3KWRA

Crystal structure of putative rna-binding protein (np_785364.1) from lactobacillus plantarum at 1.45 a resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
83
structure length
83
Chain Sequence
EVKYPAIFRDEGTYWDVRFPDVPAAQTFGASVQVAADNAANALAIALFEQSLPPASDPQYWRLASTEFVVWITMADVQFGPGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Putative RNA-binding protein (NP_785364.1) from Lactobacillus plantarum at 1.45 A resolution
rcsb
source organism Lactobacillus plantarum
molecule tags Rna binding protein
molecule keywords Putative RNA-binding protein
total genus 16
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.250 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3kwrA00
3KWRA 2YZTA 4P78A 4P7DA 2DSYA
chains in the Genus database with same CATH superfamily
2EQ3A 1EH8A 4JI0E 3VHTB 1BB8A 4R2RA 3F6GA 4R2EA 2LUQA 4X65E 1N32E 2LO3A 2LTSA 5AC4A 4TUGA 4R2SA 4JI8E 4DMIA 2EL4A 3BBGA 4LFCE 4X64E 2YU8A 1PJTA 2EPZA 4WSPA 2VQFE 2YTIA 1YYWA 1N3GA 1SR9A 3ADGA 2CT1A 2JVAA 2E5LE 2EL5A 4R2PA 1DI2A 1G2FC 1B69A 2BB8A 2N8XA 2EPCA 4X62E 4DV7E 4KHPE 2DMIA 2UUBE 4DKKA 1AAYA 2LBSB 2EOZA 2HGHA 2YSOA 3HQ1A 3C4BA 2M1SA 2JR1A 2FTXB 1EH7A 2YTNA 3RMPA 2EMBA 4JYAE 5IT9C 4ZYHA 3JU0A 2RS6A 4LTYA 2EQ1A 4DV5E 1ZR9A 2EMYA 2L8TA 2NA2A 3J81C 2K4VA 2K7IA 5AE2A 3EPKA 4HEIA 2M4IA 2YTFA 2L2MA 2UUAE 2DLKA 4WYQB 2B7TA 3VYXA 2ODRC 4R8OA 2GHFA 3LLHA 2EPLX 5LLQA 4WX9A 2B7VA 2EPKX 4JI2E 5CFFE 2EOMA 2MDGA 3C6KA 2PRTA 1RMDA 4R2DA 4IJDA 1FKAE 3IWBA 2E72A 1ZU1A 5F3WA 4BC7A 4L8NA 5KL3A 4P7DA 1Z1BA 2DIXA 2RS7A 2DGCA 2YTDA 1WRJA 1X6FA 2G7HA 1G2DC 2DSYA 2LVHA 4O24A 2EM2A 1XNQE 4F6MA 1UILA 4DR5E 4I8OA 2JXPA 2LV2A 3ADLA 2EPAA 2FV4B 5BR8E 3J7Yp 4DR4E 5KL7A 1N34E 2VQEE 2EPNA 5KL2A 2JWOA 5LMNE 2YTJA 2L3JA 1T39A 1X3CA 2EORA 1AH5A 2CPNA 2EJ4A 1MEYC 1X5WA 3ECRA 2EMHA 2YTPA 1BBOA 1WJPA 5A6AA 3HPSA 2EM5A 3IWCA 2GPIA 4LU9A 3ZOQB 1A1FA 2V86A 2UXCE 2L6MA 4BCAA 5AE1A 3HXLA 2EN4A 2RSIA 1YUIA 4Q28A 3BF2A 2ELYA 3OMLA 4X66E 5T6JA 4M2ZA 1YFHA 4DUYE 2LUPB 1XMQE 4DR3E 4LF8E 1ZBQA 2DMYA 3QG5C 2LRSA 3MHHC 4WFTA 2MKDA 4K0KE 2RPCA 2YWQA 2B3TB 2EPOA 5IXMB 