3KWRA

Crystal structure of putative rna-binding protein (np_785364.1) from lactobacillus plantarum at 1.45 a resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
83
structure length
83
Chain Sequence
b'EVKYPAIFRDEGTYWDVRFPDVPAAQTFGASVQVAADNAANALAIALFEQSLPPASDPQYWRLASTEFVVWITMADVQFGPGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative RNA-binding protein
publication title Crystal structure of Putative RNA-binding protein (NP_785364.1) from Lactobacillus plantarum at 1.45 A resolution
rcsb
source organism Lactobacillus plantarum
molecule tags Rna binding protein
total genus 16
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.250 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3kwrA00
4P78A 3KWRA 2DSYA 4P7DA 2YZTA
chains in the Genus database with same CATH superfamily
2EOEA 4LFBE 3H09A 1NEIA 4F9AB 4JI3E 4L8NA 2LCEA 1XMQE 3C4BA 2JOBA 3T1HE 2LJUA 1X47A 2YTPA 1EKZA 5LLQA 1X5WA 3IWDA 1WJPA 4F6MA 2J7JA 1HNWE 1MEYC 2ELZA 2EMBA 2L3CA 2EL4A 4BHCA 4GKKE 2EPAA 2YRMA 4MLVA 1A1LA 3K6QA 2ODRC 2LT7A 1A1IA 2UXCE 2G7HA 2EMXA 1YFHA 1TN9A 4L5NC 4BBYA 5A6BA 1YYOA 2EOXA 2UXBE 2WBSA 1PJSA 4TUGA 5FLXC 1UHZA 1P47A 2N8XA 2WCC3 2EMCA 4GZNC 4BCAA 4Q35B 4X64E 2EN6A 4DR2E 2EPLX 1ZBQA 2YU8A 2L8TA 5LL6R 1GQEA 2YU5A 5ADZA 4DV4E 5KL4A 2YSOA 4FK5C 3RMPA 2YT4A 2L3JA 2K7IA 2VQEE 1IBLE 4BMJA 1XNQE 4WXCA 4R2CA 2UUAE 1HNZE 2EOMA 1YPNA 2JYAA 4GEQB 2KHXA 3VYYA 2EQ3A 2WBTA 2B7TA 2EOSA 2EN7A 2I13A 2V88A 4DUZE 1Z1BA 2LJHA 2VRDA 4LF7E 2EOFA 4P7DA 1X49A 3VHTB 1QU6A 1JK2A 1PJQA 4RH8A 2EORA 2LE2A 2E1MA 2YTFA 2EE8A 4DV5E 2EOOA 2YRKA 1NCSA 4MLQA 2DSYA 3FIGA 2LTRA 2R76A 4B3RE 2K4VA 3JAMC 1BBOA 1XNRE 2EPUA 2M4IA 3T1YE 4ZYDA 5AASA 2RTXA 2F4VE 5LMUE 1HNXE 4LTYA 4X9JA 5KL5A 1X6FA 2EM7A 4B3ME 2UU9E 4JI0E 2V87A 4DUYE 2DB2A 4JI1E 2EPMX 4M0VA 2NUEA 2JWOA 3JTZA 2L2MA 4WX9A 1QNTA 3C6KA 4I8OA 4DV0E 4F9BB 4R2AA 4WFTA 3DF6A 4DR3E 1EH8A 5A2QC 1X6EA 5KL2A 4P78A 4DR5E 2E5LE 1KYQA 4ZYEA 1IQOA 3VYXA 4R8OA 1ZR9A 4GKJE 2MC5A 3MSWA 2LRSA 1G2DC 2V85A 1LLMC 3IWCA 2EMAA 2V89A 1WXRA 4AQYE 2BB8A 3KZYA 2FGGA 2KONA 1DI2A 1BB8A 3BF2A 4B3SE 5IWAE 