3KWRA

Crystal structure of putative rna-binding protein (np_785364.1) from lactobacillus plantarum at 1.45 a resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
83
structure length
83
Chain Sequence
EVKYPAIFRDEGTYWDVRFPDVPAAQTFGASVQVAADNAANALAIALFEQSLPPASDPQYWRLASTEFVVWITMADVQFGPGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Putative RNA-binding protein (NP_785364.1) from Lactobacillus plantarum at 1.45 A resolution
rcsb
source organism Lactobacillus plantarum
molecule tags Rna binding protein
molecule keywords Putative RNA-binding protein
total genus 16
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.250 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3kwrA00
2YZTA 3KWRA 2DSYA 4P78A 4P7DA
chains in the Genus database with same CATH superfamily
4DV1E 1T4OA 3LLHA 3LMLA 4JI7E 1AH5A 4R8OA 1BB8A 4M2ZA 3KZZA 2EOZA 2K7IA 2R1FA 1FKAE 4R2CA 4BHCA 2M4IA 2EM9A 4B3RE 2RS7A 3OTOE 1DQ3A 4NXNE 2EN4A 1PDAA 4DV4E 2EOIA 4F9AB 2DLQA 1PJQA 3M99B 1BBOA 2IHR1 1A1IA 5IT9C 2EORA 1WRJA 4LFAE 2BBGA 4P7DA 2UXCE 2L8TA 4MLVA 2VE7C 1BBGA 3JAMC 2YTFA 4BCAA 5LLQA 1ZAAC 4AQYE 1DI2A 1A1GA 1TF6A 2FTXB 1FJGE 3J7Yp 1JK1A 5AC4A 2UXDE 2UUCE 3ADIA 2EMBA 2EWLA 2L3CA 2NA2A 1QU6A 4KWYA 3ADLA 4DR7E 2JY9A 4NXME 1WJPA 2ODRC 2YTGA 4IS1C 4X8WA 2EOSA 2V89A 4DKKA 1PKPA 3IWBA 2DMIA 1YZ9A 4Q28A 4O4KA 4YHHE 1YYWA 3K6QA 2B7VA 5A6KA 1YUJA 4F9BB 1N33E 1EH8A 4R2SA 4R2PA 2YTNA 5KL7A 4BHBA 1TF3A 4L8NA 2EPCA 2MKDA 2DSYA 3C6MA 4HEIA 4B3SE 4BMJA 1HNWE 2EM2A 2EM8A 3J7AG 4JYAE 2B3TB 1X6EA 2RQLA 2EOOA 4DR3E 3EPLA 2N3HA 4GKKE 4DV6E 3EPJA 2EOXA 4JV5E 4Q35B 2E72A 2EMYA 5CFFE 1AAYA 2ZM6E 2EM5A 2R76A 2L33A 1LLMC 2DLKA 1PJSA 3J81C 3HXLA 2MC5A 2KONA 2EN2A 4O24A 2LTRA 1N3GA 2GPIA 2L2KB 4KHPE 1T4LB 2N8XA 1WHNA 4ZYEA 2D9HA 3T1HE 2FV4B 3VHTB 2NUEA 3MHSC 4DV3E 2J7JA 2EMIA 4LF5E 1F2IG 2EOHA 4JI5E 4X62E 2YPNA 4N4RB 3F6GA 5A2QC 2WZOA 4LF4E 1Z1BA 1ZBTA 4OX9E 2F8BA 2MDGA 4LFBE 4RH8A 1HNZE 2LRSA 1A1HA 5AC5A 2NABA 4LF7E 3TQMA 5FLXC 1J5EE 2LVHA 3KWRA 4X66E 3DF6A 5A6BD 2CPNA 2GLIA 2MKNA 2YTDA 2VQFE 4DUYE 2VRDA 2F4VE 2EMFA 1EKZA 4K0KE 4DR2E 1N36E 