1RQ0A 1DGCA 1YPNA 1I94E 1L4SA 4JI4E 2EP3A 2F4VE 3M99B 2EMGA 4F9BB 4JI6E 4ZYDA 1NCSA 2YTOA 3EPLA 4LF4E 3KZYA 2YU5A 1PJSA 2EOHA 2EZ6A 2EQ0A 2V85A 3F6HA 4L5NC 4MLVA 2UU9E 2B9DA 3J80C 4J8ZA 4RH8A 2HC5A 4NXNE 1XNRE 4AQYE 2MC5A 3JAMC 3C6MA 3T1HE 2MKNA 1PDAA 1GTKA 3J7AG 2ELZA 2UXBE 2HJJA 3ADJA 2YTQA 2BBGA 1IBLE 2GLIA 4LFBE 1HNWE 2MC6A 3AUZA 4FK5C 5KL6A 3THNA 1UN6B 4F6NA 2JOBA 5A6KA 1GZ6A 4GKKE 1T4LB 3UK3C 2EM7A 2EMFA 2VF1A 2YZTA 2DB2A 2ADRA 2EOEA 1T4NA 1IBME 3T1YE 1WHQA 3VK6A 2I9IA 2WZOA 3LMLA 2N3HA 2EN6A 1FJGE 4F9AB 3HPZA 2NUEA 1X6EA 4YY3E 1F2IG 2LJUA 1KYQA 2EPRA 5AC5A 3EPJA 2JOXA 2F8BA 2KONA 2VRDA 4DV2E 1IBKE 1WXRA 2EN1A 2EMKA 3JTZA 5AASA 2EMZA 4DV6E 2UUCE 2EOSA 2M9AA 2EPPA 1YUJA 5IWAE 4O4KA 4DV1E 2ODRD 4TUIA 4F9CB 1TF6A 2KOUA 2V88A 1NEIA 5A6JA 4HTGA 2D9HA 1T4OA 3KWRA 3P1XA 5A69A 2EMCA 1X47A 4R2CA 4KZSA 2EL6A 2LTRA 4O43A 4DR2E 4X8WA 4DR1E 1HR0E 2EMWA 4DR6E 4YHHE 2R76A 4WXCA 2LJHA 2ENCA 5A6BA 1LLMC 3MSWA 4B3TE 1PJQA 4RHBB 4WPYA 4LF5E 1IMUA 1J5EE 4N4RB 4WSGA 1UBDC 1N33E 2EM9A 4DV3E 1P47A 1A1IA 2MDRA 2V8QB 2R1FA 2YTGA 2YT4A 4ZYEA 5LMUE 4GZNC 1HNZE 2V83A 4NZVA 5IV8B 4IS1C 2EM8A 4R2AA 3KZZA 1JK2A 1ZBTA 1DQ3A 2ENHA 2J7JA 1A1GA 1IQSA 1RC7A 2NUGA 1A1JA 2EM6A 2EMAA 1A1KA 2L2NA 2EMLA 2EOJA 3FIGA 4BBYA 2FGGA 5A6BD 4OX9E 1N36E 4M9VC 5ADZA 2Q8UA 2L2KB 3ADIA 2JY9A 1PKPA 4M0VA 2L92A 3C4TA 4LFAE 1QNTA 2UXDE 3AV0A 1T38A 5KL5A 2EN3A 1TN9A 2LT7A 3EQ1A 2JPAA 3DJWA 2EOQA 2VE7C 5DNYA 3MHSC 4LF6E 2I13A 4KWYA 2A25A 2YRMA 2EOIA 2YRKA 1MGTA 4B3SE 1KJKA 5LL6R 1ZAAC 2WBTA 4ZYGA 2EOFA 2CTDA 2EMIA 1GQEA 4DV0E 1QU6A 1TF3A 2EPMX 5A2QC 2HHHE 2EOOA 2EPUA 1JK1A 1WHNA 2JP9A 1YYKA 1J26A 4JI5E 2WCC3 4R03A 3EPHA 4BHBA 3VYYA 2RTXA 2DLQA 4B3ME 2YTEA 3BIDA 4BS9A 2V87A 3K6QA 1EKZA 2L33A 4Q35B 4MLQA 1A1HA 4GKJE 4OOGC 4DR7E 1XMOE 2V89A 2EOYA 2EN7A 5AE3A 3L00A 1X49A 2CSHA 4NHRA 3OTOE 2RSMA 1X48A 2LE2A 1EH6A 5FLXC 4DUZE 2EM4A 4P78A 3TQMA 4R2QA 2EN2A 2IHR1 4LF9E 2LCEA 4GEQB 2L3CA 2ENAA 2YRHA 2M7QA 2WBUA 5KL4A 3DF6A 2KHXA 2ZM6E 4M30A 5TSEA 4JV5E 2RQLA 2LMZA 4BC9A 1SFEA 4JI1E 1BBGA 4F54A 1X6HA 4F2JC 1A1LA 2E1MA 4B3RE 2EN8A 4NXME 2JYAA 3H09A 1YYOA 2NUFA 1IQOA 1HNXE 3IWDA 4DV4E 1O0WA 2EMXA 2N3GA 2NABA 2WBSA 2EE8A 1UHZA 2EPXA 4BMJA 4BHCA 3THOB 2EM0A 2DRPA 2EOXA 3HTXA 4O5GA 4LF7E 1YSAC 1YZ9A 4JI3E 2YSPA 2YPNA 4WXDA 2EWLA 1STUA 2EM3A 4JI7E 2H36X 3BGHA 4X9JA