1X3CA 2JY9A 1HR0E 1IQSA 1UILA 2EPNA 1DQ3A 2EPZA 1A1JA 2ENHA 3EPJA 5KL3A 4LF9E 3MHHC 4WSPA 1XMOE 4HTGA 5DNYA 4WYQB 4R2SA 2DRPA 2EMLA 2UUBE 2EOQA 4O5GA 2DLKA 4JI6E 3QG5C 2EL5A 4K0KE 2ZM6E 1T4NA 2LUPB 3J7AG 1YZ9A 2V8QB 2B7VA 5IT9C 1T38A 2KOUA 5AC4A 5F3WA 2EQ1A 5A6AA 5CFFE 1N33E 2NUFA 2EPKX 2YTEA 2M1SA 2EMKA 3F6GA 2YTNA 1PKPA 4JI2E 4DR7E 2E72A 1A1FA 2DLQA 1N34E 1J5EE 2EM9A 2R1FA 3KWRA 1RC7A 1STUA 4DV3E 2RQLA 2D9HA 1KJKA 1N3GA 2LVHA 4JV5E 3EPHA 2EM4A 1T4OA 4R2PA 2JR1A 3F6HA 4Q28A 2FV4B 3UK3C 2EM8A 2EPPA 1EH6A 4F6NA 4DV1E 2N3GA 4BS9A 2WBUA 1F2IG 1O0WA 1AH5A 2CT1A 4OX9E 1DGCA 2MDRA 2EM3A 1RMDA 2EN4A 3C4TA 4NXME 3KZZA 3EPKA 3HPZA 5TSEA 4YHHE 4X65E 2N3HA 2MKDA 2EMWA 2RSMA 2DMYA 3EQ1A 1A1HA 2F8BA 2WZOA 2GPIA 4IS1C 2EMFA 4ZYHA 2HJJA 5AE2A 4X8WA 2DIXA 4X62E 2NA2A 4JI4E 1IBME 4DV7E 4NZVA 2YTQA 2EPRA 3OMLA 2L92A 2EOZA 3VK6A 1YUIA 5AE3A 5A6JA 2M7QA 1FKAE 3AV0A 2LMZA 2EOJA 4DV2E 4JI8E 5A69A 2EOHA 2L33A 5IV8B 2EN3A 2MKNA 2EMZA 3J80C 2B9DA 3M99B 2ELYA 4YY3E 2L2NA 4KHPE 2YTDA 3HTXA 2GHFA 2ODRD 4DR4E 4NXNE 2EMHA 1WHQA 1PJTA 4M2ZA 5A6BD 2EM2A 4LF6E 4HEIA 4JYAE 2EMIA 2B3TB 2EOIA 2EM6A 1FJGE 2DGCA 3THNA 3THOB 1B69A 2L6MA 4LU9A 4M30A 1AAYA 3LMLA 2EP3A 3EPLA 2EL6A 4NHRA 2A25A 3L00A 1T4LB 3LLHA 3BGHA 2HC5A 2ENAA 1RQ0A 1TF3A 4DMIA 2LO3A 4RHBB 4JI7E 2EM5A 4R2EA 2NUGA 1SFEA 4JI5E 2GLIA 1G2FC 4R2QA 1L4SA 4X66E 1WRJA 2YTOA 3ZOQB 2EZ6A 4F2JC 2EOYA 1UBDC 4ZYGA 3ECRA 1YYKA 4M9VC 2BBGA 3C6MA 2UXDE 2VE7C 2LTSA 4R03A 3ADIA 2JP9A 2MDGA 2ENCA 5AC5A 2I9IA 5KL6A 3HXLA 4O4KA 2YSPA 4F54A 2VF1A 2NABA 1IBKE 2YPNA 3AUZA 2JXPA 3ADGA 3OTOE 1GZ6A 4WSGA 2EQ0A 1X6HA 2RSIA 3J7Yp 4BC7A 3BBGA 1SR9A 5T6JA 2EN8A 2CSHA 2LUQA 1YYWA 3J81C 2EPOA 2H36X 5AE1A 4DR6E 4DKKA 4TUIA 2CPNA 4O24A 4KWYA 2PRTA 4O43A 4LF5E 1JK1A 2JVAA 3P1XA 1T39A 2EN2A 2JOXA 3TQMA 4R2RA 2ADRA 2MC6A 4WXDA 5KL7A 1TF6A 1ZAAC 2EWLA 3DJWA 4LFCE 1X48A 2RS6A 2YTIA 2JPAA 1J26A 1GTKA 2EMYA 2VQFE 2IHR1 4KZSA 5A6KA 4R2DA 2EPCA 2LV2A 1BBGA 4WPYA 2FTXB 1UN6B 1MGTA 3JU0A 2YTGA 2HHHE 3HPSA 1PDAA 3BIDA 1ZU1A 2EJ4A 2M9AA 3HQ1A 2UUCE 4LFAE 2EPXA 2EMGA 4J8ZA 4DV6E 3ADLA 1YUJA 2EM0A 2EN1A 4B3TE 3IWBA 4LF8E 2L2KB 2RPCA 5LMNE 4BC9A 1ZBTA 2YZTA 4OOGC 2RS7A 2V83A 1N32E 1EH7A 4F9CB 1A1GA 4LF4E 3MHSC 5BR8E 2DMIA 2YWQA 2YRHA 1N36E 1I94E 4N4RB 4DR1E 2Q8UA 4IJDA 5IXMB 2V86A 2YTJA 2HGHA 1WHNA 3ADJA 1A1KA 2CTDA 2LBSB 1YSAC 4BHBA 1IMUA
