3KWRA

Crystal structure of putative rna-binding protein (np_785364.1) from lactobacillus plantarum at 1.45 a resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
83
structure length
83
Chain Sequence
EVKYPAIFRDEGTYWDVRFPDVPAAQTFGASVQVAADNAANALAIALFEQSLPPASDPQYWRLASTEFVVWITMADVQFGPGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Putative RNA-binding protein
publication title Crystal structure of Putative RNA-binding protein (NP_785364.1) from Lactobacillus plantarum at 1.45 A resolution
rcsb
source organism Lactobacillus plantarum
total genus 16
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.250 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3kwrA00
4P7DA 2DSYA 3KWRA 2YZTA 4P78A
chains in the Genus database with same CATH superfamily
2GPIA 2E5LE 2L33A 2K7IA 2EOQA 2E1MA 2EOHA 1IMUA 2YWQA 4P7DA 1F2IG 3F6GA 1WHQA 2EL4A 1PJQA 2EN4A 2JY9A 1HNZE 1WXRA 1N33E 4M30A 1JK1A 1T4NA 2LCEA 1UBDC 3VYXA 4GZNC 2ZM6E 2LV2A 5KL5A 2EMZA 5IXMB 3LLHA 4O43A 4LFCE 4AQYE 4JI6E 4JI7E 2YTFA 2EOMA 1EH6A 1X49A 2UU9E 2JP9A 1T39A 1HR0E 1ZU1A 4R2SA 4LFBE 4DV1E 2EE8A 2EQ3A 2NUGA 2FGGA 2EWLA 2YPNA 1IBLE 1YYWA 2Q8UA 2EL6A 3JU0A 2ODRD 2EQ0A 2VQFE 2JYAA 3EPKA 3VYYA 2R76A 2L2KB 2B7TA 4X66E 4ZYGA 4HTGA 1A1GA 2VQEE 2UUAE 2EPRA 3ADJA 1N3GA 2R1FA 4F2JC 2CT1A 2UXCE 5A6JA 4R2QA 4R2PA 4JI2E 4NXME 2RS7A 5F3WA 2IHR1 4OOGC 2KHXA 4KZSA 4LF8E 2HC5A 5A6BA 2V89A 2LRSA 3BBGA 2N8XA 3ADGA 2EMYA 1T4LB 3F6HA 2DRPA 3MSWA 3BGHA 5LL6R 2NABA 4NHRA 2YRKA 4DR5E 2MDRA 2JPAA 1BB8A 2WBSA 2MC6A 2D9HA 2FV4B 3HTXA 4MLVA 2YTOA 4F9BB 1N32E 1A1LA 4DR2E 1YUIA 2LO3A 1AH5A 3J7AG 4O24A 1STUA 3OTOE 3J7Yp 4L8NA 2YTPA 1X6HA 3THNA 4DV4E 2EM3A 2EN6A 4DUZE 4WSGA 1YSAC 2V8QB 3HPSA 2EPOA 2V86A 4JI8E 1SR9A 1L4SA 2GLIA 3BF2A 3P1XA 5A69A 2HHHE 5IWAE 4LF9E 2YRMA 2K4VA 2L6MA 4DR1E 2EMIA 5AE1A 2EMAA 2MKNA 5KL4A 2EMKA 1IBKE 2EPCA 5T6JA 1X48A 4DV5E 4B3ME 3VHTB 2ENCA 2ODRC 4GEQB 4J8ZA 4O5GA 1YYKA 4M0VA 5AE2A 2WCC3 5A2QC 2B7VA 5BR8E 1RMDA 2DSYA 4X65E 4DV6E 4LF5E 2MDGA 4NZVA 1Z1BA 3EPHA 1X47A 3UK3C 4R2DA 4R8OA 4WX9A 4M9VC 2EN2A 3L00A 1WJPA 2F4VE 2EOSA 1LLMC 