3C4BA 3IWCA 2YRHA 2EOFA 4ZYDA 2EPNA 4RHBB 2EJ4A 2LE2A 4DV5E 4R03A 2EPUA 4LF6E 1J26A 2HHHE 3BGHA 5A6AA 4R2DA 4F6NA 1RMDA 2EM7A 1G2DC 4DV0E 1XMOE 3THOB 1IQSA 2CSHA 4LF9E 5KL6A 4YY3E 4JI3E 2YU5A 1STUA 2EOYA 3JU0A 4J8ZA 2EPMX 2HC5A 1A1LA 2K4VA 2EMWA 2YTQA 2EP3A 2EMLA 3H09A 2RTXA 1O0WA 5F3WA 2RSMA 4R2RA 2E5LE 1GTKA 2EL5A 3AUZA 1YYKA 1XNQE 2EOJA 2H36X 5TSEA 4JI2E 1GZ6A 4B3ME 3THNA 4LFCE 2EL4A 2EPRA 4O5GA 3MHHC 4JI4E 2EOMA 3C6KA 2UXBE 2VF1A 3BBGA 2YZTA 4WPYA 4M9VC 2LT7A 4DR6E 2ODRD 3P1XA 5IXMB 5A6BA 1T39A 3AV0A 2WBUA 2N3GA 4TUIA 3BF2A 4ZYHA 4M30A 2A25A 3EQ1A 2LCEA 1YYOA 2EM3A 4BC7A 1X5WA 3T1YE 2E1MA 1GQEA 2DGCA 2UUAE 5A69A 2L3JA 2ADRA 4WSPA 2M9AA 4WXCA 5AE2A 1IBKE 4HTGA 1X48A 4WFTA 1WXRA 5ADZA 4X65E 1YUIA 4X64E 3BIDA 5IWAE 2YT4A 4DR5E 2EN1A 2KHXA 3ADJA 1TN9A 2EOQA 2JP9A 2EPKX 1SFEA 1T38A 1B69A 1NCSA 1QNTA 2EM4A 5T6JA 2DRPA 3HPZA 2LJUA 4KZSA 5BR8E 5KL2A 2JVAA 2YU8A 1UN6B 5LL6R 4BS9A 2LJHA 2YSOA 1I94E 1MGTA 4JI8E 1YSAC 2WBSA 4DV2E 2V88A 2LTSA 2V83A 2YTJA 2L6MA 2LO3A 1IBME 2ENCA 2EQ0A 4GKJE 2EMKA 2YTEA 4MLQA 1EH6A 2GHFA 4DMIA 2YRKA 4TUGA 3HQ1A 2YTPA 2V87A 2LV2A 2JOBA 2EMXA 4B3TE 2EN6A 5AE3A 5KL5A 5KL4A 4LF8E 1X49A 2FGGA 2ENHA 3HTXA 1L4SA 2DB2A 3ADGA 3VYYA 3QG5C 1ZR9A 2RS6A 2EQ3A 4DR1E 4JI1E 1X6HA 2B7TA 2EMCA 2EMGA 2CTDA 2L2MA 3IWDA 1XNRE 1IMUA 2YRMA 3EPHA 2EM0A 5IV8B 4WX9A 5KL3A 2I13A 3J80C 2V85A 4NZVA 2CT1A 1EH7A 3UK3C 3VYXA 4M0VA 2YTIA 5A6JA 2EMAA 4FK5C 3ECRA 2YSPA 4X9JA 1X6FA 4F6MA 1A1FA 2RSIA 4F9CB 5LMUE 1X3CA 4F54A 2YWQA 2I9IA 3RMPA 4LU9A 2EPXA 2EPLX 2LMZA 4WSGA 5DNYA 4R2QA 2RPCA 4GZNC 2JOXA 3HPSA 4F2JC 2JPAA 3KZYA 2EPAA 2KOUA 1DGCA 2LUPB 4L5NC 4R2EA 2V8QB 4NHRA 2EQ1A 4DR4E 2EMZA 3L00A 2HJJA 3C4TA 1A1JA 2LBSB 1N32E 2Q8UA 1YFHA 2DIXA 2M7QA 2VQEE 2EN3A 2HGHA 1RQ0A 1JK2A 1G2FC 4WYQB 1WHQA 2NUGA 4BC9A 1UHZA 2JR1A 3MSWA 4DV7E 2WCC3 2EZ6A 4R2AA 4WXDA 3VK6A 1IQOA 4JI0E 2B9DA 5LMNE 1ZBQA 1NEIA 1HR0E 2M1SA 3JTZA 2ELZA 3F6HA 2EPOA 2BB8A 2EOEA 2JWOA 3ZOQB 4P78A 2EMHA 2V86A 4GEQB 1MEYC 2L2NA 1RC7A 3FIGA 2NUFA 1IBLE 2MC6A 1P47A 1ZU1A 1UBDC 4OOGC 1PJTA 1UILA 4JI6E 4O43A 4DUZE 5AE1A 2YTOA 2MDRA 1YPNA 4IJDA 3OMLA 4ZYGA 2EN8A 1A1KA 5AASA 2LUQA 3DJWA 1N34E 2G7HA 4I8OA 4BBYA 1SR9A 2PRTA 4LTYA 2ENAA 2DMYA 2EPZA 3EPKA 2EN7A 1T4NA 1X47A 2ELYA 2JYAA 1KYQA 1XMQE 2UUBE 2EPPA 2WBTA 1KJKA 2UU9E 2EL6A 2L92A 2JXPA 1HNXE 2EE8A 2EM6A
