  2NUG A;  1RC7 A;  2UXB E;  3AUZ A;  2RSM A;  4I8O A;  5IWA E;  4BC7 A;  2V86 A;  5LL6 R;  3P1X A;  4JI0 E;  4DR2 E;  4TUG A;  1QU6 A;  2H36 X;  2E5L E;  1N32 E;  4OOG C;  2V85 A;  4JV5 E;  4JI5 E;  4JI1 E;  5AE1 A;  1X47 A;  4DV2 E;  1IBM E;  4M2Z A;  1XMQ E;  3AV0 A;  4LF9 E;  2K4V A;  2M7Q A;  2YZT A;  4YY3 E;  4DV3 E;  1DQ3 A;  4LF8 E;  3JU0 A;  5LMN E;  4B3S E;  2MC5 A;  4DUY E;  2JWO A;  4DV0 E;  2N3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...