chains in the Genus database with same CATH topology
4LFBE 4Q28A 3H09A 2FV4B 1YYKA 4F9AB 4JI3E 2F4VE 2UXDE 5LMUE 2VE7C 4L8NA 4DV1E 2LTSA 2N3GA 4R03A 3C4BA 4BS9A 4LTYA 1XMQE 1HNXE 3ADIA 3J7AG 1O0WA 2JOBA 3T1HE 4OX9E 1X47A 1EKZA 2MDRA 4B3ME 2UU9E 4JI0E 2V87A 3C4TA 4DUYE 3IWDA 4NXME 1HNWE 2DB2A 3HPZA 4JI1E 3HXLA 4YHHE 2L3CA 4F54A 4X65E 2N3HA 4M0VA 2NUEA 4GKKE 2JWOA 2RSMA 3JTZA 2VF1A 2DMYA 2L2MA 3K6QA 2ODRC 4I8OA 1IBKE 4DV0E 2UXCE 2G7HA 3AUZA 4F9BB 3ADGA 4WFTA 3OTOE 1GZ6A 2F8BA 2WZOA 3DF6A 4DR3E 5A2QC 4P78A 4L5NC 4BBYA 4DR5E 3J7Yp 1YYOA 2E5LE 4BC7A 1SR9A 5T6JA 4R8OA 3VYXA 5AE2A 2UXBE 4X8WA 4GKJE 2MC5A 4TUGA 2DIXA 5FLXC 2LUQA 4X62E 3MSWA 1YYWA 2NA2A 1UHZA 2LRSA 3J81C 4JI4E 2V85A 2H36X 1IBME 3IWCA 4DV7E 5AE1A 4BCAA 3OMLA 2V89A 4X64E 2L92A 4DKKA 4DR6E 4TUIA 3VK6A 2CPNA 5AE3A 1WXRA 2M7QA 4DR2E 1FKAE 3AV0A 1ZBQA 2LMZA 4AQYE 4LF5E 4DV2E 2FGGA 2KONA 4JI8E 1DI2A 2L8TA 4B3SE 5LL6R 2JVAA 1GQEA 3P1XA 5IWAE 5ADZA 2L33A 4DV4E 2JY9A 1HR0E 2JOXA 1UILA 2MC6A 3J80C 2B9DA 2EWLA 3DJWA 4LFCE 1DQ3A 3RMPA 1X48A 2RS6A 2YT4A 4YY3E 1J26A 2VQFE 2L3JA 2L2NA 2VQEE 2IHR1 4KZSA 4BMJA 1IBLE 1XNQE 4KHPE 4LF9E 3HTXA 4WSPA 2ODRD 4DR4E 1XMOE 4NXNE 4WPYA 2UUAE 5DNYA 2FTXB 4WYQB 1HNZE 1WHQA 4GEQB 2UUBE 2KHXA 3JU0A 4M2ZA 3VYYA 2HHHE 4LF6E 4JYAE 2B7TA 2B3TB 1FJGE 3HPSA 4JI6E 2V88A 4DUZE 4K0KE 2L6MA 2LJHA 3HQ1A 2ZM6E 1T4NA 4LU9A 4M30A 2LUPB 2UUCE 3LMLA 4LF7E 4LFAE 1YZ9A 4J8ZA 2V8QB 2B7VA 4DV6E 5IT9C 3ADLA 1T4LB 4P7DA 1X49A 2KOUA 5F3WA 4B3TE 3LLHA 3IWBA 4LF8E 2L2KB 1QU6A 1RQ0A 5CFFE 4DMIA 2LE2A 2E1MA 5LMNE 4BC9A 1N33E 2NUFA 1ZBTA 2YZTA 2M1SA 3F6GA 4JI7E 4DV5E 4OOGC 1PKPA 2RS7A 2V83A 1N32E 4F9CB 2NUGA 2DSYA 3FIGA 4JI5E 4JI2E 5BR8E 4LF4E 2LTRA 4DR7E 4B3RE 2K4VA 3JAMC 1N34E 1XNRE 1J5EE 3KWRA 1N36E 1RC7A 1I94E 1STUA 4X66E 4DV3E 2M4IA 4DR1E 3T1YE 3ZOQB 2V86A 2EZ6A 5AASA 2RTXA 4JV5E 1WHNA 3ADJA 1T4OA 2LBSB 2JR1A 3F6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P78 A;  3KWR A;  2DSY A;  4P7D A;  2YZT A; 