1YUJA 2ADRA 2L8TA 3C4BA 1FKAE 4YY3E 2EM4A 1A1HA 4M2ZA 4MLQA 2YTIA 4ZYDA 1YPNA 2YTNA 2EN7A 1PDAA 4DV7E 2DB2A 2EPPA 2V83A 1XNQE 1QU6A 1TF3A 4DV2E 1UILA 3KZZA 2GHFA 2L3JA 2UXBE 2M9AA 1MEYC 2LTSA 4HEIA 1HNWE 4BC7A 1TF6A 2YSOA 2MC5A 1G2FC 1SFEA 4IS1C 2EM6A 4JI1E 1AAYA 1WRJA 2YT4A 4X62E 3AV0A 2LMZA 2L2NA 2B3TB 2UXDE 2EM5A 4BMJA 4DR3E 3ECRA 2V87A 1MGTA 2E72A 1J5EE 2LJUA 4LU9A 2EPUA 2N3HA 4DV3E 2NUFA 2JR1A 2NA2A 1KJKA 2EOZA 4JV5E 1NCSA 4RH8A 1EH8A 2F8BA 5KL7A 2WBTA 1YZ9A 4JYAE 3H09A 1T4OA 2CSHA 1T38A 2HGHA 2RSMA 2WZOA 4JI3E 4KHPE 2DMIA 2EOJA 3JAMC 2A25A 5AASA 3C6MA 4KWYA 3EQ1A 2EMLA 2ELZA 5FLXC 4I8OA 1GZ6A 4B3SE 4R2RA 2N3GA 2EZ6A 1QNTA 4F54A 2EPKX 2KOUA 2EM9A 4GKKE 3RMPA 2LUQA 4TUIA 2EP3A 1B69A 4X8WA 3TQMA 3AUZA 3FIGA 4JI5E 1DI2A 2B9DA 1XMOE 4F6MA 1XNRE 1P47A 4R03A 4F6NA 1A1KA 2J7JA 1PJSA 2EOIA 2YU5A 4BCAA 2M4IA 2H36X 2V85A 3HPZA 2LT7A 2EMFA 2DMYA 2EM2A 1BBOA 4R2AA 4DMIA 2ENAA 2LUPB 5DNYA 5A6AA 4F9CB 2UUCE 2RTXA 2CTDA 2EMHA 2EN1A 2EM8A 2EN8A 4B3RE 4WFTA 2RPCA 1A1IA 2DIXA 4JI4E 5LMUE 1EH7A 2RS6A 1YFHA 2JOBA 2EPLX 2EPXA 5KL6A 1J26A 4O4KA 1EKZA 4X9JA 5ADZA 2EPMX 2VE7C 4LF7E 2YTQA 1UN6B 2I9IA 2L92A 2M1SA 3DJWA 4BC9A 5KL2A 5AC4A 4RHBB 4B3TE 1DGCA 4L5NC 3LMLA 4LFAE 2JXPA 4WSPA 2LTRA 3EPLA 4TUGA 2EOYA 4LF6E 2JWOA 4Q28A 3THOB 3EPJA 4DR7E 1A1FA 4DR6E 3ZOQB 2YRHA 4JI0E 4YHHE 3IWBA 3K6QA 2EMCA 5TSEA 4BHCA 5IT9C 5LLQA 1ZBTA 1I94E 2YTEA 2EORA 4OX9E 1ZBQA 2EOXA 2EPZA 2DLQA 2ELYA 2PRTA 2EMWA 4R2EA 1JK2A 2YTDA 2YU8A 5A6BD 2YTJA 2BBGA 3IWCA 2G7HA 1RC7A 4X64E 3JTZA 3C4TA 4LF4E 2EN3A 4FK5C 1O0WA 4K0KE 1N34E 1XMQE 2EM0A 2DGCA 2FTXB 2L3CA 2EMBA 2JOXA 1X6EA 4ZYEA 1IQOA 3T1HE 3VK6A 1FJGE 2DLKA 2EQ1A 4DUYE 1KYQA 2YZTA 2VF1A 1X3CA 5IV8B 4WYQB 1GQEA 4BS9A 5KL3A 4GKJE 2RSIA 5CFFE 3T1YE 3ADIA 4P78A 4LTYA 1RQ0A 2EPAA 2V88A 2KONA 3OMLA 2EPNA 2NUEA 1PKPA 3KZYA 1IQSA 2EJ4A 4N4RB 2EL5A 2EOEA 3J80C 2EOFA 4NXNE 2VRDA 1A1JA 5LMNE 1X6FA 4Q35B 2WBUA 5AC5A 2L2MA 2I13A 2EM7A 3IWDA 3M99B 4BHBA 5AE3A 5A6KA 1NEIA 1UHZA 1BBGA 2ENHA 1DQ3A 2CPNA 3C6KA 1WHNA 2BB8A 3HQ1A 2UUBE 2YTGA 1PJTA 1X5WA 1N36E 2HJJA 1IBME 2JVAA 4R2CA 2YSPA 3BIDA 3MHHC 2EOOA 1ZAAC 4WXCA 3HXLA 4BBYA 2M7QA 2RQLA 2LVHA 3ADLA 3QG5C 4IJDA 4F9AB 3MHSC 1YYOA 1TN9A 3KWRA 1HNXE 4DV0E 3J81C 2LBSB 3DF6A 2EMXA 1ZR9A 4DKKA 4ZYHA 4WPYA 1G2DC 4DR4E 2LJHA 4WXDA 2LE2A 2EMGA 1GTKA 2MKDA
