2V89A

Crystal structure of rag2-phd finger in complex with h3k4me3 peptide at 1.1a resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
78
structure length
78
Chain Sequence
SPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQIARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Rag2 Phd Finger Couples Histone H3 Lysine 4 Trimethylation with V(D)J Recombination.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords VDJ RECOMBINATION-ACTIVATING PROTEIN 2
total genus 13
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.290 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2v89A01
2V89A 2V86A 2V87A 2V85A 2JWOA 2V83A 2V88A
chains in the Genus database with same CATH superfamily
2J7JA 2UUCE 2V8QB 3LLHA 4O5GA 3TQMA 1HNWE 4DUYE 4MLVA 3IWDA 3MSWA 2YTGA 2N8XA 2YTEA 2EWLA 2VE7C 2ADRA 5ADZA 4JI1E 3J7Yp 2DGCA 4DV6E 2EOHA 2EORA 4JI8E 2LCEA 3BGHA 2JY9A 1YSAC 3HTXA 1IBKE 4O24A 4N4RB 2EN8A 2EMHA 1NEIA 2JPAA 1HR0E 2DLKA 4DV5E 4HTGA 4Q35B 4R8OA 3VYXA 4WXDA 1N36E 2KONA 3MHHC 1PDAA 3BF2A 1X6HA 2YTFA 3ZOQB 5KL3A 2EQ3A 4F54A 2RS7A 2FGGA 1WXRA 1LLMC 4WXCA 2V87A 2HJJA 4R03A 4ZYDA 2UXDE 2K7IA 2EMWA 2LUPB 2H36X 2CT1A 4LF8E 4DV4E 1WJPA 4JI5E 1QU6A 4M30A 2EMCA 3THNA 3EPHA 4I8OA 4F6NA 2LV2A 2K4VA 3T1YE 4Q28A 1UBDC 1STUA 4B3TE 4B3RE 2L2MA 5IWAE 1IBLE 2B7TA 3JAMC 3DJWA 4DR1E 5IV8B 3AUZA 4LFCE 2G7HA 2EMXA 5KL2A 2LTRA 2JVAA 2EPZA 4OX9E 2V89A 2EN6A 3OMLA 2EJ4A 4IJDA 5AASA 2L8TA 2B9DA 2RS6A 3JTZA 2MC5A 3H09A 3L00A 4JYAE 3J7AG 2L3CA 2VQFE 3J81C 4RHBB 1X5WA 3K6QA 4LF5E 4LFBE 2YTIA 1GTKA 2EM9A 4BCAA 4F9BB 4WFTA 2M9AA 2ZM6E 3P1XA 2GPIA 1NCSA 3C4BA 2EMGA 2UXCE 4DR6E 1ZAAC 5FLXC 2EPLX 2YU5A 3LMLA 3VYYA 4O43A 3DF6A 1RMDA 2EPNA 4LF6E 4P7DA 4X65E 1YYKA 2WZOA 2UUAE 1XNRE 1SFEA 2EOJA 2FV4B 5LLQA 4JI3E 4F6MA 2EOZA 1ZU1A 4L5NC 2WBUA 1IMUA 5CFFE 2BB8A 1DQ3A 2EPPA 1XMQE 2LE2A 2YTPA 2EPCA 2EM3A 4GKJE 2LT7A 4J8ZA 2YRMA 3HXLA 1A1KA 2EN3A 4OOGC 1PJQA 2YZTA 4TUGA 1N34E 2JP9A 5DNYA 2E72A 2BBGA 2CPNA 3KWRA 2B3TB 2ELZA 1T39A 1XNQE 5TSEA 2RQLA 2E1MA 1B69A 4F9AB 2EMAA 1J26A 2EMIA 2YWQA 5LMNE 3EPKA 2NUGA 2R1FA 4X66E 