3KWRA

Crystal structure of putative rna-binding protein (np_785364.1) from lactobacillus plantarum at 1.45 a resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
83
structure length
83
Chain Sequence
EVKYPAIFRDEGTYWDVRFPDVPAAQTFGASVQVAADNAANALAIALFEQSLPPASDPQYWRLASTEFVVWITMADVQFGPGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative RNA-binding protein
publication title Crystal structure of Putative RNA-binding protein (NP_785364.1) from Lactobacillus plantarum at 1.45 A resolution
rcsb
source organism Lactobacillus plantarum
molecule tags Rna binding protein
total genus 16
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.250 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3kwrA00
2DSYA 4P7DA 4P78A 3KWRA 2YZTA
chains in the Genus database with same CATH superfamily
3JAMC 1N34E 2JY9A 3C4TA 2ELZA 4LFAE 4R2RA 2KOUA 2JVAA 2LMZA 2LJUA 2V83A 5KL6A 2L92A 1IBLE 2EQ0A 2YTQA 3MSWA 4DR7E 2EN7A 2NABA 2EPMX 2EMZA 4RH8A 2EN3A 1IMUA 1STUA 2YWQA 5AASA 3VYXA 3BIDA 2PRTA 4DV3E 2DMIA 2EOZA 5FLXC 4O24A 2LRSA 3THOB 2EMKA 4DMIA 4K0KE 2EPKX 4ZYDA 4NHRA 2DIXA 2EOYA 3KZYA 2KHXA 4O4KA 2DGCA 2ENHA 1XNQE 2L3CA 3HPSA 3EPKA 2EMYA 4LF7E 1A1HA 2MKNA 1T39A 3TQMA 4JV5E 3UK3C 2LTSA 2IHR1 2EOHA 2WBSA 2EM6A 1UBDC 2YU5A 3J81C 2EWLA 3EPLA 1DQ3A 1XMOE 1NEIA 2EM5A 1PJQA 2EM4A 2LCEA 4DR3E 1X6HA 5A2QC 2UUCE 4BMJA 4TUGA 5A6KA 1X6EA 2LO3A 1GTKA 4M9VC 1EH6A 3ADLA 1JK2A 4WYQB 1PKPA 1SR9A 1X5WA 2BBGA 2MKDA 4F9CB 2EN2A 5AC5A 5DNYA 4F54A 1HNXE 1MEYC 1FJGE 1UILA 3ZOQB 5KL2A 3IWDA 2Q8UA 4JI6E 2EJ4A 2JP9A 2L2MA 2EPCA 1G2FC 2EORA 2LUQA 1QU6A 3T1HE 1G2DC 2WBUA 1WHQA 2JPAA 3C6KA 1A1IA 2EMGA 1BBOA 3H09A 2EN6A 4JI8E 4GEQB 5T6JA 2EOOA 2N3GA 5KL4A 2EOSA 1N32E 5LMNE 1HNWE 4JI4E 2DMYA 2M7QA 2RPCA 1XMQE 3EPJA 4DKKA 2WBTA 1UHZA 2FTXB 3LLHA 3F6GA 2EOJA 2L2KB 2UXBE 2V85A 4ZYGA 5AE3A 3EQ1A 1T4LB 2YTNA 2EPPA 1BB8A 2FGGA 3HTXA 4O5GA 2NA2A 1FKAE 3BBGA 4F9AB 2RSMA 3VYYA 2EPUA 2JYAA 2GHFA 2YTJA 2EPNA 1ZAAC 2EM7A 2UXDE 3HXLA 1LLMC 1N33E 2L33A 2RQLA 1B69A 4DV0E 1QNTA 2CTDA 4BBYA 4DUZE 4P78A 2K7IA 5IV8B 1YUJA 4DV1E 3C4BA 2YTFA 3JU0A 2E5LE 2EN1A 