5AASA

The selective autophagy receptor tax1bp1 is required for autophagy- dependent capture of cytosolic salmonella typhimurium
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
63
structure length
63
Chain Sequence
SSFDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Autophagy Receptor Tax1BP1 and the Molecular Motor Myosin Vi are Required for Clearance of Salmonella Typhimurium by Autophagy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords TAX1-BINDING PROTEIN 1
total genus 12
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2015-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18112 Zn-C2H2_12 Autophagy receptor zinc finger-C2H2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.550 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5aasA00
5AASA 4BMJA 2M7QA
chains in the Genus database with same CATH superfamily
5A6BD 1RC7A 4DV0E 2M7QA 4DV4E 4L8NA 2WBTA 5A6AA 4F9CB 4B3SE 1AH5A 2EPZA 5KL5A 3ADLA 1PJTA 3JTZA 4ZYDA 1KYQA 1ZAAC 1SR9A 2YTGA 4ZYHA 4MLVA 3VHTB 4R2PA 4KHPE 2EN6A 1LLMC 4X9JA 2V83A 3J7AG 4BHBA 2LBSB 2JWOA 2NUEA 1UILA 2NABA 4LFCE 4F9BB 1RMDA 3THOB 5A6KA 2FV4B 3MSWA 2M9AA 3JU0A 2L2MA 2L6MA 4WX9A 3OMLA 2EOYA 2EM0A 2EN4A 5KL2A 4O43A 3ADGA 4BC7A 3EPLA 4JI3E 2VQEE 2JXPA 5LMUE 3F6HA 2YRMA 4GEQB 4NHRA 1EH6A 4JI8E 1GTKA 3HPZA 5AE3A 2WZOA 4R2RA 1PJSA 3H09A 2EMGA 2EM6A 2E5LE 2EMCA 2UXBE 1N36E 1WHNA 2IHR1 2YRKA 1YSAC 1SFEA 3KZYA 1YZ9A 2EMKA 2DLKA 2LO3A 2WBSA 3MHHC 4BC9A 4X65E 2Q8UA 5AC5A 2A25A 2EM2A 4LF7E 2NA2A 1YYOA 2EPPA 1FKAE 2EOXA 2EOIA 4X8WA 2EOSA 1PDAA 2YWQA 4WYQB 3UK3C 1UHZA 4I8OA 2YTEA 2YT4A 4LFAE 2F8BA 2L8TA 1XNRE 3THNA 2LTSA 4B3ME 2EPLX 5A6JA 4JI2E 2RSIA 1EKZA 4M2ZA 2KHXA 4DUYE 2EN1A 4P78A 4BMJA 2V86A 4DR1E 3ZOQB 5IXMB 4BCAA 1QNTA 4LF4E 4IJDA 2EMFA 4ZYEA 3MHSC 1MGTA 3IWDA 2KONA 4DUZE 2RSMA 4M0VA 2EM5A 2E1MA 4JV5E 2EPRA 1ZBTA 2LVHA 4JI5E 4TUIA 3J80C 2LCEA 4OOGC 2ZM6E 3BF2A 1GQEA 1J26A 5IV8B 2EOEA 4R2CA 2L3JA 2EP3A 4DV3E 2EMWA 4RHBB 2JY9A 2EOFA 1DQ3A 2EOQA 2EN7A 1TF6A 3DJWA 1N3GA 3EPHA 4LFBE 5BR8E 4F6NA 2UU9E 1DI2A 2EOOA 5AE1A 2NUGA 2NUFA 1L4SA 4JI1E 2VQFE 4R2QA 3LMLA 4M9VC 4LTYA 4R2AA 2G7HA 2RPCA 4O5GA 5IWAE 1O0WA 1XNQE 2VRDA 2L3CA 