chains in the Genus database with same CATH topology
4F9AB 5BR8E 2FV4B 3ADLA 4JI0E 3HPZA 2NUEA 3F6GA 3J7Yp 4DR4E 4YY3E 4B3SE 2LUQA 4X65E 1N34E 2VQEE 5LL6R 1N32E 2JOXA 2LTSA 2F8BA 2JWOA 4TUGA 5LMNE 2KONA 2L3JA 4JI8E 4DMIA 4DV2E 1IBKE 4LFCE 2CPNA 1WXRA 4X64E 1GQEA 4DV0E 1QU6A 4WSPA 2VQFE 1YYWA 3JTZA 5AASA 4DV6E 2UUCE 1SR9A 3ADGA 5A2QC 3HPSA 2HHHE 5IWAE 2JVAA 3IWCA 4DV1E 2ODRD 4TUIA 4LU9A 1WHNA 3ZOQB 4F9CB 2V88A 2KOUA 2V86A 2L6MA 4BCAA 5AE1A 4JI5E 1YYKA 1T4OA 3KWRA 3P1XA 1J26A 4R03A 3HXLA 1X47A 1DI2A 4Q28A 4KZSA 3OMLA 4X66E 3VYYA 5T6JA 2RTXA 4M2ZA 4B3ME 4DUYE 2LTRA 4BS9A 2V87A 2LUPB 4DR2E 3K6QA 4DV7E 4X62E 4X8WA 4DR3E 1XMQE 1EKZA 2L33A 4DR1E 4LF8E 1ZBQA 2DMYA 4KHPE 2E5LE 2LRSA 2UUBE 4WFTA 4DKKA 1HR0E 2LBSB 4DR6E 4K0KE 4YHHE 4GKJE 4OOGC 2LJHA 4DR7E 3HQ1A 3C4BA 2M1SA 1XMOE 2B3TB 2JR1A 2V89A 2FTXB 3MSWA 5AE3A 3RMPA 1X49A 4B3TE 4WPYA 1RQ0A 3OTOE 4LF5E 2UXCE 4JYAE 5IT9C 2RSMA 1X48A 1J5EE 2LE2A 1I94E 5FLXC 4JI4E 3JU0A 1N33E 2F4VE 4F9BB 2RS6A 4LTYA 4DV3E 4DUZE 4P78A 4JI6E 4LF4E 4DV5E 2MDRA 2V8QB 5LMUE 2L8TA 2NA2A 2YT4A 2IHR1 1HNZE 3J81C 4LF9E 2K4VA 2V83A 4GEQB 5AE2A 2L3CA 2EZ6A 2V85A 2M7QA 3F6HA 4L5NC 2UU9E 2B9DA 2M4IA 3J80C 3DF6A 4J8ZA 2KHXA 2L2MA 4NXNE 2ZM6E 2UUAE 1XNRE 4WYQB 2B7TA 2MC5A 4M30A 3JAMC 4AQYE 3T1HE 2ODRC 4R8OA 3VYXA 2LMZA 3LLHA 1ZBTA 4BC9A 1DQ3A 4JI1E 3J7AG 4JV5E 2B7VA 4JI2E 2UXBE 1RC7A 2NUGA 5CFFE 3ADJA 1IBLE 4LFBE 1HNWE 4F54A 2MC6A 3AUZA 2L2NA 2E1MA 4B3RE 3FIGA 4BBYA 2FGGA 4NXME 3H09A 1YYOA 2NUFA 4OX9E 1HNXE 3IWDA 1N36E 4DV4E 1O0WA 2JOBA 1GZ6A 2N3GA 3IWBA 5ADZA 2L2KB 1T4LB 2JY9A 1FKAE 3ADIA 4GKKE 1PKPA 1UHZA 4M0VA 5F3WA 2YZTA 2VF1A 4BC7A 2L92A 4L8NA 3C4TA 4BMJA 4P7DA 2DIXA 4LFAE 2DB2A 2RS7A 2UXDE 1T4NA 3AV0A 4LF7E 2G7HA 3HTXA 1IBME 1YZ9A 3T1YE 4JI3E 2DSYA 1WHQA 1XNQE 3DJWA 3VK6A 2EWLA 2VE7C 5DNYA 1UILA 4LF6E 1STUA 4JI7E 2H36X 2WZOA 3LMLA 2N3HA 4DR5E 4I8OA 1FJGE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KWR A;  2YZT A;  4P78 A;  4P7D A;  2DSY A; 