4F2JC 4BBYA 3J80C 2YRKA 2VF1A 4JI2E 2EOMA 3ADJA 4WSPA 4DUZE 2WCC3 2LUQA 1J5EE 3QG5C 3F6GA 2EM2A 5A69A 4BC9A 2GHFA 4DR5E 2EOYA 1N3GA 2IHR1 1N33E 2HC5A 2EMBA 5A6BD 3KZYA 1A1FA 1MGTA 2MDRA 4BHBA 2L3JA 2EPAA 4GZNC 1YYWA 2DLQA 3RMPA 2RTXA 2EOQA 1T4OA 5KL4A 5T6JA 1QNTA 4LTYA 3EPJA 1YYOA 4LF7E 1UHZA 1DGCA 2VRDA 4R2AA 2EE8A 2EOIA 1Z1BA 1RC7A 1HNZE 1EH7A 2MC6A 3EPLA 4WSGA 4NXME 2ODRD 1KYQA 2MKDA 4NXNE 2DB2A 1YPNA 4R2PA 2R76A 1GQEA 5IXMB 4GKKE 4YHHE 4ZYEA 1IQOA 4MLQA 3MHSC 3ADLA 4LFAE 2NUEA 2UUBE 4DR3E 3BBGA 2UXBE 5LL6R 2KHXA 4BMJA 3VHTB 3F6HA 1I94E 4FK5C 1TF3A 2LJUA 4NHRA 2DIXA 2EM6A 4DV7E 1YFHA 1T4NA 1JK1A 1PJTA 4LF4E 1UILA 3HPSA 5AE1A 2ELYA 2V88A 1YZ9A 1X6FA 2DSYA 1F2IG 2WBSA 1XMOE 5A6KA 4JI0E 2EM8A 5KL6A 1YUJA 4DV1E 1SR9A 4IS1C 3IWCA 2EM5A 2EL5A 1BBOA 2NUFA 4R2QA 1BBGA 5IT9C 2YU8A 2EPKX 4X8WA 4YY3E 2EL4A 1L4SA 2YSPA 2EOXA 5F3WA 2EMZA 4WYQB 2M7QA 1WRJA 3VK6A 2EMKA 1BB8A 4DV2E 1IBME 4F9CB 4LU9A 4DKKA 2EPUA 3OTOE 2WBTA 2E5LE 1A1JA 2YTQA 4HEIA 1PJSA 5A6AA 4KWYA 1A1LA 2F4VE 2EQ1A 2YT4A 2L6MA 4R2SA 1GZ6A 4AQYE 2JXPA 1X48A 2PRTA 1ZBTA 4BS9A 1G2FC 2EZ6A 3EQ1A 2JWOA 2EN7A 1PKPA 1WHQA 5BR8E 1N32E 2N3GA 2EMYA 2LTSA 5AE3A 4DR4E 2ENCA 2FTXB 5AC5A 4WX9A 2LRSA 3HQ1A 3HPZA 1YUIA 4R2RA 3JU0A 1RQ0A 2N3HA 2L2NA 2YTOA 5LMUE 2I9IA 2GLIA 4K0KE 2A25A 2YPNA 4JI4E 1EKZA 2ODRC 2EQ0A 2KOUA 4JV5E 2UU9E 2LO3A 2NA2A 2DMIA 2EP3A 2JOBA 5KL7A 2V85A 1FJGE 4KZSA 2EOFA 2EPMX 3T1HE 2ENHA 2YTDA 3C6KA 2CSHA 2EPXA 4DR7E 4B3ME 2YTNA 4X9JA 1TN9A 2YRHA 4P78A 2DMYA 2EM0A 1A1HA 1EH8A 2D9HA 2M1SA 2EM7A 2MKNA 1TF6A 4L8NA 2LVHA 1EH6A 4ZYGA 4NZVA 1X49A 1HNXE 4M2ZA 1ZBQA 2EPOA 3C6MA 1AAYA 2EL6A 4DV3E 1X47A 2LBSB 1O0WA 2YSOA 2LJHA 2EN4A 1JK2A 4B3SE 2EN1A 2V83A 3M99B 3ADGA 3ADIA 4R2EA 3UK3C 2RPCA 5AE2A 2MDGA 2RSIA 2LMZA 2B7VA 4WPYA 1T38A 1T4LB 4M9VC 2Q8UA 3KZZA 2YTJA 2CTDA 2L33A 2L92A 2RSMA 1X6EA 4DR2E 4DV0E 2I13A 4BC7A 4JI7E 2F8BA 5KL5A 1DI2A 1ZR9A 4R2CA 2L2KB 1FKAE 2EN2A 4JI6E 1P47A 4TUIA 2EOEA 3AV0A 5AC4A 3IWBA 2VQEE 1MEYC 3C4TA 2EOSA 3FIGA 2EMFA 1G2DC 1IQSA 2HHHE 1UN6B 4ZYHA 4X62E 4RH8A 1AH5A 2EMLA 2EOOA 5A6BA 4X64E 4KHPE 4O4KA 5A6JA 2NABA 2JR1A 2M4IA 5A2QC 3ECRA 2EPRA 1X3CA 1WHNA 3THOB 4DMIA 3BIDA 1A1GA 4LF9E 4M0VA 4R2DA 2HGHA 2ENAA 2JYAA 2EM4A 1A1IA 4BHCA 1KJKA 2V86A 2JOXA 4GEQB 2DRPA