chains in the Genus database with same CATH topology
4DR6E 2ODRD 1T4OA 3P1XA 4DV1E 3LLHA 2ZM6E 3AV0A 3LMLA 4F9CB 5LMUE 2L33A 4JI7E 2N3GA 4TUIA 4F54A 3HXLA 3J81C 2MC5A 4M30A 2KONA 4R8OA 3RMPA 4M2ZA 4LU9A 2LTRA 1YYOA 4BC7A 3T1YE 2L2KB 1FKAE 2LMZA 4KHPE 1T4LB 2M4IA 5DNYA 2E1MA 1GQEA 1WHNA 2JOXA 3HPSA 2UUAE 2RS7A 4B3RE 3OTOE 1DQ3A 3T1HE 2L3JA 4NXNE 2FV4B 4WSPA 2NUEA 4DV3E 4DV4E 2KOUA 5AE2A 4F9AB 2LUPB 4L5NC 1IBKE 4JI5E 4LF5E 2V8QB 4X62E 1X48A 4DR4E 4WFTA 1WXRA 2IHR1 5ADZA 3F6GA 4X65E 5A2QC 2WZOA 4LF4E 3C4TA 4X64E 5IT9C 1ZBTA 5IWAE 4LFAE 2F8BA 2LBSB 2YT4A 4DR5E 4OX9E 1N32E 4LFBE 2KHXA 3ADJA 4P7DA 2UXCE 2L8TA 2DIXA 2VE7C 2M7QA 1HNZE 2VQEE 3JAMC 4BCAA 2LRSA 4AQYE 1DI2A 2FTXB 1RQ0A 1FJGE 3J7Yp 4LF7E 5T6JA 4WYQB 1WHQA 3HPZA 4KZSA 5BR8E 5FLXC 1J5EE 3KWRA 2JVAA 4X66E 2NUGA 3DF6A 2UXDE 2UUCE 4BC9A 3ADIA 5LL6R 1UHZA 4BS9A 2EWLA 2LJHA 2CPNA 2JR1A 2NA2A 1QU6A 3MSWA 4JI8E 2L3CA 4DV7E 1I94E 2VQFE 4DV2E 4DUYE 2EZ6A 3ADLA 3VK6A 4DR7E 2F4VE 2JY9A 2V88A 2LTSA 1EKZA 2V83A 4JI0E 2B9DA 2L6MA 4NXME 4K0KE 2ODRC 1IBME 4DR2E 5LMNE 1ZBQA 3C4BA 1N36E 3IWCA 4GKJE 4X8WA 1HR0E 2M1SA 3JTZA 2V89A 4DMIA 1PKPA 2LE2A 4DKKA 3F6HA 3IWBA 4R03A 4DV5E 4LF6E 4TUGA 1J26A 3HQ1A 2JWOA 1YZ9A 3ZOQB 2V87A 4P78A 4Q28A 2HHHE 2V86A 4GEQB 2L2NA 1RC7A 3FIGA 4YHHE 2NUFA 1IBLE 2MC6A 1YYWA 2JOBA 3K6QA 2B7VA 4DV0E 4OOGC 1XMOE 1UILA 4JI6E 4B3TE 5AE3A 4DUZE 5AE1A 4F9BB 1N33E 2MDRA 4LF9E 4YY3E 4JI3E 3OMLA 4LF8E 1STUA 1X49A 2FGGA 3JU0A 4J8ZA 5AASA 2DB2A 2K4VA 3ADGA 3VYYA 3HTXA 2LUQA 2RS6A 3DJWA 4DR1E 1N34E 2G7HA 4I8OA 4L8NA 2DSYA 4BBYA 1SR9A 3H09A 2RTXA 4BMJA 4B3SE 1HNWE 4LTYA 4JI1E 1O0WA 2B7TA 5F3WA 2DMYA 2RSMA 3J7AG 4JYAE 2B3TB 2L2MA 3IWDA 2E5LE 1XNRE 1T4NA 1X47A 3AUZA 4DR3E 1YYKA 1XNQE 2H36X 4JI2E 2N3HA 1XMQE 1GZ6A 2UUBE 4B3ME 4GKKE 4LFCE 4JI4E 4DV6E 3J80C 2V85A 3VYXA 4JV5E 4M0VA 2UXBE 2UU9E 2L92A 2VF1A 2YZTA 4WPYA 1HNXE 5CFFE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YZT A;  3KWR A;  2DSY A;  4P78 A;  4P7D A; 