#chains in the Genus database with same CATH topology
 2EQ3 A;  1EH8 A;  4JI0 E;  3VHT B;  1BB8 A;  4R2R A;  3F6G A;  4R2E A;  2LUQ A;  4X65 E;  1N32 E;  2LO3 A;  2LTS A;  5AC4 A;  4TUG A;  4R2S A;  4JI8 E;  4DMI A;  2EL4 A;  3BBG A;  4LFC E;  4X64 E;  2YU8 A;  1PJT A;  2EPZ A;  4WSP A;  2VQF E;  2YTI A;  1YYW A;  1N3G A;  1SR9 A;  3ADG A;  2CT1 A;  2JVA A;  2E5L E;  2EL5 A;  4R2P A;  1DI2 A;  1G2F C;  1B69 A;  2BB8 A;  2N8X A;  2EPC A;  4X62 E;  4DV7 E;  4KHP E;  2DMI A;  2UUB E;  4DKK A;  1AAY A;  2LBS B;  2EOZ A;  2HGH A;  2YSO A;  3HQ1 A;  3C4B A;  2M1S A;  2JR1 A;  2FTX B;  1EH7 A;  2YTN A;  3RMP A;  2EMB A;  4JYA E;  5IT9 C;  4ZYH A;  3JU0 A;  2RS6 A;  4LTY A;  2EQ1 A;  4DV5 E;  1ZR9 A;  2EMY A;  2L8T A;  2NA2 A;  3J81 C;  2K4V A;  2K7I A;  5AE2 A;  3EPK A;  4HEI A;  2M4I A;  2YTF A;  2L2M A;  2UUA E;  2DLK A;  4WYQ B;  2B7T A;  3VYX A;  2ODR C;  4R8O A;  2GHF A;  3LLH A;  2EPL X;  5LLQ A;  4WX9 A;  2B7V A;  2EPK X;  4JI2 E;  5CFF E;  2EOM A;  2MDG A;  3C6K A;  2PRT A;  1RMD A;  4R2D A;  4IJD A;  1FKA E;  3IWB A;  2E72 A;  1ZU1 A;  5F3W A;  4BC7 A;  4L8N A;  5KL3 A;  4P7D A;  1Z1B A;  2DIX A;  2RS7 A;  2DGC A;  2YTD A;  1WRJ A;  1X6F A;  2G7H A;  1G2D C;  2DSY A;  2LVH A;  4O24 A;  2EM2 A;  1XNQ E;  4F6M A;  1UIL A;  4DR5 E;  4I8O A;  2JXP A;  2LV2 A;  3ADL A;  2EPA A;  2FV4 B;  5BR8 E;  3J7Y p;  4DR4 E;  5KL7 A;  1N34 E;  2VQE E;  2EPN A;  5KL2 A;  2JWO A;  5LMN E;  2YTJ A;  2L3J A;  1T39 A;  1X3C A;  2EOR A;  1AH5 A;  2CPN A;  2EJ4 A;  1MEY C;  1X5W A;  3ECR A;  2EMH A;  2YTP A;  1BBO A;  1WJP A;  5A6A A;  3HPS A;  2EM5 A;  3IWC A;  2GPI A;  4LU9 A;  3ZOQ B;  1A1F A;  2V86 A;  2UXC E;  2L6M A;  4BCA A;  5AE1 A;  3HXL A;  2EN4 A;  2RSI A;  1YUI A;  4Q28 A;  3BF2 A;  2ELY A;  3OML A;  4X66 E;  5T6J A;  4M2Z A;  1YFH A;  4DUY E;  2LUP B;  1XMQ E;  4DR3 E;  4LF8 E;  1ZBQ A;  2DMY A;  3QG5 C;  2LRS A;  3MHH C;  4WFT A;  2MKD A;  4K0K E;  2RPC A;  2YWQ A;  2B3T B;  2EPO A;  5IXM B;  1RQ0 A;  1DGC A;  