#chains in the Genus database with same CATH topology
 2EOE A;  4LFB E;  3H09 A;  1NEI A;  4F9A B;  4JI3 E;  4L8N A;  2LCE A;  1XMQ E;  3C4B A;  2JOB A;  3T1H E;  2LJU A;  1X47 A;  2YTP A;  1EKZ A;  5LLQ A;  1X5W A;  3IWD A;  1WJP A;  4F6M A;  2J7J A;  1HNW E;  1MEY C;  2ELZ A;  2EMB A;  2L3C A;  2EL4 A;  4BHC A;  4GKK E;  2EPA A;  2YRM A;  4MLV A;  1A1L A;  3K6Q A;  2ODR C;  2LT7 A;  1A1I A;  2UXC E;  2G7H A;  2EMX A;  1YFH A;  1TN9 A;  4L5N C;  4BBY A;  5A6B A;  1YYO A;  2EOX A;  2UXB E;  2WBS A;  1PJS A;  4TUG A;  5FLX C;  1UHZ A;  1P47 A;  2N8X A;  2WCC 3;  2EMC A;  4GZN C;  4BCA A;  4Q35 B;  4X64 E;  2EN6 A;  4DR2 E;  2EPL X;  1ZBQ A;  2YU8 A;  2L8T A;  5LL6 R;  1GQE A;  2YU5 A;  5ADZ A;  4DV4 E;  5KL4 A;  2YSO A;  4FK5 C;  3RMP A;  2YT4 A;  2L3J A;  2K7I A;  2VQE E;  1IBL E;  4BMJ A;  1XNQ E;  4WXC A;  4R2C A;  2UUA E;  1HNZ E;  2EOM A;  1YPN A;  2JYA A;  4GEQ B;  2KHX A;  3VYY A;  2EQ3 A;  2WBT A;  2B7T A;  2EOS A;  2EN7 A;  2I13 A;  2V88 A;  4DUZ E;  1Z1B A;  2LJH A;  2VRD A;  4LF7 E;  2EOF A;  4P7D A;  1X49 A;  3VHT B;  1QU6 A;  1JK2 A;  1PJQ A;  4RH8 A;  2EOR A;  2LE2 A;  2E1M A;  2YTF A;  2EE8 A;  4DV5 E;  2EOO A;  2YRK A;  1NCS A;  4MLQ A;  2DSY A;  3FIG A;  2LTR A;  2R76 A;  4B3R E;  2K4V A;  3JAM C;  1BBO A;  1XNR E;  2EPU A;  2M4I A;  3T1Y E;  4ZYD A;  5AAS A;  2RTX A;  2F4V E;  5LMU E;  1HNX E;  4LTY A;  4X9J A;  5KL5 A;  1X6F A;  2EM7 A;  4B3M E;  2UU9 E;  4JI0 E;  2V87 A;  4DUY E;  2DB2 A;  4JI1 E;  2EPM X;  4M0V A;  2NUE A;  2JWO A;  3JTZ A;  2L2M A;  4WX9 A;  1QNT A;  3C6K A;  4I8O A;  4DV0 E;  4F9B B;  4R2A A;  4WFT A;  3DF6 A;  4DR3 E;  1EH8 A;  5A2Q C;  1X6E A;  5KL2 A;  4P78 A;  4DR5 E;  2E5L E;  1KYQ A;  4ZYE A;  1IQO A;  3VYX A;  4R8O A;  1ZR9 A;  4GKJ E;  2MC5 A;  3MSW A;  2LRS A;  1G2D C;  2V85 A;  1LLM C;  3IWC A;  2EMA A;  2V89 A;  1WXR A;  4AQY E;  2BB8 A;  3KZY A;  2FGG A;  2KON A;  1DI2 A;  1BB8 A;  3BF2 A;  4B3S E;  5IWA E;  1X3C A;  2JY9 A;  1HR0 E;  1IQS A;  