2EMHA 2CT1A 4O43A 2EP3A 1RC7A 4LF9E 4M30A 1IBME 2LV2A 2YU8A 1BBGA 4JI0E 1EH7A 4HEIA 2EOEA 5LL6R 3ADGA 5A6BD 4N4RB 1HR0E 2YTPA 1X3CA 1XNRE 3KZZA 4YY3E 4WFTA 2LBSB 2EQ3A 2FV4B 4R2EA 2EPZA 4OX9E 2ODRD 4WXDA 2E72A 2YRKA 2N8XA 4M2ZA 2A25A 1PJSA 2EM3A 2EPRA 3F6HA 2B3TB 1MGTA 2ENAA 4BHCA 1WJPA 1WXRA 5A6BA 4LTYA 1N36E 2RTXA 2V8QB 2VQEE 2NUEA 4J8ZA 1IQSA 2DLKA 5AE2A 3BGHA 2DRPA 2R76A 2H36X 4WXCA 4R2SA 5ADZA 3IWCA 2UU9E 1EKZA 1A1JA 3C6MA 2HC5A 2YPNA 4KWYA 3THNA 4TUIA 4I8OA 1PDAA 2N3HA 4DV6E 1YUIA 1DI2A 2EL4A 4B3RE 4M0VA 3BF2A 4GZNC 4LFCE 3MHHC 4KZSA 2LUPB 1YSAC 4MLQA 4BS9A 3K6QA 3HPZA 4AQYE 3RMPA 1N3GA 4DV5E 1DGCA 1A1LA 2EL5A 2DB2A 2LJHA 2B9DA 4R2PA 4DR6E 2MDRA 2I9IA 4JI2E 1A1FA 3FIGA 4R2QA 4RHBB 4DV7E 4X65E 3HQ1A 4LF4E 2L3JA 3MHSC 1KJKA 1GQEA 2GPIA 2YTOA 3JTZA 5CFFE 4DUYE 4LU9A 3ADJA 3IWBA 2EQ1A 2G7HA 2MDGA 1IBKE 2CPNA 1WRJA 3EPHA 1ZBQA 2EZ6A 2LTRA 2JOXA 2V87A 4X9JA 1TN9A 2F4VE 2YT4A 4R8OA 2WZOA 4ZYHA 2LE2A 5KL5A 2HGHA 2EOFA 2EOQA 4DR4E 4Q35B 2JOBA 4R2AA 2JWOA 1J26A 4DV2E 2UXCE 5KL7A 2K4VA 1SFEA 2ZM6E 4JI3E 2GLIA 5IXMB 1Z1BA 2JR1A 1YPNA 4IJDA 2ENCA 3DF6A 2UUBE 3AUZA 1T38A 2LVHA 1O0WA 4ZYEA 1YZ9A 2VE7C 1NCSA 1YYKA 2EL6A 1X48A 4NZVA 2LT7A 4GKKE 4DV4E 4P7DA 5F3WA 4DR2E 3QG5C 1PJTA 3DJWA 4IS1C 3VHTB 1RMDA 5KL3A 4B3SE 3J7AG 2YTEA 2NUGA 2J7JA 2EN8A 3L00A 2EPAA 2CSHA 4OOGC 2V88A 1UN6B 4Q28A 4GKJE 4FK5C 1ZU1A 1KYQA 2EOIA 2NUFA 1ZR9A 2EM8A 2HJJA 3AV0A 4R2CA 5A69A 2EMIA 2UUAE 4JI5E 4WSPA 2YRHA 1WHNA 4DR1E 2VF1A 3LMLA 1YFHA 2RS7A 2WCC3 2KONA 2BB8A 2JXPA 4B3ME 2EM0A 2M4IA 4BHBA 4LFBE 4NXNE 2EPXA 2EOMA 1YYWA 2EMLA 4LF8E 5LMUE 2VRDA 2I13A 2EE8A 3ECRA 3P1XA 2YRMA 4JI1E 2EMXA 3M99B 2VQFE 2HHHE 2DLQA 4L5NC 1X47A 1X49A 2EN4A 4MLVA 1ZBTA 4F6NA 4JYAE 1A1KA 3T1YE 1TF3A 1X6FA 2ODRC 2EMBA 2EM9A 2ADRA 3ADIA 2E1MA 2EOXA 4F2JC 2B7VA 2EMCA 5LLQA 4L8NA 4KHPE 2EMFA 1EH8A 2EPOA 4HTGA 1A1GA 2D9HA 2EMWA 4LF6E 1P47A 4BCAA 1L4SA 2EPLX 2M9AA 1TF6A 4B3TE 1T4NA 5BR8E 2EMAA 2YZTA 1IQOA 2YTDA 1T4OA 2EM2A 3OMLA 2V86A 2L2NA 5A6JA 4X66E 2YTGA 5AE1A 4LF5E 4WX9A 3J7Yp 4F6MA 2YSPA 1AH5A 2F8BA 1HNZE 1YYOA 4X8WA 2RS6A 3J80C 4X64E 3VK6A 4JI7E 4YHHE 4WSGA 5A6AA 2B7TA 5IT9C 1F2IG 1I94E 4BC9A 4WPYA 2L8TA 2YTIA 1J5EE 2DSYA 2V89A 3KWRA 4BC7A 5IWAE 2YSOA 4F9BB 1JK1A 2L6MA 4X62E 2M1SA 3OTOE 2MC5A 4R2DA 1GZ6A 2R1FA 4DR5E 4NXME 4R03A 5TSEA 5AC4A 2MC6A 1AAYA 1RQ0A 2RSIA 2ELYA