1YPN A;  1I94 E;  1L4S A;  4JI4 E;  2EP3 A;  2F4V E;  3M99 B;  2EMG A;  4F9B B;  4JI6 E;  4ZYD A;  1NCS A;  2YTO A;  3EPL A;  4LF4 E;  3KZY A;  2YU5 A;  1PJS A;  2EOH A;  2EZ6 A;  2EQ0 A;  2V85 A;  3F6H A;  4L5N C;  4MLV A;  2UU9 E;  2B9D A;  3J80 C;  4J8Z A;  4RH8 A;  2HC5 A;  4NXN E;  1XNR E;  4AQY E;  2MC5 A;  3JAM C;  3C6M A;  3T1H E;  2MKN A;  1PDA A;  1GTK A;  3J7A G;  2ELZ A;  2UXB E;  2HJJ A;  3ADJ A;  2YTQ A;  2BBG A;  1IBL E;  2GLI A;  4LFB E;  1HNW E;  2MC6 A;  3AUZ A;  4FK5 C;  5KL6 A;  3THN A;  1UN6 B;  4F6N A;  2JOB A;  5A6K A;  1GZ6 A;  4GKK E;  1T4L B;  3UK3 C;  2EM7 A;  2EMF A;  2VF1 A;  2YZT A;  2DB2 A;  2ADR A;  2EOE A;  1T4N A;  1IBM E;  3T1Y E;  1WHQ A;  3VK6 A;  2I9I A;  2WZO A;  3LML A;  2N3H A;  2EN6 A;  1FJG E;  4F9A B;  3HPZ A;  2NUE A;  1X6E A;  4YY3 E;  1F2I G;  2LJU A;  1KYQ A;  2EPR A;  5AC5 A;  3EPJ A;  2JOX A;  2F8B A;  2KON A;  2VRD A;  4DV2 E;  1IBK E;  1WXR A;  2EN1 A;  2EMK A;  3JTZ A;  5AAS A;  2EMZ A;  4DV6 E;  2UUC E;  2EOS A;  2M9A A;  2EPP A;  1YUJ A;  5IWA E;  4O4K A;  4DV1 E;  2ODR D;  4TUI A;  4F9C B;  1TF6 A;  2KOU A;  2V88 A;  1NEI A;  5A6J A;  4HTG A;  2D9H A;  1T4O A;  3KWR A;  3P1X A;  5A69 A;  2EMC A;  1X47 A;  4R2C A;  4KZS A;  2EL6 A;  2LTR A;  4O43 A;  4DR2 E;  4X8W A;  4DR1 E;  1HR0 E;  2EMW A;  4DR6 E;  4YHH E;  2R76 A;  4WXC A;  2LJH A;  2ENC A;  5A6B A;  1LLM C;  3MSW A;  4B3T E;  1PJQ A;  4RHB B;  4WPY A;  4LF5 E;  1IMU A;  1J5E E;  4N4R B;  4WSG A;  1UBD C;  1N33 E;  2EM9 A;  4DV3 E;  1P47 A;  1A1I A;  2MDR A;  2V8Q B;  2R1F A;  2YTG A;  2YT4 A;  4ZYE A;  5LMU E;  4GZN C;  1HNZ E;  2V83 A;  4NZV A;  5IV8 B;  4IS1 C;  2EM8 A;  4R2A A;  3KZZ A;  1JK2 A;  1ZBT A;  1DQ3 A;  2ENH A;  2J7J A;  1A1G A;  1IQS A;  1RC7 A;  2NUG A;  1A1J A;  2EM6 A;  2EMA A;  1A1K A;  2L2N A;  2EML A;  2EOJ A;  3FIG A;  4BBY A;  2FGG A;  5A6B D;  4OX9 E;  1N36 E;  4M9V C;  5ADZ A;  2Q8U A;  2L2K B;  3ADI A;  2JY9 A;  1PKP A;  4M0V A;  2L92 A;  3C4T A;  4LFA E;  1QNT A;  2UXD E;  3AV0 A;  1T38 A;  5KL5 A;  2EN3 A;  1TN9 A;  2LT7 A;  3EQ1 A;  2JPA A;  3DJW