1UIL A;  2EPN A;  1DQ3 A;  2EPZ A;  1A1J A;  2ENH A;  3EPJ A;  5KL3 A;  4LF9 E;  3MHH C;  4WSP A;  1XMO E;  4HTG A;  5DNY A;  4WYQ B;  4R2S A;  2DRP A;  2EML A;  2UUB E;  2EOQ A;  4O5G A;  2DLK A;  4JI6 E;  3QG5 C;  2EL5 A;  4K0K E;  2ZM6 E;  1T4N A;  2LUP B;  3J7A G;  1YZ9 A;  2V8Q B;  2B7V A;  5IT9 C;  1T38 A;  2KOU A;  5AC4 A;  5F3W A;  2EQ1 A;  5A6A A;  5CFF E;  1N33 E;  2NUF A;  2EPK X;  2YTE A;  2M1S A;  2EMK A;  3F6G A;  2YTN A;  1PKP A;  4JI2 E;  4DR7 E;  2E72 A;  1A1F A;  2DLQ A;  1N34 E;  1J5E E;  2EM9 A;  2R1F A;  3KWR A;  1RC7 A;  1STU A;  4DV3 E;  2RQL A;  2D9H A;  1KJK A;  1N3G A;  2LVH A;  4JV5 E;  3EPH A;  2EM4 A;  1T4O A;  4R2P A;  2JR1 A;  3F6H A;  4Q28 A;  2FV4 B;  3UK3 C;  2EM8 A;  2EPP A;  1EH6 A;  4F6N A;  4DV1 E;  2N3G A;  4BS9 A;  2WBU A;  1F2I G;  1O0W A;  1AH5 A;  2CT1 A;  4OX9 E;  1DGC A;  2MDR A;  2EM3 A;  1RMD A;  2EN4 A;  3C4T A;  4NXM E;  3KZZ A;  3EPK A;  3HPZ A;  5TSE A;  4YHH E;  4X65 E;  2N3H A;  2MKD A;  2EMW A;  2RSM A;  2DMY A;  3EQ1 A;  1A1H A;  2F8B A;  2WZO A;  2GPI A;  4IS1 C;  2EMF A;  4ZYH A;  2HJJ A;  5AE2 A;  4X8W A;  2DIX A;  4X62 E;  2NA2 A;  4JI4 E;  1IBM E;  4DV7 E;  4NZV A;  2YTQ A;  2EPR A;  3OML A;  2L92 A;  2EOZ A;  3VK6 A;  1YUI A;  5AE3 A;  5A6J A;  2M7Q A;  1FKA E;  3AV0 A;  2LMZ A;  2EOJ A;  4DV2 E;  4JI8 E;  5A69 A;  2EOH A;  2L33 A;  5IV8 B;  2EN3 A;  2MKN A;  2EMZ A;  3J80 C;  2B9D A;  3M99 B;  2ELY A;  4YY3 E;  2L2N A;  4KHP E;  2YTD A;  3HTX A;  2GHF A;  2ODR D;  4DR4 E;  4NXN E;  2EMH A;  1WHQ A;  1PJT A;  4M2Z A;  5A6B D;  2EM2 A;  4LF6 E;  4HEI A;  4JYA E;  2EMI A;  2B3T B;  2EOI A;  2EM6 A;  1FJG E;  2DGC A;  3THN A;  3THO B;  1B69 A;  2L6M A;  4LU9 A;  4M30 A;  1AAY A;  3LML A;  2EP3 A;  3EPL A;  2EL6 A;  4NHR A;  2A25 A;  3L00 A;  1T4L B;  3LLH A;  3BGH A;  2HC5 A;  2ENA A;  1RQ0 A;  1TF3 A;  4DMI A;  2LO3 A;  4RHB B;  4JI7 E;  2EM5 A;  4R2E A;  2NUG A;  1SFE A;  4JI5 E;  2GLI A;  1G2F C;  4R2Q A;  1L4S A;  4X66 E;  1WRJ A;  2YTO A;  3ZOQ B;  2EZ6 A;  4F2J C;  2EOY A;  1UBD C;  4ZYG A;  3ECR A;  1YYK A;  4M9V C;  2BBG A;  