chains in the Genus database with same CATH topology
3J81C 4NXNE 2JOBA 2DB2A 3K6QA 4LF5E 4LFBE 2UUCE 2V85A 1GQEA 1FJGE 2V8QB 3LLHA 4KZSA 4GKKE 4YHHE 3T1HE 4BCAA 1HNWE 4F9BB 4DUYE 3ADLA 4WFTA 3IWDA 4LFAE 2NUEA 4DR7E 4B3ME 3MSWA 2UUBE 4DR3E 2ZM6E 3P1XA 2EWLA 2UXBE 5LL6R 2KHXA 3C4BA 4BMJA 4P78A 2DMYA 2VE7C 2UXCE 5ADZA 4JI1E 4DR6E 3F6HA 5FLXC 3J7Yp 2M1SA 1I94E 3LMLA 3VYYA 4DV6E 4LF6E 3DF6A 4JI8E 2DIXA 4P7DA 4L8NA 4DV7E 4LF4E 1T4NA 2JY9A 1UILA 3HPSA 4X65E 1YYKA 3HTXA 2WZOA 5AE1A 1IBKE 2UUAE 1X49A 2V88A 1HNXE 1XNRE 1YZ9A 2FV4B 4M2ZA 1ZBQA 4JI3E 2DSYA 4DV3E 1X47A 2LBSB 4L5NC 1O0WA 1HR0E 5CFFE 1XMOE 2LJHA 4B3SE 4JI0E 4DV5E 4DV1E 1SR9A 1DQ3A 3IWCA 1XMQE 4R8OA 3VYXA 2LE2A 2V83A 2NUFA 1N36E 3ADGA 3ADIA 5IT9C 2KONA 4X8WA 4YY3E 4GKJE 4J8ZA 3HXLA 3ZOQB 4F54A 4OOGC 5AE2A 2RS7A 2FGGA 1WXRA 2LMZA 2B7VA 2YZTA 4WPYA 4WYQB 4TUGA 5F3WA 1T4LB 1N34E 2M7QA 5DNYA 2V87A 2L33A 2CPNA 3KWRA 2B3TB 2L92A 2RSMA 3VK6A 4R03A 4DR2E 1XNQE 2UXDE 4DV2E 2E1MA 4DV0E 2LUPB 4F9AB 1IBME 4BC7A 2H36X 4JI7E 4LU9A 4F9CB 2F8BA 5LMNE 4DKKA 4LF8E 4DV4E 1J26A 1DI2A 2NUGA 4X66E 4JI5E 1QU6A 4M30A 4BBYA 3J80C 2L2KB 3OTOE 2VF1A 4I8OA 1FKAE 4JI2E 4JI6E 2E5LE 4TUIA 2K4VA 3ADJA 4WSPA 4DUZE 3AV0A 2LUQA 3T1YE 1J5EE 3IWBA 4Q28A 2VQEE 1STUA 3F6GA 4B3TE 2F4VE 2YT4A 2L6MA 1GZ6A 3C4TA 3FIGA 4BC9A 4AQYE 4DR5E 4B3RE 1X48A 2L2MA 1ZBTA 2HHHE 4BS9A 5IWAE 1IBLE 2B7TA 2EZ6A 4X62E 2JWOA 2IHR1 3JAMC 3DJWA 1N33E 4DR1E 1PKPA 3AUZA 1WHQA 2G7HA 4X64E 5BR8E 4LFCE 2N3GA 1N32E 4KHPE 2LTSA 5AE3A 4DR4E 2LTRA 2MDRA 2FTXB 2JR1A 2L3JA 2JVAA 2M4IA 1YYWA 5A2QC 4OX9E 2LRSA 3HQ1A 2V89A 1WHNA 3RMPA 2RTXA 4DMIA 1T4OA 3HPZA 3OMLA 5T6JA 4LTYA 3JU0A 1RQ0A 2L8TA 2B9DA 2N3HA 2L2NA 2RS6A 4M0VA 5AASA 1YYOA 5LMUE 1UHZA 4LF7E 4LF9E 4K0KE 3JTZA 2MC5A 3H09A 4JI4E 4JYAE 1EKZA 2ODRC 1RC7A 2KOUA 4JV5E 1HNZE 3J7AG 2MC6A 2UU9E 2V86A 2NA2A 2JOXA 2L3CA 2VQFE 4NXME 4GEQB 2ODRD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V89 A;  2V86 A;  2V87 A;  2V85 A;  2JWO A;  2V83 A;  2V88 A; 