A;  2EOQ A;  2VE7 C;  5DNY A;  3MHS C;  4LF6 E;  2I13 A;  4KWY A;  2A25 A;  2YRM A;  2EOI A;  2YRK A;  1MGT A;  4B3S E;  1KJK A;  5LL6 R;  1ZAA C;  2WBT A;  4ZYG A;  2EOF A;  2CTD A;  2EMI A;  1GQE A;  4DV0 E;  1QU6 A;  1TF3 A;  2EPM X;  5A2Q C;  2HHH E;  2EOO A;  2EPU A;  1JK1 A;  1WHN A;  2JP9 A;  1YYK A;  1J26 A;  4JI5 E;  2WCC 3;  4R03 A;  3EPH A;  4BHB A;  3VYY A;  2RTX A;  2DLQ A;  4B3M E;  2YTE A;  3BID A;  4BS9 A;  2V87 A;  3K6Q A;  1EKZ A;  2L33 A;  4Q35 B;  4MLQ A;  1A1H A;  4GKJ E;  4OOG C;  4DR7 E;  1XMO E;  2V89 A;  2EOY A;  2EN7 A;  5AE3 A;  3L00 A;  1X49 A;  2CSH A;  4NHR A;  3OTO E;  2RSM A;  1X48 A;  2LE2 A;  1EH6 A;  5FLX C;  4DUZ E;  2EM4 A;  4P78 A;  3TQM A;  4R2Q A;  2EN2 A;  2IHR 1;  4LF9 E;  2LCE A;  4GEQ B;  2L3C A;  2ENA A;  2YRH A;  2M7Q A;  2WBU A;  5KL4 A;  3DF6 A;  2KHX A;  2ZM6 E;  4M30 A;  5TSE A;  4JV5 E;  2RQL A;  2LMZ A;  4BC9 A;  1SFE A;  4JI1 E;  1BBG A;  4F54 A;  1X6H A;  4F2J C;  1A1L A;  2E1M A;  4B3R E;  2EN8 A;  4NXM E;  2JYA A;  3H09 A;  1YYO A;  2NUF A;  1IQO A;  1HNX E;  3IWD A;  4DV4 E;  1O0W A;  2EMX A;  2N3G A;  2NAB A;  2WBS A;  2EE8 A;  1UHZ A;  2EPX A;  4BMJ A;  4BHC A;  3THO B;  2EM0 A;  2DRP A;  2EOX A;  3HTX A;  4O5G A;  4LF7 E;  1YSA C;  1YZ9 A;  4JI3 E;  2YSP A;  2YPN A;  4WXD A;  2EWL A;  1STU A;  2EM3 A;  4JI7 E;  2H36 X;  3BGH A;  4X9J A; 
#chains in the Genus database with same CATH homology
 4F9A B;  5BR8 E;  2FV4 B;  3ADL A;  4JI0 E;  3HPZ A;  2NUE A;  3F6G A;  3J7Y p;  4DR4 E;  4YY3 E;  4B3S E;  2LUQ A;  4X65 E;  1N34 E;  2VQE E;  5LL6 R;  1N32 E;  2JOX A;  2LTS A;  2F8B A;  2JWO A;  4TUG A;  5LMN E;  2KON A;  2L3J A;  4JI8 E;  4DMI A;  4DV2 E;  1IBK E;  4LFC E;  2CPN A;  1WXR A;  4X64 E;  1GQE A;  4DV0 E;  1QU6 A;  4WSP A;  2VQF E;  1YYW A;  3JTZ A;  5AAS A;  4DV6 E;  2UUC E;  1SR9 A;  3ADG A;  5A2Q C;  3HPS A;  2HHH E;  5IWA E;  2JVA A;  3IWC A;  4DV1 E;  2ODR D;  4TUI A;  4LU9 A;  1WHN A;  3ZOQ B;  4F9C B;  2V88 A;  2KOU A;  2V86 A;  2L6M A;  4BCA A;  5AE1 A;  4JI5 E;  1YYK A;  1T4O A;  3KWR A;  3P1X A;  1J26 A;  4R03 A;  