#chains in the Genus database with same CATH topology
 4DV1 E;  1T4O A;  3LLH A;  3LML A;  4JI7 E;  1AH5 A;  4R8O A;  1BB8 A;  4M2Z A;  3KZZ A;  2EOZ A;  2K7I A;  2R1F A;  1FKA E;  4R2C A;  4BHC A;  2M4I A;  2EM9 A;  4B3R E;  2RS7 A;  3OTO E;  1DQ3 A;  4NXN E;  2EN4 A;  1PDA A;  4DV4 E;  2EOI A;  4F9A B;  2DLQ A;  1PJQ A;  3M99 B;  1BBO A;  2IHR 1;  1A1I A;  5IT9 C;  2EOR A;  1WRJ A;  4LFA E;  2BBG A;  4P7D A;  2UXC E;  2L8T A;  4MLV A;  2VE7 C;  1BBG A;  3JAM C;  2YTF A;  4BCA A;  5LLQ A;  1ZAA C;  4AQY E;  1DI2 A;  1A1G A;  1TF6 A;  2FTX B;  1FJG E;  3J7Y p;  1JK1 A;  5AC4 A;  2UXD E;  2UUC E;  3ADI A;  2EMB A;  2EWL A;  2L3C A;  2NA2 A;  1QU6 A;  4KWY A;  3ADL A;  4DR7 E;  2JY9 A;  4NXM E;  1WJP A;  2ODR C;  2YTG A;  4IS1 C;  4X8W A;  2EOS A;  2V89 A;  4DKK A;  1PKP A;  3IWB A;  2DMI A;  1YZ9 A;  4Q28 A;  4O4K A;  4YHH E;  1YYW A;  3K6Q A;  2B7V A;  5A6K A;  1YUJ A;  4F9B B;  1N33 E;  1EH8 A;  4R2S A;  4R2P A;  2YTN A;  5KL7 A;  4BHB A;  1TF3 A;  4L8N A;  2EPC A;  2MKD A;  2DSY A;  3C6M A;  4HEI A;  4B3S E;  4BMJ A;  1HNW E;  2EM2 A;  2EM8 A;  3J7A G;  4JYA E;  2B3T B;  1X6E A;  2RQL A;  2EOO A;  4DR3 E;  3EPL A;  2N3H A;  4GKK E;  4DV6 E;  3EPJ A;  2EOX A;  4JV5 E;  4Q35 B;  2E72 A;  2EMY A;  5CFF E;  1AAY A;  2ZM6 E;  2EM5 A;  2R76 A;  2L33 A;  1LLM C;  2DLK A;  1PJS A;  3J81 C;  3HXL A;  2MC5 A;  2KON A;  2EN2 A;  4O24 A;  2LTR A;  1N3G A;  2GPI A;  2L2K B;  4KHP E;  1T4L B;  2N8X A;  1WHN A;  4ZYE A;  2D9H A;  3T1H E;  2FV4 B;  3VHT B;  2NUE A;  3MHS C;  4DV3 E;  2J7J A;  2EMI A;  4LF5 E;  1F2I G;  2EOH A;  4JI5 E;  4X62 E;  2YPN A;  4N4R B;  3F6G A;  5A2Q C;  2WZO A;  4LF4 E;  1Z1B A;  1ZBT A;  4OX9 E;  2F8B A;  2MDG A;  4LFB E;  4RH8 A;  1HNZ E;  2LRS A;  1A1H A;  5AC5 A;  2NAB A;  4LF7 E;  3TQM A;  5FLX C;  1J5E E;  2LVH A;  3KWR A;  4X66 E;  3DF6 A;  5A6B D;  2CPN A;  2GLI A;  2MKN A;  2YTD A;  2VQF E;  4DUY E;  2VRD A;  2F4V E;  2EMF A;  1EKZ A;  4K0K E;  4DR2 E;  1N36 E;  3C4B A;  3IWC A;  