chains in the Genus database with same CATH topology
3JAMC 4KZSA 2LUPB 1N34E 2JY9A 4BS9A 4B3ME 3C4TA 3F6GA 2L2KB 3K6QA 4LFAE 2UXBE 2M4IA 2V85A 2KOUA 5AE3A 3HPZA 4LFBE 1T4LB 4AQYE 2JVAA 2LMZA 2V83A 3RMPA 2FGGA 4NXNE 1YYWA 2L92A 1IBLE 3HTXA 2NA2A 4DV5E 4DR7E 3MSWA 1FKAE 4LF8E 4F9AB 2RSMA 3VYYA 2DB2A 2LJHA 1STUA 5LMUE 2B9DA 5AASA 4DR6E 3VYXA 2MDRA 3P1XA 4JI1E 4DV3E 4JI2E 3FIGA 5FLXC 2UXDE 3HXLA 1N33E 2L33A 2VQFE 2HHHE 4L5NC 2LRSA 1X47A 1X49A 4DV7E 1ZBTA 4JYAE 4DMIA 4DV0E 4K0KE 4X65E 4BBYA 4DUZE 3HQ1A 4P78A 3T1YE 4LF4E 2DIXA 2L3JA 4DV1E 3C4BA 1GQEA 2KHXA 3JU0A 2E5LE 2ODRC 5CFFE 3JTZA 4DUYE 1XNQE 2L3CA 3HPSA 4LU9A 3ADIA 3ADJA 3IWBA 2G7HA 2E1MA 4B3RE 1IBKE 1RC7A 4LF7E 4LF9E 2B7VA 2CPNA 4JV5E 4M30A 1IBME 2LTSA 2IHR1 4L8NA 4KHPE 1ZBQA 2EZ6A 2LTRA 4JI0E 2JOXA 2V87A 5LL6R 3J81C 2EWLA 3ADGA 1DQ3A 4LF6E 2F4VE 1XMOE 1HR0E 2YT4A 4R8OA 2WZOA 4DR3E 2LE2A 4BCAA 5A2QC 2UUCE 1XNRE 4BMJA 4TUGA 4YY3E 4B3TE 4DR4E 4WFTA 2LBSB 1T4NA 2JOBA 5BR8E 2YZTA 3ADLA 2FV4B 1T4OA 3OMLA 4OX9E 2JWOA 2V86A 1J26A 4WYQB 2L2NA 1PKPA 4X66E 1SR9A 2ODRD 4DV2E 2UXCE 2K4VA 2ZM6E 5AE1A 4JI3E 4LF5E 4F9CB 5DNYA 1HNXE 3J7Yp 4F54A 2JR1A 4M2ZA 3DF6A 2UUBE 1FJGE 3AUZA 1UILA 3ZOQB 2F8BA 1O0WA 1HNZE 1YZ9A 2VE7C 1YYOA 3IWDA 4X8WA 3F6HA 2B3TB 2RS6A 4JI6E 1YYKA 3J80C 1X48A 4GKKE 4X64E 1WXRA 3VK6A 4JI7E 4DV4E 4P7DA 2L2MA 4LTYA 5F3WA 4DR2E 1N36E 4YHHE 2RTXA 3DJWA 2LUQA 4B3SE 3J7AG 1QU6A 2NUGA 2V8QB 2B7TA 2VQEE 3T1HE 5IT9C 4J8ZA 2NUEA 1I94E 4OOGC 1WHQA 4BC9A 5AE2A 2V88A 4WPYA 2L8TA 4Q28A 1J5EE 2DSYA 4GKJE 2H36X 3H09A 2V89A 4JI8E 5ADZA 3IWCA 2UU9E 3KWRA 4GEQB 4BC7A 5T6JA 5IWAE 1EKZA 2N3GA 2NUFA 4F9BB 2L6MA 1N32E 5LMNE 3AV0A 1HNWE 4X62E 2M1SA 2UUAE 3OTOE 2MC5A 4JI4E 2DMYA 1GZ6A 4DR5E 4NXME 4R03A 4JI5E 4WSPA 2M7QA 1WHNA 2MC6A 4DR1E 2FTXB 2VF1A 3LMLA 4DV6E 4TUIA 1RQ0A 4I8OA 2N3HA 4DKKA 1XMQE 1DI2A 2RS7A 1UHZA 2KONA 4M0VA 3LLHA 4LFCE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DSY A;  4P7D A;  4P78 A;  3KWR A;  2YZT A; 