chains in the Genus database with same CATH topology
5FLXC 4I8OA 1GZ6A 2E5LE 2L33A 4B3SE 2E1MA 2N3GA 4P7DA 5AE1A 2EZ6A 4F54A 3F6GA 3IWCA 2G7HA 1WHQA 1RC7A 4X64E 2KOUA 2JY9A 3JTZA 3RMPA 3C4TA 1IBKE 1HNZE 2LUQA 4LF4E 5T6JA 4GKKE 1X48A 1WXRA 4TUIA 4M30A 1O0WA 4DV5E 4B3ME 2ODRC 4GEQB 1T4NA 4X8WA 4J8ZA 3AUZA 1YYKA 4M0VA 3VYXA 5AE2A 3FIGA 4JI5E 1N34E 1XMQE 2ZM6E 5A2QC 2B7VA 5BR8E 1DI2A 2FTXB 2B9DA 2L3CA 2DSYA 1XMOE 2JOXA 4X65E 1XNRE 3LLHA 4R03A 4LFCE 4AQYE 4DR1E 4JI6E 4DV6E 4JI7E 3VK6A 3T1HE 4LF5E 1FJGE 4BCAA 1X47A 1X49A 2M4IA 4DUYE 2H36X 2V85A 2YZTA 2VF1A 2UU9E 3HPZA 1HR0E 4WYQB 4R8OA 4LFBE 1GQEA 4BS9A 2DMYA 4DV1E 2NUGA 2F4VE 2FGGA 4GKJE 2EWLA 4DMIA 1IBLE 5CFFE 1YYWA 2LUPB 3JU0A 5DNYA 2ODRD 3C4BA 2L8TA 3T1YE 4P78A 4YY3E 4LTYA 2VQFE 1FKAE 4F9CB 1RQ0A 2UUCE 3ADIA 2RTXA 3VYYA 4M2ZA 2L2KB 2V88A 2B7TA 2KONA 3OMLA 4X66E 2NUEA 1PKPA 2UUAE 2VQEE 4B3RE 4WFTA 3ADJA 2DIXA 3J80C 4NXNE 4DV7E 2DB2A 5LMNE 2UXCE 4JI2E 2V83A 4NXME 2RS7A 5F3WA 4JI4E 1QU6A 5LMUE 4DV2E 1UILA 2IHR1 4OOGC 1XNQE 2L3JA 2UXBE 2RS6A 2KHXA 4KZSA 2JOBA 4LF8E 2LTSA 2L2MA 1HNWE 3IWDA 4BC7A 2V89A 1J26A 5AE3A 1EKZA 5ADZA 2MC5A 2LRSA 2VE7C 3ADGA 4LF7E 1UHZA 1T4LB 2L92A 4JI1E 1DQ3A 3F6HA 2YT4A 4X62E 2M1SA 3AV0A 3DJWA 2CPNA 2LMZA 2L2NA 4BC9A 1WHNA 2B3TB 3HQ1A 3MSWA 5LL6R 2UUBE 1N36E 1N33E 4DR3E 4BMJA 2UXDE 2V87A 4DR5E 1IBME 1J5EE 4B3TE 4L5NC 2MDRA 3LMLA 2JVAA 4LU9A 4LFAE 2MC6A 2FV4B 2N3HA 4WSPA 4DV3E 2LTRA 3HTXA 2NUFA 4F9BB 2JR1A 2NA2A 1N32E 4TUGA 4LF6E 4DR2E 2JWOA 4Q28A 4JV5E 3J7AG 3HXLA 2F8BA 1YZ9A 4K0KE 4JYAE 4DR7E 1STUA 4BBYA 3OTOE 2M7QA 3J7Yp 4L8NA 3H09A 4DR6E 1T4OA 3ZOQB 4JI0E 4YHHE 4JI3E 4KHPE 2RSMA 2WZOA 4DV4E 3ADLA 3IWBA 3K6QA 4DUZE 2V8QB 4F9AB 3HPSA 1YYOA 3JAMC 2V86A 4JI8E 3KWRA 5AASA 1HNXE 4DV0E 3J81C 2LBSB 3DF6A 1SR9A 5IT9C 4DKKA 3P1XA 1ZBTA 2HHHE 5IWAE 1I94E 4WPYA 4LF9E 4DR4E 2LJHA 2K4VA 2LE2A 2L6MA 4OX9E 1ZBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P7D A;  2DSY A;  3KWR A;  2YZT A;  4P78 A; 