2YRH A;  2EOF A;  4ZYD A;  2EPN A;  4RHB B;  2EJ4 A;  2LE2 A;  4DV5 E;  4R03 A;  2EPU A;  4LF6 E;  1J26 A;  2HHH E;  3BGH A;  5A6A A;  4R2D A;  4F6N A;  1RMD A;  2EM7 A;  1G2D C;  4DV0 E;  1XMO E;  3THO B;  1IQS A;  2CSH A;  4LF9 E;  5KL6 A;  4YY3 E;  4JI3 E;  2YU5 A;  1STU A;  2EOY A;  3JU0 A;  4J8Z A;  2EPM X;  2HC5 A;  1A1L A;  2K4V A;  2EMW A;  2YTQ A;  2EP3 A;  2EML A;  3H09 A;  2RTX A;  1O0W A;  5F3W A;  2RSM A;  4R2R A;  2E5L E;  1GTK A;  2EL5 A;  3AUZ A;  1YYK A;  1XNQ E;  2EOJ A;  2H36 X;  5TSE A;  4JI2 E;  1GZ6 A;  4B3M E;  3THN A;  4LFC E;  2EL4 A;  2EPR A;  4O5G A;  3MHH C;  4JI4 E;  2EOM A;  3C6K A;  2UXB E;  2VF1 A;  3BBG A;  2YZT A;  4WPY A;  4M9V C;  2LT7 A;  4DR6 E;  2ODR D;  3P1X A;  5IXM B;  5A6B A;  1T39 A;  3AV0 A;  2WBU A;  2N3G A;  4TUI A;  3BF2 A;  4ZYH A;  4M30 A;  2A25 A;  3EQ1 A;  2LCE A;  1YYO A;  2EM3 A;  4BC7 A;  1X5W A;  3T1Y E;  2E1M A;  1GQE A;  2DGC A;  2UUA E;  5A69 A;  2L3J A;  2ADR A;  4WSP A;  2M9A A;  4WXC A;  5AE2 A;  1IBK E;  4HTG A;  1X48 A;  4WFT A;  1WXR A;  5ADZ A;  4X65 E;  1YUI A;  4X64 E;  3BID A;  5IWA E;  2YT4 A;  4DR5 E;  2EN1 A;  2KHX A;  3ADJ A;  1TN9 A;  2EOQ A;  2JP9 A;  2EPK X;  1SFE A;  1T38 A;  1B69 A;  1NCS A;  1QNT A;  2EM4 A;  5T6J A;  2DRP A;  3HPZ A;  2LJU A;  4KZS A;  5BR8 E;  5KL2 A;  2JVA A;  2YU8 A;  1UN6 B;  5LL6 R;  4BS9 A;  2LJH A;  2YSO A;  1I94 E;  1MGT A;  4JI8 E;  1YSA C;  2WBS A;  4DV2 E;  2V88 A;  2LTS A;  2V83 A;  2YTJ A;  2L6M A;  2LO3 A;  1IBM E;  2ENC A;  2EQ0 A;  4GKJ E;  2EMK A;  2YTE A;  4MLQ A;  1EH6 A;  2GHF A;  4DMI A;  2YRK A;  4TUG A;  3HQ1 A;  2YTP A;  2V87 A;  2LV2 A;  2JOB A;  2EMX A;  4B3T E;  2EN6 A;  5AE3 A;  5KL5 A;  5KL4 A;  4LF8 E;  1X49 A;  2FGG A;  2ENH A;  3HTX A;  1L4S A;  2DB2 A;  3ADG A;  3VYY A;  3QG5 C;  1ZR9 A;  2RS6 A;  2EQ3 A;  4DR1 E;  4JI1 E;  1X6H A;  2B7T A;  2EMC A;  2EMG A;  2CTD A;  2L2M A;  3IWD A;  1XNR E;  1IMU A;  2YRM A;  3EPH A;  2EM0 A;  5IV8 B;  4WX9 A;  5KL3 A;  2I13 A;  3J80 C;  2V85 A;  4NZV A;  2CT1 A;  1EH7 A;  3UK3 C;  3VYX A;  4M0V A;  2YTI A;  5A6J A;  2EMA