#chains in the Genus database with same CATH topology
 3JAM C;  1N34 E;  2JY9 A;  3C4T A;  2ELZ A;  4LFA E;  4R2R A;  2KOU A;  2JVA A;  2LMZ A;  2LJU A;  2V83 A;  5KL6 A;  2L92 A;  1IBL E;  2EQ0 A;  2YTQ A;  3MSW A;  4DR7 E;  2EN7 A;  2NAB A;  2EPM X;  2EMZ A;  4RH8 A;  2EN3 A;  1IMU A;  1STU A;  2YWQ A;  5AAS A;  3VYX A;  3BID A;  2PRT A;  4DV3 E;  2DMI A;  2EOZ A;  5FLX C;  4O24 A;  2LRS A;  3THO B;  2EMK A;  4DMI A;  4K0K E;  2EPK X;  4ZYD A;  4NHR A;  2DIX A;  2EOY A;  3KZY A;  2KHX A;  4O4K A;  2DGC A;  2ENH A;  1XNQ E;  2L3C A;  3HPS A;  3EPK A;  2EMY A;  4LF7 E;  1A1H A;  2MKN A;  1T39 A;  3TQM A;  4JV5 E;  3UK3 C;  2LTS A;  2IHR 1;  2EOH A;  2WBS A;  2EM6 A;  1UBD C;  2YU5 A;  3J81 C;  2EWL A;  3EPL A;  1DQ3 A;  1XMO E;  1NEI A;  2EM5 A;  1PJQ A;  2EM4 A;  2LCE A;  4DR3 E;  1X6H A;  5A2Q C;  2UUC E;  4BMJ A;  4TUG A;  5A6K A;  1X6E A;  2LO3 A;  1GTK A;  4M9V C;  1EH6 A;  3ADL A;  1JK2 A;  4WYQ B;  1PKP A;  1SR9 A;  1X5W A;  2BBG A;  2MKD A;  4F9C B;  2EN2 A;  5AC5 A;  5DNY A;  4F54 A;  1HNX E;  1MEY C;  1FJG E;  1UIL A;  3ZOQ B;  5KL2 A;  3IWD A;  2Q8U A;  4JI6 E;  2EJ4 A;  2JP9 A;  2L2M A;  2EPC A;  1G2F C;  2EOR A;  2LUQ A;  1QU6 A;  3T1H E;  1G2D C;  2WBU A;  1WHQ A;  2JPA A;  3C6K A;  1A1I A;  2EMG A;  1BBO A;  3H09 A;  2EN6 A;  4JI8 E;  4GEQ B;  5T6J A;  2EOO A;  2N3G A;  5KL4 A;  2EOS A;  1N32 E;  5LMN E;  1HNW E;  4JI4 E;  2DMY A;  2M7Q A;  2RPC A;  1XMQ E;  3EPJ A;  4DKK A;  2WBT A;  1UHZ A;  2FTX B;  3LLH A;  3F6G A;  2EOJ A;  2L2K B;  2UXB E;  2V85 A;  4ZYG A;  5AE3 A;  3EQ1 A;  1T4L B;  2YTN A;  2EPP A;  1BB8 A;  2FGG A;  3HTX A;  4O5G A;  2NA2 A;  1FKA E;  3BBG A;  4F9A B;  2RSM A;  3VYY A;  2EPU A;  2JYA A;  2GHF A;  2YTJ A;  2EPN A;  1ZAA C;  2EM7 A;  2UXD E;  3HXL A;  1LLM C;  1N33 E;  2L33 A;  2RQL A;  1B69 A;  4DV0 E;  1QNT A;  2CTD A;  4BBY A;  4DUZ E;  4P78 A;  2K7I A;  5IV8 B;  1YUJ A;  4DV1 E;  3C4B A;  2YTF A;  3JU0 A;  2E5L E;  2EN1 A;  2EMH A;  2CT1 A;  4O43 A;  2EP3 A;  1RC7 A;  4LF9 E;  4M30 A;  1IBM E;  2LV2 A;  2YU8 A;  1BBG A;  4JI0 E;  1EH7 A;  4HEI A;  2EOE A;  5LL6 R;  3ADG A;  5A6B D;  4N4R B;  1HR0 E;  2YTP A;  1X3C A;  1XNR E;  3KZZ A;  4YY3 E;  4WFT A;  2LBS B;  2EQ3 A;  2FV4 B;  4R2E A;  2EPZ A;  4OX9 E;  2ODR D;  4WXD A;  2E72 A;  2YRK A;  2N8X A;  4M2Z A;  2A25 A;  1PJS A;  2EM3 A;  2EPR A;  3F6H A;  2B3T B;  1MGT A;  2ENA A;  4BHC A;  1WJP A;  1WXR A;  5A6B A;  4LTY A;  1N36 E;  2RTX A;  2V8Q B;  2VQE E;  2NUE A;  4J8Z A;  1IQS A;  2DLK A;  5AE2 A;  3BGH A;  2DRP A;  2R76 A;  2H36 X;  4WXC A;  4R2S A;  5ADZ A;  3IWC A;  2UU9 E;  1EKZ A;  1A1J A;  3C6M A;  2HC5 A;  2YPN A;  4KWY A;  3THN A;  4TUI A;  4I8O A;  1PDA A;  2N3H A;  4DV6 E;  1YUI A;  1DI2 A;  2EL4 A;  4B3R E;  4M0V A;  3BF2 A;  4GZN C;  4LFC E;  3MHH C;  4KZS A;  2LUP B;  1YSA C;  4MLQ A;  4BS9 A;  3K6Q A;  3HPZ A;  4AQY E;  3RMP A;  1N3G A;  4DV5 E;  1DGC A;  1A1L A;  2EL5 A;  2DB2 A;  2LJH A;  2B9D A;  4R2P A;  4DR6 E;  2MDR A;  2I9I A;  4JI2 E;  1A1F A;  3FIG A;  4R2Q A;  4RHB B;  4DV7 E;  4X65 E;  3HQ1 A;  4LF4 E;  2L3J A;  3MHS C;  1KJK A;  1GQE A;  2GPI A;  2YTO A;  3JTZ A;  5CFF E;  4DUY E;  4LU9 A;  3ADJ A;  3IWB A;  2EQ1 A;  2G7H A;  2MDG A;  1IBK E;  2CPN A;  1WRJ A;  3EPH A;  1ZBQ A;  2EZ6 A;  2LTR A;  2JOX A;  2V87 A;  4X9J A;  1TN9 A;  2F4V E;  2YT4 A;  4R8O A;  2WZO A;  4ZYH A;  2LE2 A;  5KL5 A;  2HGH A;  2EOF A;  2EOQ A;  4DR4 E;  4Q35 B;  2JOB A;  4R2A A;  2JWO A;  1J26 A;  4DV2 E;  2UXC E;  5KL7 A;  2K4V A;  1SFE A;  2ZM6 E;  4JI3 E;  2GLI A;  5IXM B;  1Z1B A;  2JR1 A;  1YPN A;  4IJD A;  2ENC A;  3DF6 A;  2UUB E;  3AUZ A;  1T38 A;  2LVH A;  1O0W A;  4ZYE A;  1YZ9 A;  2VE7 C;  1NCS A;  1YYK A;  2EL6 A;  1X48 A;  4NZV A;  2LT7 A;  4GKK E;  4DV4 E;  4P7D A;  5F3W A;  4DR2 E;  3QG5 C;  1PJT A;  3DJW A;  4IS1 C;  3VHT B;  1RMD A;  5KL3 A;  4B3S E;  3J7A G;  2YTE A;  2NUG A;  2J7J A;  2EN8 A;  3L00 A;  2EPA A;  2CSH A;  4OOG C;  2V88 A;  1UN6 B;  4Q28 A;  4GKJ E;  4FK5 C;  1ZU1 A;  1KYQ A;  2EOI A;  2NUF A;  1ZR9 A;  2EM8 A;  2HJJ A;  3AV0 A;  4R2C A;  5A69 A;  