3C6M A;  2UXD E;  2VE7 C;  2LTS A;  4R03 A;  3ADI A;  2JP9 A;  2MDG A;  2ENC A;  5AC5 A;  2I9I A;  5KL6 A;  3HXL A;  4O4K A;  2YSP A;  4F54 A;  2VF1 A;  2NAB A;  1IBK E;  2YPN A;  3AUZ A;  2JXP A;  3ADG A;  3OTO E;  1GZ6 A;  4WSG A;  2EQ0 A;  1X6H A;  2RSI A;  3J7Y p;  4BC7 A;  3BBG A;  1SR9 A;  5T6J A;  2EN8 A;  2CSH A;  2LUQ A;  1YYW A;  3J81 C;  2EPO A;  2H36 X;  5AE1 A;  4DR6 E;  4DKK A;  4TUI A;  2CPN A;  4O24 A;  4KWY A;  2PRT A;  4O43 A;  4LF5 E;  1JK1 A;  2JVA A;  3P1X A;  1T39 A;  2EN2 A;  2JOX A;  3TQM A;  4R2R A;  2ADR A;  2MC6 A;  4WXD A;  5KL7 A;  1TF6 A;  1ZAA C;  2EWL A;  3DJW A;  4LFC E;  1X48 A;  2RS6 A;  2YTI A;  2JPA A;  1J26 A;  1GTK A;  2EMY A;  2VQF E;  2IHR 1;  4KZS A;  5A6K A;  4R2D A;  2EPC A;  2LV2 A;  1BBG A;  4WPY A;  2FTX B;  1UN6 B;  1MGT A;  3JU0 A;  2YTG A;  2HHH E;  3HPS A;  1PDA A;  3BID A;  1ZU1 A;  2EJ4 A;  2M9A A;  3HQ1 A;  2UUC E;  4LFA E;  2EPX A;  2EMG A;  4J8Z A;  4DV6 E;  3ADL A;  1YUJ A;  2EM0 A;  2EN1 A;  4B3T E;  3IWB A;  4LF8 E;  2L2K B;  2RPC A;  5LMN E;  4BC9 A;  1ZBT A;  2YZT A;  4OOG C;  2RS7 A;  2V83 A;  1N32 E;  1EH7 A;  4F9C B;  1A1G A;  4LF4 E;  3MHS C;  5BR8 E;  2DMI A;  2YWQ A;  2YRH A;  1N36 E;  1I94 E;  4N4R B;  4DR1 E;  2Q8U A;  4IJD A;  5IXM B;  2V86 A;  2YTJ A;  2HGH A;  1WHN A;  3ADJ A;  1A1K A;  2CTD A;  2LBS B;  1YSA C;  4BHB A;  1IMU A; 
#chains in the Genus database with same CATH homology
 4LFB E;  4Q28 A;  3H09 A;  2FV4 B;  1YYK A;  4F9A B;  4JI3 E;  2F4V E;  2UXD E;  5LMU E;  2VE7 C;  4L8N A;  4DV1 E;  2LTS A;  2N3G A;  4R03 A;  3C4B A;  4BS9 A;  4LTY A;  1XMQ E;  1HNX E;  3ADI A;  3J7A G;  1O0W A;  2JOB A;  3T1H E;  4OX9 E;  1X47 A;  1EKZ A;  2MDR A;  4B3M E;  2UU9 E;  4JI0 E;  2V87 A;  3C4T A;  4DUY E;  3IWD A;  4NXM E;  1HNW E;  2DB2 A;  3HPZ A;  4JI1 E;  3HXL A;  4YHH E;  2L3C A;  4F54 A;  4X65 E;  2N3H A;  4M0V A;  2NUE A;  4GKK E;  2JWO A;  2RSM A;  3JTZ A;  2VF1 A;  2DMY A;  2L2M A;  3K6Q A;  2ODR C;  4I8O A;  1IBK E;  4DV0 E;  2UXC E;  2G7H A;  3AUZ A;  4F9B B;  3ADG A;  4WFT A;  3OTO E;  1GZ6 A;  2F8B A;  2WZO