#chains in the Genus database with same CATH topology
 2GPI A;  2E5L E;  2L33 A;  2K7I A;  2EOQ A;  2E1M A;  2EOH A;  1IMU A;  2YWQ A;  4P7D A;  1F2I G;  3F6G A;  1WHQ A;  2EL4 A;  1PJQ A;  2EN4 A;  2JY9 A;  1HNZ E;  1WXR A;  1N33 E;  4M30 A;  1JK1 A;  1T4N A;  2LCE A;  1UBD C;  3VYX A;  4GZN C;  2ZM6 E;  2LV2 A;  5KL5 A;  2EMZ A;  5IXM B;  3LLH A;  4O43 A;  4LFC E;  4AQY E;  4JI6 E;  4JI7 E;  2YTF A;  2EOM A;  1EH6 A;  1X49 A;  2UU9 E;  2JP9 A;  1T39 A;  1HR0 E;  1ZU1 A;  4R2S A;  4LFB E;  4DV1 E;  2EE8 A;  2EQ3 A;  2NUG A;  2FGG A;  2EWL A;  2YPN A;  1IBL E;  1YYW A;  2Q8U A;  2EL6 A;  3JU0 A;  2ODR D;  2EQ0 A;  2VQF E;  2JYA A;  3EPK A;  3VYY A;  2R76 A;  2L2K B;  2B7T A;  4X66 E;  4ZYG A;  4HTG A;  1A1G A;  2VQE E;  2UUA E;  2EPR A;  3ADJ A;  1N3G A;  2R1F A;  4F2J C;  2CT1 A;  2UXC E;  5A6J A;  4R2Q A;  4R2P A;  4JI2 E;  4NXM E;  2RS7 A;  5F3W A;  2IHR 1;  4OOG C;  2KHX A;  4KZS A;  4LF8 E;  2HC5 A;  5A6B A;  2V89 A;  2LRS A;  3BBG A;  2N8X A;  3ADG A;  2EMY A;  1T4L B;  3F6H A;  2DRP A;  3MSW A;  3BGH A;  5LL6 R;  2NAB A;  4NHR A;  2YRK A;  4DR5 E;  2MDR A;  2JPA A;  1BB8 A;  2WBS A;  2MC6 A;  2D9H A;  2FV4 B;  3HTX A;  4MLV A;  2YTO A;  4F9B B;  1N32 E;  1A1L A;  4DR2 E;  1YUI A;  2LO3 A;  1AH5 A;  3J7A G;  4O24 A;  1STU A;  3OTO E;  3J7Y p;  4L8N A;  2YTP A;  1X6H A;  3THN A;  4DV4 E;  2EM3 A;  2EN6 A;  4DUZ E;  4WSG A;  1YSA C;  2V8Q B;  3HPS A;  2EPO A;  2V86 A;  4JI8 E;  1SR9 A;  1L4S A;  2GLI A;  3BF2 A;  3P1X A;  5A69 A;  2HHH E;  5IWA E;  4LF9 E;  2YRM A;  2K4V A;  2L6M A;  4DR1 E;  2EMI A;  5AE1 A;  2EMA A;  2MKN A;  5KL4 A;  2EMK A;  1IBK E;  2EPC A;  5T6J A;  1X48 A;  4DV5 E;  4B3M E;  3VHT B;  2ENC A;  2ODR C;  4GEQ B;  4J8Z A;  4O5G A;  1YYK A;  4M0V A;  5AE2 A;  2WCC 3;  5A2Q C;  2B7V A;  5BR8 E;  1RMD A;  2DSY A;  4X65 E;  4DV6 E;  4LF5 E;  2MDG A;  4NZV A;  1Z1B A;  3EPH A;  1X47 A;  3UK3 C;  4R2D A;  4R8O A;  4WX9 A;  4M9V C;  2EN2 A;  3L00 A;  1WJP A;  2F4V E;  2EOS A;  1LLM C;  1YUJ A;  2ADR A;  2L8T A;  3C4B A;  1FKA E;  4YY3 E;  2EM4 A;  1A1H A;  4M2Z A;  4MLQ A;  2YTI A;  4ZYD A;  1YPN A;  2YTN A;  2EN7 A;  1PDA A;  4DV7 E;  2DB2 A;  2EPP A;  2V83 A;  1XNQ E;  1QU6 A;  1TF3 A;  4DV2 E;  1UIL A;  3KZZ A;  2GHF A;  2L3J A;  2UXB E;  2M9A A;  1MEY C;  2LTS A;  4HEI A;  1HNW E;  4BC7 A;  1TF6 A;  2YSO A;  2MC5 A;  1G2F C;  1SFE A;  4IS1 C;  2EM6 A;  4JI1 E;  1AAY A;  1WRJ A;  2YT4 A;  4X62 E;  3AV0 A;  2LMZ A;  2L2N A;  2B3T B;  2UXD E;  2EM5 A;  4BMJ A;  4DR3 E;  3ECR A;  2V87 A;  1MGT A;  2E72 A;  1J5E E;  2LJU A;  4LU9 A;  2EPU A;  2N3H A;  4DV3 E;  2NUF A;  2JR1 A;  2NA2 A;  1KJK A;  2EOZ A;  4JV5 E;  1NCS A;  4RH8 A;  1EH8 A;  2F8B A;  5KL7 A;  2WBT A;  1YZ9 A;  4JYA E;  3H09 A;  1T4O A;  2CSH A;  1T38 A;  2HGH A;  2RSM A;  2WZO A;  4JI3 E;  4KHP E;  2DMI A;  2EOJ A;  3JAM C;  2A25 A;  5AAS A;  3C6M A;  4KWY A;  3EQ1 A;  2EML A;  2ELZ A;  5FLX C;  4I8O A;  1GZ6 A;  4B3S E;  4R2R A;  2N3G A;  2EZ6 A;  1QNT A;  4F54 A;  2EPK X;  2KOU A;  2EM9 A;  4GKK E;  3RMP A;  2LUQ A;  4TUI A;  2EP3 A;  1B69 A;  4X8W A;  3TQM A;  3AUZ A;  3FIG A;  4JI5 E;  1DI2 A;  2B9D A;  1XMO E;  4F6M A;  1XNR E;  1P47 A;  4R03 A;  4F6N A;  1A1K A;  2J7J A;  1PJS A;  2EOI A;  2YU5 A;  4BCA A;  2M4I A;  2H36 X;  2V85 A;  3HPZ A;  2LT7 A;  2EMF A;  2DMY A;  2EM2 A;  1BBO A;  4R2A A;  4DMI A;  2ENA A;  2LUP B;  5DNY A;  5A6A A;  4F9C B;  2UUC E;  2RTX A;  2CTD A;  2EMH A;  2EN1 A;  2EM8 A;  2EN8 A;  4B3R E;  4WFT A;  2RPC A;  1A1I A;  2DIX A;  4JI4 E;  5LMU E;  1EH7 A;  2RS6 A;  1YFH A;  2JOB A;  2EPL X;  2EPX A;  5KL6 A;  1J26 A;  4O4K A;  1EKZ A;  4X9J A;  5ADZ A;  2EPM X;  2VE7 C;  4LF7 E;  2YTQ A;  1UN6 B;  2I9I A;  2L92 A;  2M1S A;  3DJW A;  4BC9 A;  5KL2 A;  5AC4 A;  4RHB B;  4B3T E;  1DGC A;  4L5N C;  3LML A;  4LFA E;  2JXP A;  4WSP A;  2LTR A;  3EPL A;  4TUG A;  2EOY A;  4LF6 E;  2JWO A;  4Q28 A;  3THO B;  3EPJ A;  4DR7 E;  1A1F A;  4DR6 E;  3ZOQ B;  2YRH A;  4JI0 E;  4YHH E;  3IWB A;  3K6Q A;  2EMC A;  5TSE A;  4BHC A;  5IT9 C;  5LLQ A;  1ZBT A;  1I94 E;  2YTE A;  2EOR A;  4OX9 E;  