#chains in the Genus database with same CATH topology
 2J7J A;  2UUC E;  2V8Q B;  3LLH A;  4O5G A;  3TQM A;  1HNW E;  4DUY E;  4MLV A;  3IWD A;  3MSW A;  2YTG A;  2N8X A;  2YTE A;  2EWL A;  2VE7 C;  2ADR A;  5ADZ A;  4JI1 E;  3J7Y p;  2DGC A;  4DV6 E;  2EOH A;  2EOR A;  4JI8 E;  2LCE A;  3BGH A;  2JY9 A;  1YSA C;  3HTX A;  1IBK E;  4O24 A;  4N4R B;  2EN8 A;  2EMH A;  1NEI A;  2JPA A;  1HR0 E;  2DLK A;  4DV5 E;  4HTG A;  4Q35 B;  4R8O A;  3VYX A;  4WXD A;  1N36 E;  2KON A;  3MHH C;  1PDA A;  3BF2 A;  1X6H A;  2YTF A;  3ZOQ B;  5KL3 A;  2EQ3 A;  4F54 A;  2RS7 A;  2FGG A;  1WXR A;  1LLM C;  4WXC A;  2V87 A;  2HJJ A;  4R03 A;  4ZYD A;  2UXD E;  2K7I A;  2EMW A;  2LUP B;  2H36 X;  2CT1 A;  4LF8 E;  4DV4 E;  1WJP A;  4JI5 E;  1QU6 A;  4M30 A;  2EMC A;  3THN A;  3EPH A;  4I8O A;  4F6N A;  2LV2 A;  2K4V A;  3T1Y E;  4Q28 A;  1UBD C;  1STU A;  4B3T E;  4B3R E;  2L2M A;  5IWA E;  1IBL E;  2B7T A;  3JAM C;  3DJW A;  4DR1 E;  5IV8 B;  3AUZ A;  4LFC E;  2G7H A;  2EMX A;  5KL2 A;  2LTR A;  2JVA A;  2EPZ A;  4OX9 E;  2V89 A;  2EN6 A;  3OML A;  2EJ4 A;  4IJD A;  5AAS A;  2L8T A;  2B9D A;  2RS6 A;  3JTZ A;  2MC5 A;  3H09 A;  3L00 A;  4JYA E;  3J7A G;  2L3C A;  2VQF E;  3J81 C;  4RHB B;  1X5W A;  3K6Q A;  4LF5 E;  4LFB E;  2YTI A;  1GTK A;  2EM9 A;  4BCA A;  4F9B B;  4WFT A;  2M9A A;  2ZM6 E;  3P1X A;  2GPI A;  1NCS A;  3C4B A;  2EMG A;  2UXC E;  4DR6 E;  1ZAA C;  5FLX C;  2EPL X;  2YU5 A;  3LML A;  3VYY A;  4O43 A;  3DF6 A;  1RMD A;  2EPN A;  4LF6 E;  4P7D A;  4X65 E;  1YYK A;  2WZO A;  2UUA E;  1XNR E;  1SFE A;  2EOJ A;  2FV4 B;  5LLQ A;  4JI3 E;  4F6M A;  2EOZ A;  1ZU1 A;  4L5N C;  2WBU A;  1IMU A;  5CFF E;  2BB8 A;  1DQ3 A;  2EPP A;  1XMQ E;  2LE2 A;  2YTP A;  2EPC A;  2EM3 A;  4GKJ E;  2LT7 A;  4J8Z A;  2YRM A;  3HXL A;  1A1K A;  2EN3 A;  4OOG C;  1PJQ A;  2YZT A;  4TUG A;  1N34 E;  2JP9 A;  5DNY A;  2E72 A;  2BBG A;  2CPN A;  3KWR A;  2B3T B;  2ELZ A;  1T39 A;  1XNQ E;  5TSE A;  2RQL A;  2E1M A;  1B69 A;  4F9A B;  2EMA A;  1J26 A;  2EMI