3HXL A;  1X47 A;  1DI2 A;  4Q28 A;  4KZS A;  3OML A;  4X66 E;  3VYY A;  5T6J A;  2RTX A;  4M2Z A;  4B3M E;  4DUY E;  2LTR A;  4BS9 A;  2V87 A;  2LUP B;  4DR2 E;  3K6Q A;  4DV7 E;  4X62 E;  4X8W A;  4DR3 E;  1XMQ E;  1EKZ A;  2L33 A;  4DR1 E;  4LF8 E;  1ZBQ A;  2DMY A;  4KHP E;  2E5L E;  2LRS A;  2UUB E;  4WFT A;  4DKK A;  1HR0 E;  2LBS B;  4DR6 E;  4K0K E;  4YHH E;  4GKJ E;  4OOG C;  2LJH A;  4DR7 E;  3HQ1 A;  3C4B A;  2M1S A;  1XMO E;  2B3T B;  2JR1 A;  2V89 A;  2FTX B;  3MSW A;  5AE3 A;  3RMP A;  1X49 A;  4B3T E;  4WPY A;  1RQ0 A;  3OTO E;  4LF5 E;  2UXC E;  4JYA E;  5IT9 C;  2RSM A;  1X48 A;  1J5E E;  2LE2 A;  1I94 E;  5FLX C;  4JI4 E;  3JU0 A;  1N33 E;  2F4V E;  4F9B B;  2RS6 A;  4LTY A;  4DV3 E;  4DUZ E;  4P78 A;  4JI6 E;  4LF4 E;  4DV5 E;  2MDR A;  2V8Q B;  5LMU E;  2L8T A;  2NA2 A;  2YT4 A;  2IHR 1;  1HNZ E;  3J81 C;  4LF9 E;  2K4V A;  2V83 A;  4GEQ B;  5AE2 A;  2L3C A;  2EZ6 A;  2V85 A;  2M7Q A;  3F6H A;  4L5N C;  2UU9 E;  2B9D A;  2M4I A;  3J80 C;  3DF6 A;  4J8Z A;  2KHX A;  2L2M A;  4NXN E;  2ZM6 E;  2UUA E;  1XNR E;  4WYQ B;  2B7T A;  2MC5 A;  4M30 A;  3JAM C;  4AQY E;  3T1H E;  2ODR C;  4R8O A;  3VYX A;  2LMZ A;  3LLH A;  1ZBT A;  4BC9 A;  1DQ3 A;  4JI1 E;  3J7A G;  4JV5 E;  2B7V A;  4JI2 E;  2UXB E;  1RC7 A;  2NUG A;  5CFF E;  3ADJ A;  1IBL E;  4LFB E;  1HNW E;  4F54 A;  2MC6 A;  3AUZ A;  2L2N A;  2E1M A;  4B3R E;  3FIG A;  4BBY A;  2FGG A;  4NXM E;  3H09 A;  1YYO A;  2NUF A;  4OX9 E;  1HNX E;  3IWD A;  1N36 E;  4DV4 E;  1O0W A;  2JOB A;  1GZ6 A;  2N3G A;  3IWB A;  5ADZ A;  2L2K B;  1T4L B;  2JY9 A;  1FKA E;  3ADI A;  4GKK E;  1PKP A;  1UHZ A;  4M0V A;  5F3W A;  2YZT A;  2VF1 A;  4BC7 A;  2L92 A;  4L8N A;  3C4T A;  4BMJ A;  4P7D A;  2DIX A;  4LFA E;  2DB2 A;  2RS7 A;  2UXD E;  1T4N A;  3AV0 A;  4LF7 E;  2G7H A;  3HTX A;  1IBM E;  1YZ9 A;  3T1Y E;  4JI3 E;  2DSY A;  1WHQ A;  1XNQ E;  3DJW A;  3VK6 A;  2EWL A;  2VE7 C;  5DNY A;  1UIL A;  4LF6 E;  1STU A;  4JI7 E;  2H36 X;  2WZO A;  3LML A;  2N3H A;  4DR5 E;  4I8O A;  1FJG E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...