2YTQA 2EOZA 1YYWA 5CFFE 2PRTA 2YPNA 1X6HA 4DR2E 4K0KE 2FGGA 3P1XA 4M30A 3OTOE 2H36X 4O4KA 2EPMX 2CTDA 2V85A 5ADZA 3C6MA 2WCC3 4X64E 5KL6A 2LV2A 1I94E 4JI7E 3KZZA 3VYYA 1P47A 1NCSA 4R2DA 1A1FA 1T4OA 4WSGA 3EQ1A 2DB2A 1A1LA 1Z1BA 2JP9A 3J7Yp 1IQSA 2YTDA 2EMBA 1G2DC 3ADIA 4R03A 4X62E 2EMZA 1F2IG 4DV5E 4X66E 3RMPA 3C6KA 2L2NA 4LF8E 5KL4A 3DF6A 1WHQA 1YUJA 1G2FC 3TQMA 4J8ZA 2JPAA 4N4RB 2LTRA 2HHHE 2ODRC 2LUPB 1PJQA 2HJJA 2M4IA 1A1IA 1UBDC 2LT7A 1ZU1A 4BBYA 4DMIA 1KJKA 2N8XA 1STUA 1JK2A 2RQLA 1WJPA 2EQ3A 1JK1A 2R1FA 1IBLE 3IWCA 1UN6B 2YTOA 2JR1A 1ZR9A 4DR6E 1HNWE 3VK6A 2LE2A 2B7TA 2RS6A 2EOMA 1N33E 3HQ1A 2EPUA 1IQOA 2MC6A 2V87A 1MEYC 3BGHA 3M99B 3LLHA 2BB8A 2LJUA 5FLXC 3HXLA 4DV7E 3KWRA 4LF9E 4YHHE 2EPCA 3EPJA 4GKJE 1TF3A 4F2JC 4IS1C 2VE7C 2MKDA 4DR7E 1PKPA 2EN8A 1A1HA 4JI4E 3T1HE 4JYAE 5AE2A 2EMYA 1HR0E 4MLQA 2EE8A 4JI6E 1BBGA 3AUZA 2EN2A 2EWLA 4FK5C 2EPAA 2B3TB 2V89A 4BHCA 4LF6E 2EPOA 4WPYA 1FJGE 4DR4E 1HNXE 1X3CA 2GPIA 1X6EA 4HEIA 4P7DA 4DV1E 1YFHA 2EM7A 2B7VA 4ZYGA 3T1YE 1IBKE 1A1KA 2ENCA 3HTXA 2YSOA 1IMUA 4DKKA 2EMIA 2EPKX 2HC5A 5DNYA 2EPXA 2EOHA 2MKNA 2MC5A 2EMHA 2UUCE 2BBGA 2JYAA 3AV0A 1T4NA 4AQYE 2UXCE 5AASA 3QG5C 4R2EA 2EL6A 4WSPA 2YTIA 2ADRA 2EM4A 4Q28A 2L2KB 2LRSA 2WBUA 4F54A 1AAYA 2YU8A 2EQ1A 4NXME 2I9IA 1N32E 3VYXA 5KL3A 4DV6E 2EZ6A 5IT9C 2EQ0A 1YPNA 5LL6R 4NXNE 2DMIA 5AC4A 5A2QC 2J7JA 4HTGA 2LUQA 1EH7A 4NZVA 2JOXA 2EN3A 1X6FA 2YTFA 2YTJA 2KOUA 2DRPA 2RTXA 2EMXA 2ELZA 2R76A 4L5NC 2L92A 1RQ0A 2DGCA 1WRJA 5LLQA 2EM3A 2YTPA 1J5EE 3FIGA 1ZBQA 2EM9A 4R8OA 2YTNA 4TUGA 3EPKA 4DR5E 1N34E 2E72A 2DLQA 2MDGA 2YU5A 3JAMC 5LMNE 3C4BA 5F3WA 5A69A 4OX9E 2CT1A 1QU6A 2M1SA 4KWYA 5A6BA 5TSEA 4WXDA 2I13A 2V8QB 2CPNA 2GLIA 4YY3E 2K7IA 2RS7A 4WFTA 1B69A 2N3HA 1X49A 2B9DA 1T4LB 4WXCA 4GKKE 1T38A 2UUAE 2ELYA 1HNZE 3BBGA 4JI0E 2EMLA 1DGCA 4B3TE 3BIDA 3J81C 4F9AB 1NEIA 2EMAA 2UXDE 2V88A 1BBOA 1IBME 4B3RE 3L00A 2DMYA 2ODRD 2EL5A 1WXRA 1A1JA 3C4TA 2F4VE 2HGHA 3F6GA 4GZNC 1EH8A 1T39A 3HPSA 2DIXA 1X5WA 1YUIA 4F6MA 2FTXB 3ECRA 1XMOE 2LMZA 2EORA 2N3GA 2GHFA 5T6JA 2UUBE 2YZTA 2MDRA 1TN9A 4DR3E 1X47A 2DSYA 4O24A 2ENHA 2YRHA 1BB8A 4DV2E 4BS9A 4RH8A 2VF1A 2EL4A 2JVAA 3IWBA 2LJHA 1GZ6A 3ADJA 4Q35B 2ENAA 2JOBA 2L33A 2D9HA 4R2SA 2K4VA 4KZSA 1YYKA 4LU9A 1XMQE 1A1GA 4LF5E 1X48A 2EJ4A 2CSHA 2EPNA 5KL7A 2EOJA 2EM8A 2YSPA 3K6QA