A;  2YWQ A;  5LMN E;  3EPK A;  2NUG A;  2R1F A;  4X66 E;  4F2J C;  4BBY A;  3J80 C;  2YRK A;  2VF1 A;  4JI2 E;  2EOM A;  3ADJ A;  4WSP A;  4DUZ E;  2WCC 3;  2LUQ A;  1J5E E;  3QG5 C;  3F6G A;  2EM2 A;  5A69 A;  4BC9 A;  2GHF A;  4DR5 E;  2EOY A;  1N3G A;  2IHR 1;  1N33 E;  2HC5 A;  2EMB A;  5A6B D;  3KZY A;  1A1F A;  1MGT A;  2MDR A;  4BHB A;  2L3J A;  2EPA A;  4GZN C;  1YYW A;  2DLQ A;  3RMP A;  2RTX A;  2EOQ A;  1T4O A;  5KL4 A;  5T6J A;  1QNT A;  4LTY A;  3EPJ A;  1YYO A;  4LF7 E;  1UHZ A;  1DGC A;  2VRD A;  4R2A A;  2EE8 A;  2EOI A;  1Z1B A;  1RC7 A;  1HNZ E;  1EH7 A;  2MC6 A;  3EPL A;  4WSG A;  4NXM E;  2ODR D;  1KYQ A;  2MKD A;  4NXN E;  2DB2 A;  1YPN A;  4R2P A;  2R76 A;  1GQE A;  5IXM B;  4GKK E;  4YHH E;  4ZYE A;  1IQO A;  4MLQ A;  3MHS C;  3ADL A;  4LFA E;  2NUE A;  2UUB E;  4DR3 E;  3BBG A;  2UXB E;  5LL6 R;  2KHX A;  4BMJ A;  3VHT B;  3F6H A;  1I94 E;  4FK5 C;  1TF3 A;  2LJU A;  4NHR A;  2DIX A;  2EM6 A;  4DV7 E;  1YFH A;  1T4N A;  1JK1 A;  1PJT A;  4LF4 E;  1UIL A;  3HPS A;  5AE1 A;  2ELY A;  2V88 A;  1YZ9 A;  1X6F A;  2DSY A;  1F2I G;  2WBS A;  1XMO E;  5A6K A;  4JI0 E;  2EM8 A;  5KL6 A;  1YUJ A;  4DV1 E;  1SR9 A;  4IS1 C;  3IWC A;  2EM5 A;  2EL5 A;  1BBO A;  2NUF A;  4R2Q A;  1BBG A;  5IT9 C;  2YU8 A;  2EPK X;  4X8W A;  4YY3 E;  2EL4 A;  1L4S A;  2YSP A;  2EOX A;  5F3W A;  2EMZ A;  4WYQ B;  2M7Q A;  1WRJ A;  3VK6 A;  2EMK A;  1BB8 A;  4DV2 E;  1IBM E;  4F9C B;  4LU9 A;  4DKK A;  2EPU A;  3OTO E;  2WBT A;  2E5L E;  1A1J A;  2YTQ A;  4HEI A;  1PJS A;  5A6A A;  4KWY A;  1A1L A;  2F4V E;  2EQ1 A;  2YT4 A;  2L6M A;  4R2S A;  1GZ6 A;  4AQY E;  2JXP A;  1X48 A;  2PRT A;  1ZBT A;  4BS9 A;  1G2F C;  2EZ6 A;  3EQ1 A;  2JWO A;  2EN7 A;  1PKP A;  1WHQ A;  5BR8 E;  1N32 E;  2N3G A;  2EMY A;  2LTS A;  5AE3 A;  4DR4 E;  2ENC A;  2FTX B;  5AC5 A;  4WX9 A;  2LRS A;  3HQ1 A;  3HPZ A;  1YUI A;  4R2R A;  3JU0 A;  1RQ0 A;  2N3H A;  2L2N A;  2YTO A;  5LMU E;  2I9I A;  2GLI A;  4K0K E;  2A25 A;  2YPN A;  4JI4 E;  1EKZ A;  2ODR C;  2EQ0 A;  2KOU A;  4JV5 E;  2UU9 E;  2LO3 A;  2NA2 A;  2DMI