A;  4FK5 C;  3ECR A;  2YSP A;  4X9J A;  1X6F A;  4F6M A;  1A1F A;  2RSI A;  4F9C B;  5LMU E;  1X3C A;  4F54 A;  2YWQ A;  2I9I A;  3RMP A;  4LU9 A;  2EPX A;  2EPL X;  2LMZ A;  4WSG A;  5DNY A;  4R2Q A;  2RPC A;  4GZN C;  2JOX A;  3HPS A;  4F2J C;  2JPA A;  3KZY A;  2EPA A;  2KOU A;  1DGC A;  2LUP B;  4L5N C;  4R2E A;  2V8Q B;  4NHR A;  2EQ1 A;  4DR4 E;  2EMZ A;  3L00 A;  2HJJ A;  3C4T A;  1A1J A;  2LBS B;  1N32 E;  2Q8U A;  1YFH A;  2DIX A;  2M7Q A;  2VQE E;  2EN3 A;  2HGH A;  1RQ0 A;  1JK2 A;  1G2F C;  4WYQ B;  1WHQ A;  2NUG A;  4BC9 A;  1UHZ A;  2JR1 A;  3MSW A;  4DV7 E;  2WCC 3;  2EZ6 A;  4R2A A;  4WXD A;  3VK6 A;  1IQO A;  4JI0 E;  2B9D A;  5LMN E;  1ZBQ A;  1NEI A;  1HR0 E;  2M1S A;  3JTZ A;  2ELZ A;  3F6H A;  2EPO A;  2BB8 A;  2EOE A;  2JWO A;  3ZOQ B;  4P78 A;  2EMH A;  2V86 A;  4GEQ B;  1MEY C;  2L2N A;  1RC7 A;  3FIG A;  2NUF A;  1IBL E;  2MC6 A;  1P47 A;  1ZU1 A;  1UBD C;  4OOG C;  1PJT A;  1UIL A;  4JI6 E;  4O43 A;  4DUZ E;  5AE1 A;  2YTO A;  2MDR A;  1YPN A;  4IJD A;  3OML A;  4ZYG A;  2EN8 A;  1A1K A;  5AAS A;  2LUQ A;  3DJW A;  1N34 E;  2G7H A;  4I8O A;  4BBY A;  1SR9 A;  2PRT A;  4LTY A;  2ENA A;  2DMY A;  2EPZ A;  3EPK A;  2EN7 A;  1T4N A;  1X47 A;  2ELY A;  2JYA A;  1KYQ A;  1XMQ E;  2UUB E;  2EPP A;  2WBT A;  1KJK A;  2UU9 E;  2EL6 A;  2L92 A;  2JXP A;  1HNX E;  2EE8 A;  2EM6 A; 
#chains in the Genus database with same CATH homology
 4DR6 E;  2ODR D;  1T4O A;  3P1X A;  4DV1 E;  3LLH A;  2ZM6 E;  3AV0 A;  3LML A;  4F9C B;  5LMU E;  2L33 A;  4JI7 E;  2N3G A;  4TUI A;  4F54 A;  3HXL A;  3J81 C;  2MC5 A;  4M30 A;  2KON A;  4R8O A;  3RMP A;  4M2Z A;  4LU9 A;  2LTR A;  1YYO A;  4BC7 A;  3T1Y E;  2L2K B;  1FKA E;  2LMZ A;  4KHP E;  1T4L B;  2M4I A;  5DNY A;  2E1M A;  1GQE A;  1WHN A;  2JOX A;  3HPS A;  2UUA E;  2RS7 A;  4B3R E;  3OTO E;  1DQ3 A;  3T1H E;  2L3J A;  4NXN E;  2FV4 B;  4WSP A;  2NUE A;  4DV3 E;  4DV4 E;  2KOU A;  5AE2 A;  4F9A B;  2LUP B;  4L5N C;  1IBK E;  4JI5 E;  4LF5 E;  2V8Q B;  4X62 E;  1X48 A;  4DR4 E;  4WFT A;  1WXR A;  2IHR 1;  5ADZ A;  3F6G A;  4X65 E;  