1ZBQ A;  2EOX A;  2EPZ A;  2DLQ A;  2ELY A;  2PRT A;  2EMW A;  4R2E A;  1JK2 A;  2YTD A;  2YU8 A;  5A6B D;  2YTJ A;  2BBG A;  3IWC A;  2G7H A;  1RC7 A;  4X64 E;  3JTZ A;  3C4T A;  4LF4 E;  2EN3 A;  4FK5 C;  1O0W A;  4K0K E;  1N34 E;  1XMQ E;  2EM0 A;  2DGC A;  2FTX B;  2L3C A;  2EMB A;  2JOX A;  1X6E A;  4ZYE A;  1IQO A;  3T1H E;  3VK6 A;  1FJG E;  2DLK A;  2EQ1 A;  4DUY E;  1KYQ A;  2YZT A;  2VF1 A;  1X3C A;  5IV8 B;  4WYQ B;  1GQE A;  4BS9 A;  5KL3 A;  4GKJ E;  2RSI A;  5CFF E;  3T1Y E;  3ADI A;  4P78 A;  4LTY A;  1RQ0 A;  2EPA A;  2V88 A;  2KON A;  3OML A;  2EPN A;  2NUE A;  1PKP A;  3KZY A;  1IQS A;  2EJ4 A;  4N4R B;  2EL5 A;  2EOE A;  3J80 C;  2EOF A;  4NXN E;  2VRD A;  1A1J A;  5LMN E;  1X6F A;  4Q35 B;  2WBU A;  5AC5 A;  2L2M A;  2I13 A;  2EM7 A;  3IWD A;  3M99 B;  4BHB A;  5AE3 A;  5A6K A;  1NEI A;  1UHZ A;  1BBG A;  2ENH A;  1DQ3 A;  2CPN A;  3C6K A;  1WHN A;  2BB8 A;  3HQ1 A;  2UUB E;  2YTG A;  1PJT A;  1X5W A;  1N36 E;  2HJJ A;  1IBM E;  2JVA A;  4R2C A;  2YSP A;  3BID A;  3MHH C;  2EOO A;  1ZAA C;  4WXC A;  3HXL A;  4BBY A;  2M7Q A;  2RQL A;  2LVH A;  3ADL A;  3QG5 C;  4IJD A;  4F9A B;  3MHS C;  1YYO A;  1TN9 A;  3KWR A;  1HNX E;  4DV0 E;  3J81 C;  2LBS B;  3DF6 A;  2EMX A;  1ZR9 A;  4DKK A;  4ZYH A;  4WPY A;  1G2D C;  4DR4 E;  2LJH A;  4WXD A;  2LE2 A;  2EMG A;  1GTK A;  2MKD A; 
#chains in the Genus database with same CATH homology
 5FLX C;  4I8O A;  1GZ6 A;  2E5L E;  2L33 A;  4B3S E;  2E1M A;  2N3G A;  4P7D A;  5AE1 A;  2EZ6 A;  4F54 A;  3F6G A;  3IWC A;  2G7H A;  1WHQ A;  1RC7 A;  4X64 E;  2KOU A;  2JY9 A;  3JTZ A;  3RMP A;  3C4T A;  1IBK E;  1HNZ E;  2LUQ A;  4LF4 E;  5T6J A;  4GKK E;  1X48 A;  1WXR A;  4TUI A;  4M30 A;  1O0W A;  4DV5 E;  4B3M E;  2ODR C;  4GEQ B;  1T4N A;  4X8W A;  4J8Z A;  3AUZ A;  1YYK A;  4M0V A;  3VYX A;  5AE2 A;  3FIG A;  4JI5 E;  1N34 E;  1XMQ E;  2ZM6 E;  5A2Q C;  2B7V A;  5BR8 E;  1DI2 A;  2FTX B;  2B9D A;  2L3C A;  2DSY A;  1XMO E;  2JOX A;  4X65 E;  1XNR E;  3LLH A;  4R03 A;  4LFC E;  4AQY E;  4DR1 E;  4JI6 E;  4DV6 E;  4JI7 E;  3VK6 A;  