A;  2EP3 A;  2JOB A;  5KL7 A;  2V85 A;  1FJG E;  4KZS A;  2EOF A;  2EPM X;  3T1H E;  2ENH A;  2YTD A;  3C6K A;  2CSH A;  2EPX A;  4DR7 E;  4B3M E;  2YTN A;  4X9J A;  1TN9 A;  2YRH A;  4P78 A;  2DMY A;  2EM0 A;  1A1H A;  1EH8 A;  2D9H A;  2M1S A;  2EM7 A;  2MKN A;  1TF6 A;  4L8N A;  2LVH A;  1EH6 A;  4ZYG A;  4NZV A;  1X49 A;  1HNX E;  4M2Z A;  1ZBQ A;  2EPO A;  3C6M A;  1AAY A;  2EL6 A;  4DV3 E;  1X47 A;  2LBS B;  1O0W A;  2YSO A;  2LJH A;  2EN4 A;  1JK2 A;  4B3S E;  2EN1 A;  2V83 A;  3M99 B;  3ADG A;  3ADI A;  4R2E A;  3UK3 C;  2RPC A;  5AE2 A;  2MDG A;  2RSI A;  2LMZ A;  2B7V A;  4WPY A;  1T38 A;  1T4L B;  4M9V C;  2Q8U A;  3KZZ A;  2YTJ A;  2CTD A;  2L33 A;  2L92 A;  2RSM A;  1X6E A;  4DR2 E;  4DV0 E;  2I13 A;  4BC7 A;  4JI7 E;  2F8B A;  5KL5 A;  1DI2 A;  1ZR9 A;  4R2C A;  2L2K B;  1FKA E;  2EN2 A;  4JI6 E;  1P47 A;  4TUI A;  2EOE A;  3AV0 A;  5AC4 A;  3IWB A;  2VQE E;  1MEY C;  3C4T A;  2EOS A;  3FIG A;  2EMF A;  1G2D C;  1IQS A;  2HHH E;  1UN6 B;  4ZYH A;  4X62 E;  4RH8 A;  1AH5 A;  2EML A;  2EOO A;  5A6B A;  4X64 E;  4KHP E;  4O4K A;  5A6J A;  2NAB A;  2JR1 A;  2M4I A;  5A2Q C;  3ECR A;  2EPR A;  1X3C A;  1WHN A;  3THO B;  4DMI A;  3BID A;  1A1G A;  4LF9 E;  4M0V A;  4R2D A;  2HGH A;  2ENA A;  2JYA A;  2EM4 A;  1A1I A;  4BHC A;  1KJK A;  2V86 A;  2JOX A;  4GEQ B;  2DRP A; 
#chains in the Genus database with same CATH homology
 3J81 C;  4NXN E;  2JOB A;  2DB2 A;  3K6Q A;  4LF5 E;  4LFB E;  2UUC E;  2V85 A;  1GQE A;  1FJG E;  2V8Q B;  3LLH A;  4KZS A;  4GKK E;  4YHH E;  3T1H E;  4BCA A;  1HNW E;  4F9B B;  4DUY E;  3ADL A;  4WFT A;  3IWD A;  4LFA E;  2NUE A;  4DR7 E;  4B3M E;  3MSW A;  2UUB E;  4DR3 E;  2ZM6 E;  3P1X A;  2EWL A;  2UXB E;  5LL6 R;  2KHX A;  3C4B A;  4BMJ A;  4P78 A;  2DMY A;  2VE7 C;  2UXC E;  5ADZ A;  4JI1 E;  4DR6 E;  3F6H A;  5FLX C;  3J7Y p;  2M1S A;  1I94 E;  3LML A;  3VYY A;  4DV6 E;  4LF6 E;  3DF6 A;  4JI8 E;  2DIX A;  4P7D A;  4L8N A;  4DV7 E;  4LF4 E;  1T4N A;  2JY9 A;  1UIL A;  3HPS A;  4X65 E;  1YYK A;  3HTX A;  2WZO A;  5AE1 A;  1IBK E;  2UUA E;  