5A2Q C;  2WZO A;  4LF4 E;  3C4T A;  4X64 E;  5IT9 C;  1ZBT A;  5IWA E;  4LFA E;  2F8B A;  2LBS B;  2YT4 A;  4DR5 E;  4OX9 E;  1N32 E;  4LFB E;  2KHX A;  3ADJ A;  4P7D A;  2UXC E;  2L8T A;  2DIX A;  2VE7 C;  2M7Q A;  1HNZ E;  2VQE E;  3JAM C;  4BCA A;  2LRS A;  4AQY E;  1DI2 A;  2FTX B;  1RQ0 A;  1FJG E;  3J7Y p;  4LF7 E;  5T6J A;  4WYQ B;  1WHQ A;  3HPZ A;  4KZS A;  5BR8 E;  5FLX C;  1J5E E;  3KWR A;  2JVA A;  4X66 E;  2NUG A;  3DF6 A;  2UXD E;  2UUC E;  4BC9 A;  3ADI A;  5LL6 R;  1UHZ A;  4BS9 A;  2EWL A;  2LJH A;  2CPN A;  2JR1 A;  2NA2 A;  1QU6 A;  3MSW A;  4JI8 E;  2L3C A;  4DV7 E;  1I94 E;  2VQF E;  4DV2 E;  4DUY E;  2EZ6 A;  3ADL A;  3VK6 A;  4DR7 E;  2F4V E;  2JY9 A;  2V88 A;  2LTS A;  1EKZ A;  2V83 A;  4JI0 E;  2B9D A;  2L6M A;  4NXM E;  4K0K E;  2ODR C;  1IBM E;  4DR2 E;  5LMN E;  1ZBQ A;  3C4B A;  1N36 E;  3IWC A;  4GKJ E;  4X8W A;  1HR0 E;  2M1S A;  3JTZ A;  2V89 A;  4DMI A;  1PKP A;  2LE2 A;  4DKK A;  3F6H A;  3IWB A;  4R03 A;  4DV5 E;  4LF6 E;  4TUG A;  1J26 A;  3HQ1 A;  2JWO A;  1YZ9 A;  3ZOQ B;  2V87 A;  4P78 A;  4Q28 A;  2HHH E;  2V86 A;  4GEQ B;  2L2N A;  1RC7 A;  3FIG A;  4YHH E;  2NUF A;  1IBL E;  2MC6 A;  1YYW A;  2JOB A;  3K6Q A;  2B7V A;  4DV0 E;  4OOG C;  1XMO E;  1UIL A;  4JI6 E;  4B3T E;  5AE3 A;  4DUZ E;  5AE1 A;  4F9B B;  1N33 E;  2MDR A;  4LF9 E;  4YY3 E;  4JI3 E;  3OML A;  4LF8 E;  1STU A;  1X49 A;  2FGG A;  3JU0 A;  4J8Z A;  5AAS A;  2DB2 A;  2K4V A;  3ADG A;  3VYY A;  3HTX A;  2LUQ A;  2RS6 A;  3DJW A;  4DR1 E;  1N34 E;  2G7H A;  4I8O A;  4L8N A;  2DSY A;  4BBY A;  1SR9 A;  3H09 A;  2RTX A;  4BMJ A;  4B3S E;  1HNW E;  4LTY A;  4JI1 E;  1O0W A;  2B7T A;  5F3W A;  2DMY A;  2RSM A;  3J7A G;  4JYA E;  2B3T B;  2L2M A;  3IWD A;  2E5L E;  1XNR E;  1T4N A;  1X47 A;  3AUZ A;  4DR3 E;  1YYK A;  1XNQ E;  2H36 X;  4JI2 E;  2N3H A;  1XMQ E;  1GZ6 A;  2UUB E;  4B3M E;  4GKK E;  4LFC E;  4JI4 E;  4DV6 E;  3J80 C;  2V85 A;  3VYX A;  4JV5 E;  4M0V A;  2UXB E;  2UU9 E;  2L92 A;  2VF1 A;  2YZT A;  4WPY A;  1HNX E;  5CFF E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...