3T1H E;  4LF5 E;  1FJG E;  4BCA A;  1X47 A;  1X49 A;  2M4I A;  4DUY E;  2H36 X;  2V85 A;  2YZT A;  2VF1 A;  2UU9 E;  3HPZ A;  1HR0 E;  4WYQ B;  4R8O A;  4LFB E;  1GQE A;  4BS9 A;  2DMY A;  4DV1 E;  2NUG A;  2F4V E;  2FGG A;  4GKJ E;  2EWL A;  4DMI A;  1IBL E;  5CFF E;  1YYW A;  2LUP B;  3JU0 A;  5DNY A;  2ODR D;  3C4B A;  2L8T A;  3T1Y E;  4P78 A;  4YY3 E;  4LTY A;  2VQF E;  1FKA E;  4F9C B;  1RQ0 A;  2UUC E;  3ADI A;  2RTX A;  3VYY A;  4M2Z A;  2L2K B;  2V88 A;  2B7T A;  2KON A;  3OML A;  4X66 E;  2NUE A;  1PKP A;  2UUA E;  2VQE E;  4B3R E;  4WFT A;  3ADJ A;  2DIX A;  3J80 C;  4NXN E;  4DV7 E;  2DB2 A;  5LMN E;  2UXC E;  4JI2 E;  2V83 A;  4NXM E;  2RS7 A;  5F3W A;  4JI4 E;  1QU6 A;  5LMU E;  4DV2 E;  1UIL A;  2IHR 1;  4OOG C;  1XNQ E;  2L3J A;  2UXB E;  2RS6 A;  2KHX A;  4KZS A;  2JOB A;  4LF8 E;  2LTS A;  2L2M A;  1HNW E;  3IWD A;  4BC7 A;  2V89 A;  1J26 A;  5AE3 A;  1EKZ A;  5ADZ A;  2MC5 A;  2LRS A;  2VE7 C;  3ADG A;  4LF7 E;  1UHZ A;  1T4L B;  2L92 A;  4JI1 E;  1DQ3 A;  3F6H A;  2YT4 A;  4X62 E;  2M1S A;  3AV0 A;  3DJW A;  2CPN A;  2LMZ A;  2L2N A;  4BC9 A;  1WHN A;  2B3T B;  3HQ1 A;  3MSW A;  5LL6 R;  2UUB E;  1N36 E;  1N33 E;  4DR3 E;  4BMJ A;  2UXD E;  2V87 A;  4DR5 E;  1IBM E;  1J5E E;  4B3T E;  4L5N C;  2MDR A;  3LML A;  2JVA A;  4LU9 A;  4LFA E;  2MC6 A;  2FV4 B;  2N3H A;  4WSP A;  4DV3 E;  2LTR A;  3HTX A;  2NUF A;  4F9B B;  2JR1 A;  2NA2 A;  1N32 E;  4TUG A;  4LF6 E;  4DR2 E;  2JWO A;  4Q28 A;  4JV5 E;  3J7A G;  3HXL A;  2F8B A;  1YZ9 A;  4K0K E;  4JYA E;  4DR7 E;  1STU A;  4BBY A;  3OTO E;  2M7Q A;  3J7Y p;  4L8N A;  3H09 A;  4DR6 E;  1T4O A;  3ZOQ B;  4JI0 E;  4YHH E;  4JI3 E;  4KHP E;  2RSM A;  2WZO A;  4DV4 E;  3ADL A;  3IWB A;  3K6Q A;  4DUZ E;  2V8Q B;  4F9A B;  3HPS A;  1YYO A;  3JAM C;  2V86 A;  4JI8 E;  3KWR A;  5AAS A;  1HNX E;  4DV0 E;  3J81 C;  2LBS B;  3DF6 A;  1SR9 A;  5IT9 C;  4DKK A;  3P1X A;  1ZBT A;  2HHH E;  5IWA E;  1I94 E;  4WPY A;  4LF9 E;  4DR4 E;  2LJH A;  2K4V A;  2LE2 A;  2L6M A;  4OX9 E;  1ZBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...