2EMI A;  2UUA E;  4JI5 E;  4WSP A;  2YRH A;  1WHN A;  4DR1 E;  2VF1 A;  3LML A;  1YFH A;  2RS7 A;  2WCC 3;  2KON A;  2BB8 A;  2JXP A;  4B3M E;  2EM0 A;  2M4I A;  4BHB A;  4LFB E;  4NXN E;  2EPX A;  2EOM A;  1YYW A;  2EML A;  4LF8 E;  5LMU E;  2VRD A;  2I13 A;  2EE8 A;  3ECR A;  3P1X A;  2YRM A;  4JI1 E;  2EMX A;  3M99 B;  2VQF E;  2HHH E;  2DLQ A;  4L5N C;  1X47 A;  1X49 A;  2EN4 A;  4MLV A;  1ZBT A;  4F6N A;  4JYA E;  1A1K A;  3T1Y E;  1TF3 A;  1X6F A;  2ODR C;  2EMB A;  2EM9 A;  2ADR A;  3ADI A;  2E1M A;  2EOX A;  4F2J C;  2B7V A;  2EMC A;  5LLQ A;  4L8N A;  4KHP E;  2EMF A;  1EH8 A;  2EPO A;  4HTG A;  1A1G A;  2D9H A;  2EMW A;  4LF6 E;  1P47 A;  4BCA A;  1L4S A;  2EPL X;  2M9A A;  1TF6 A;  4B3T E;  1T4N A;  5BR8 E;  2EMA A;  2YZT A;  1IQO A;  2YTD A;  1T4O A;  2EM2 A;  3OML A;  2V86 A;  2L2N A;  5A6J A;  4X66 E;  2YTG A;  5AE1 A;  4LF5 E;  4WX9 A;  3J7Y p;  4F6M A;  2YSP A;  1AH5 A;  2F8B A;  1HNZ E;  1YYO A;  4X8W A;  2RS6 A;  3J80 C;  4X64 E;  3VK6 A;  4JI7 E;  4YHH E;  4WSG A;  5A6A A;  2B7T A;  5IT9 C;  1F2I G;  1I94 E;  4BC9 A;  4WPY A;  2L8T A;  2YTI A;  1J5E E;  2DSY A;  2V89 A;  3KWR A;  4BC7 A;  5IWA E;  2YSO A;  4F9B B;  1JK1 A;  2L6M A;  4X62 E;  2M1S A;  3OTO E;  2MC5 A;  4R2D A;  1GZ6 A;  2R1F A;  4DR5 E;  4NXM E;  4R03 A;  5TSE A;  5AC4 A;  2MC6 A;  1AAY A;  1RQ0 A;  2RSI A;  2ELY A; 
#chains in the Genus database with same CATH homology
 3JAM C;  4KZS A;  2LUP B;  1N34 E;  2JY9 A;  4BS9 A;  4B3M E;  3C4T A;  3F6G A;  2L2K B;  3K6Q A;  4LFA E;  2UXB E;  2M4I A;  2V85 A;  2KOU A;  5AE3 A;  3HPZ A;  4LFB E;  1T4L B;  4AQY E;  2JVA A;  2LMZ A;  2V83 A;  3RMP A;  2FGG A;  4NXN E;  1YYW A;  2L92 A;  1IBL E;  3HTX A;  2NA2 A;  4DV5 E;  4DR7 E;  3MSW A;  1FKA E;  4LF8 E;  4F9A B;  2RSM A;  3VYY A;  2DB2 A;  2LJH A;  1STU A;  5LMU E;  2B9D A;  5AAS A;  4DR6 E;  3VYX A;  2MDR A;  3P1X A;  4JI1 E;  4DV3 E;  4JI2 E;  3FIG A;  5FLX C;  2UXD E;  3HXL A;  1N33 E;  2L33 A;  2VQF E;  2HHH E;  4L5N C;  2LRS A;  1X47 A;  1X49 A;  4DV7 E;  1ZBT A;  4JYA E;  4DMI A;  4DV0 E;  4K0K E;  4X65 