1X49 A;  2V88 A;  1HNX E;  1XNR E;  1YZ9 A;  2FV4 B;  4M2Z A;  1ZBQ A;  4JI3 E;  2DSY A;  4DV3 E;  1X47 A;  2LBS B;  4L5N C;  1O0W A;  1HR0 E;  5CFF E;  1XMO E;  2LJH A;  4B3S E;  4JI0 E;  4DV5 E;  4DV1 E;  1SR9 A;  1DQ3 A;  3IWC A;  1XMQ E;  4R8O A;  3VYX A;  2LE2 A;  2V83 A;  2NUF A;  1N36 E;  3ADG A;  3ADI A;  5IT9 C;  2KON A;  4X8W A;  4YY3 E;  4GKJ E;  4J8Z A;  3HXL A;  3ZOQ B;  4F54 A;  4OOG C;  5AE2 A;  2RS7 A;  2FGG A;  1WXR A;  2LMZ A;  2B7V A;  2YZT A;  4WPY A;  4WYQ B;  4TUG A;  5F3W A;  1T4L B;  1N34 E;  2M7Q A;  5DNY A;  2V87 A;  2L33 A;  2CPN A;  3KWR A;  2B3T B;  2L92 A;  2RSM A;  3VK6 A;  4R03 A;  4DR2 E;  1XNQ E;  2UXD E;  4DV2 E;  2E1M A;  4DV0 E;  2LUP B;  4F9A B;  1IBM E;  4BC7 A;  2H36 X;  4JI7 E;  4LU9 A;  4F9C B;  2F8B A;  5LMN E;  4DKK A;  4LF8 E;  4DV4 E;  1J26 A;  1DI2 A;  2NUG A;  4X66 E;  4JI5 E;  1QU6 A;  4M30 A;  4BBY A;  3J80 C;  2L2K B;  3OTO E;  2VF1 A;  4I8O A;  1FKA E;  4JI2 E;  4JI6 E;  2E5L E;  4TUI A;  2K4V A;  3ADJ A;  4WSP A;  4DUZ E;  3AV0 A;  2LUQ A;  3T1Y E;  1J5E E;  3IWB A;  4Q28 A;  2VQE E;  1STU A;  3F6G A;  4B3T E;  2F4V E;  2YT4 A;  2L6M A;  1GZ6 A;  3C4T A;  3FIG A;  4BC9 A;  4AQY E;  4DR5 E;  4B3R E;  1X48 A;  2L2M A;  1ZBT A;  2HHH E;  4BS9 A;  5IWA E;  1IBL E;  2B7T A;  2EZ6 A;  4X62 E;  2JWO A;  2IHR 1;  3JAM C;  3DJW A;  1N33 E;  4DR1 E;  1PKP A;  3AUZ A;  1WHQ A;  2G7H A;  4X64 E;  5BR8 E;  4LFC E;  2N3G A;  1N32 E;  4KHP E;  2LTS A;  5AE3 A;  4DR4 E;  2LTR A;  2MDR A;  2FTX B;  2JR1 A;  2L3J A;  2JVA A;  2M4I A;  1YYW A;  5A2Q C;  4OX9 E;  2LRS A;  3HQ1 A;  2V89 A;  1WHN A;  3RMP A;  2RTX A;  4DMI A;  1T4O A;  3HPZ A;  3OML A;  5T6J A;  4LTY A;  3JU0 A;  1RQ0 A;  2L8T A;  2B9D A;  2N3H A;  2L2N A;  2RS6 A;  4M0V A;  5AAS A;  1YYO A;  5LMU E;  1UHZ A;  4LF7 E;  4LF9 E;  4K0K E;  3JTZ A;  2MC5 A;  3H09 A;  4JI4 E;  4JYA E;  1EKZ A;  2ODR C;  1RC7 A;  2KOU A;  4JV5 E;  1HNZ E;  3J7A G;  2MC6 A;  2UU9 E;  2V86 A;  2NA2 A;  2JOX A;  2L3C A;  2VQF E;  4NXM E;  4GEQ B;  2ODR D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...