A;  3DF6 A;  4DR3 E;  5A2Q C;  4P78 A;  4L5N C;  4BBY A;  4DR5 E;  3J7Y p;  1YYO A;  2E5L E;  4BC7 A;  1SR9 A;  5T6J A;  4R8O A;  3VYX A;  5AE2 A;  2UXB E;  4X8W A;  4GKJ E;  2MC5 A;  4TUG A;  2DIX A;  5FLX C;  2LUQ A;  4X62 E;  3MSW A;  1YYW A;  2NA2 A;  1UHZ A;  2LRS A;  3J81 C;  4JI4 E;  2V85 A;  2H36 X;  1IBM E;  3IWC A;  4DV7 E;  5AE1 A;  4BCA A;  3OML A;  2V89 A;  4X64 E;  2L92 A;  4DKK A;  4DR6 E;  4TUI A;  3VK6 A;  2CPN A;  5AE3 A;  1WXR A;  2M7Q A;  4DR2 E;  1FKA E;  3AV0 A;  1ZBQ A;  2LMZ A;  4AQY E;  4LF5 E;  4DV2 E;  2FGG A;  2KON A;  4JI8 E;  1DI2 A;  2L8T A;  4B3S E;  5LL6 R;  2JVA A;  1GQE A;  3P1X A;  5IWA E;  5ADZ A;  2L33 A;  4DV4 E;  2JY9 A;  1HR0 E;  2JOX A;  1UIL A;  2MC6 A;  3J80 C;  2B9D A;  2EWL A;  3DJW A;  4LFC E;  1DQ3 A;  3RMP A;  1X48 A;  2RS6 A;  2YT4 A;  4YY3 E;  1J26 A;  2VQF E;  2L3J A;  2L2N A;  2VQE E;  2IHR 1;  4KZS A;  4BMJ A;  1IBL E;  1XNQ E;  4KHP E;  4LF9 E;  3HTX A;  4WSP A;  2ODR D;  4DR4 E;  1XMO E;  4NXN E;  4WPY A;  2UUA E;  5DNY A;  2FTX B;  4WYQ B;  1HNZ E;  1WHQ A;  4GEQ B;  2UUB E;  2KHX A;  3JU0 A;  4M2Z A;  3VYY A;  2HHH E;  4LF6 E;  4JYA E;  2B7T A;  2B3T B;  1FJG E;  3HPS A;  4JI6 E;  2V88 A;  4DUZ E;  4K0K E;  2L6M A;  2LJH A;  3HQ1 A;  2ZM6 E;  1T4N A;  4LU9 A;  4M30 A;  2LUP B;  2UUC E;  3LML A;  4LF7 E;  4LFA E;  1YZ9 A;  4J8Z A;  2V8Q B;  2B7V A;  4DV6 E;  5IT9 C;  3ADL A;  1T4L B;  4P7D A;  1X49 A;  2KOU A;  5F3W A;  4B3T E;  3LLH A;  3IWB A;  4LF8 E;  2L2K B;  1QU6 A;  1RQ0 A;  5CFF E;  4DMI A;  2LE2 A;  2E1M A;  5LMN E;  4BC9 A;  1N33 E;  2NUF A;  1ZBT A;  2YZT A;  2M1S A;  3F6G A;  4JI7 E;  4DV5 E;  4OOG C;  1PKP A;  2RS7 A;  2V83 A;  1N32 E;  4F9C B;  2NUG A;  2DSY A;  3FIG A;  4JI5 E;  4JI2 E;  5BR8 E;  4LF4 E;  2LTR A;  4DR7 E;  4B3R E;  2K4V A;  3JAM C;  1N34 E;  1XNR E;  1J5E E;  3KWR A;  1N36 E;  1RC7 A;  1I94 E;  1STU A;  4X66 E;  4DV3 E;  2M4I A;  4DR1 E;  3T1Y E;  3ZOQ B;  2V86 A;  2EZ6 A;  5AAS A;  2RTX A;  4JV5 E;  1WHN A;  3ADJ A;  1T4O A;  2LBS B;  2JR1 A;  3F6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...