E;  4BBY A;  4DUZ E;  3HQ1 A;  4P78 A;  3T1Y E;  4LF4 E;  2DIX A;  2L3J A;  4DV1 E;  3C4B A;  1GQE A;  2KHX A;  3JU0 A;  2E5L E;  2ODR C;  5CFF E;  3JTZ A;  4DUY E;  1XNQ E;  2L3C A;  3HPS A;  4LU9 A;  3ADI A;  3ADJ A;  3IWB A;  2G7H A;  2E1M A;  4B3R E;  1IBK E;  1RC7 A;  4LF7 E;  4LF9 E;  2B7V A;  2CPN A;  4JV5 E;  4M30 A;  1IBM E;  2LTS A;  2IHR 1;  4L8N A;  4KHP E;  1ZBQ A;  2EZ6 A;  2LTR A;  4JI0 E;  2JOX A;  2V87 A;  5LL6 R;  3J81 C;  2EWL A;  3ADG A;  1DQ3 A;  4LF6 E;  2F4V E;  1XMO E;  1HR0 E;  2YT4 A;  4R8O A;  2WZO A;  4DR3 E;  2LE2 A;  4BCA A;  5A2Q C;  2UUC E;  1XNR E;  4BMJ A;  4TUG A;  4YY3 E;  4B3T E;  4DR4 E;  4WFT A;  2LBS B;  1T4N A;  2JOB A;  5BR8 E;  2YZT A;  3ADL A;  2FV4 B;  1T4O A;  3OML A;  4OX9 E;  2JWO A;  2V86 A;  1J26 A;  4WYQ B;  2L2N A;  1PKP A;  4X66 E;  1SR9 A;  2ODR D;  4DV2 E;  2UXC E;  2K4V A;  2ZM6 E;  5AE1 A;  4JI3 E;  4LF5 E;  4F9C B;  5DNY A;  1HNX E;  3J7Y p;  4F54 A;  2JR1 A;  4M2Z A;  3DF6 A;  2UUB E;  1FJG E;  3AUZ A;  1UIL A;  3ZOQ B;  2F8B A;  1O0W A;  1HNZ E;  1YZ9 A;  2VE7 C;  1YYO A;  3IWD A;  4X8W A;  3F6H A;  2B3T B;  2RS6 A;  4JI6 E;  1YYK A;  3J80 C;  1X48 A;  4GKK E;  4X64 E;  1WXR A;  3VK6 A;  4JI7 E;  4DV4 E;  4P7D A;  2L2M A;  4LTY A;  5F3W A;  4DR2 E;  1N36 E;  4YHH E;  2RTX A;  3DJW A;  2LUQ A;  4B3S E;  3J7A G;  1QU6 A;  2NUG A;  2V8Q B;  2B7T A;  2VQE E;  3T1H E;  5IT9 C;  4J8Z A;  2NUE A;  1I94 E;  4OOG C;  1WHQ A;  4BC9 A;  5AE2 A;  2V88 A;  4WPY A;  2L8T A;  4Q28 A;  1J5E E;  2DSY A;  4GKJ E;  2H36 X;  3H09 A;  2V89 A;  4JI8 E;  5ADZ A;  3IWC A;  2UU9 E;  3KWR A;  4GEQ B;  4BC7 A;  5T6J A;  5IWA E;  1EKZ A;  2N3G A;  2NUF A;  4F9B B;  2L6M A;  1N32 E;  5LMN E;  3AV0 A;  1HNW E;  4X62 E;  2M1S A;  2UUA E;  3OTO E;  2MC5 A;  4JI4 E;  2DMY A;  1GZ6 A;  4DR5 E;  4NXM E;  4R03 A;  4JI5 E;  4WSP A;  2M7Q A;  1WHN A;  2MC6 A;  4DR1 E;  2FTX B;  2VF1 A;  3LML A;  4DV6 E;  4TUI A;  1RQ0 A;  4I8O A;  2N3H A;  4DKK A;  1XMQ E;  1DI2 A;  2RS7 A;  1UHZ A;  2KON A;  4M0V A;  3LLH A;  4LFC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...