chains in the Genus database with same CATH topology
1RC7A 4NXME 4DV6E 2EZ6A 2L2NA 5IT9C 4LF8E 3IWDA 4DV0E 2KONA 2M7QA 4DUZE 2RSMA 4L8NA 5LL6R 4DV4E 4NXNE 4M0VA 4F9CB 4B3SE 5A2QC 3DF6A 1WHQA 3ADLA 2LUQA 3JTZA 2E1MA 4J8ZA 2JOXA 2LTRA 1SR9A 2HHHE 2ODRC 2LUPB 4JV5E 2KOUA 2M4IA 2RTXA 1ZBTA 4DMIA 4BBYA 4JI5E 4L5NC 4TUIA 2L92A 1RQ0A 3J80C 4KHPE 4OOGC 1STUA 1J5EE 2ZM6E 3FIGA 1ZBQA 4R8OA 1GQEA 4TUGA 1IBLE 3IWCA 2V83A 4DR5E 1N34E 1J26A 3J7AG 2L3JA 3JAMC 5LMNE 2JR1A 3C4BA 4DV3E 2JWOA 2LBSB 5F3WA 1UILA 4OX9E 4LFCE 2NUEA 3VK6A 1QU6A 2M1SA 4F9BB 2LE2A 2B7TA 2V8QB 2JY9A 2FV4B 2RS6A 3MSWA 1N33E 2CPNA 1DQ3A 3HQ1A 3DJWA 3JU0A 4LFBE 2MC6A 2V87A 5BR8E 2L2MA 4YY3E 2UU9E 2L6MA 1DI2A 2RS7A 3LLHA 3OMLA 4WFTA 5FLXC 5AE1A 3HXLA 4DV7E 2N3HA 3KWRA 1X49A 2B9DA 4YHHE 2NUFA 4LF9E 2NUGA 4GKJE 3ADGA 4BC7A 1T4LB 4JI1E 2VE7C 2VQEE 2VQFE 5LMUE 2UUAE 4JI3E 4GKKE 3F6HA 1HNZE 3LMLA 4GEQB 4DR7E 1PKPA 4LTYA 4JI4E 4JI0E 2G7HA 4JI8E 3T1HE 5IWAE 3HPZA 1O0WA 5AE3A 5AE2A 4B3TE 4JYAE 3J81C 1HR0E 2WZOA 4F9AB 4JI6E 1XNQE 3AUZA 2UXDE 2V88A 2L3CA 2EWLA 3VYXA 3H09A 2V89A 2B3TB 1IBME 1YYWA 4B3RE 5CFFE 2DMYA 4LF6E 2ODRD 4DR6E 3K6QA 1WXRA 4WPYA 3C4TA 2E5LE 2F4VE 2UXBE 4DR2E 1N36E 1FJGE 3F6GA 4K0KE 1WHNA 2IHR1 2FGGA 3P1XA 1HNXE 1YZ9A 4DR4E 4M30A 4DV1E 3HPSA 4P7DA 2DIXA 3OTOE 2H36X 4BC9A 4X65E 2FTXB 4LF7E 1XMOE 2V85A 2LMZA 2N3GA 5ADZA 5T6JA 1YYOA 2B7VA 2UUBE 2YZTA 2MDRA 4X64E 3T1YE 4DR3E 1I94E 1X47A 2DSYA 4JI7E 1IBKE 1FKAE 3HTXA 4X8WA 3VYYA 4DKKA 4DV2E 4BS9A 1T4OA 2VF1A 5DNYA 4WYQB 1UHZA 4I8OA 2YT4A 2JVAA 4LFAE 1HNWE 2F8BA 2L8TA 3IWBA 2MC5A 2DB2A 1XNRE 2LJHA 2LTSA 1GZ6A 3ADJA 2UUCE 4B3ME 3AV0A 3J7Yp 4JI2E 2JOBA 1EKZA 2L33A 1T4NA 3ADIA 4M2ZA 2K4VA 2KHXA 4KZSA 4R03A 4P78A 5AASA 4X62E 4BMJA 4DUYE 4AQYE 1YYKA 4DV5E 4LU9A 4BCAA 2V86A 4WSPA 1XMQE 4LF5E 1X48A 4X66E 4DR1E 4Q28A 2L2KB 3ZOQB 2UXCE 3RMPA 2LRSA 4LF4E 4F54A 2NA2A 1N32E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AAS A;  4BMJ A;  2M7Q A; 
#chains in the Genus database with same CATH topology
 5A6B D;  1RC7 A;  4DV0 E;  2M7Q A;  4DV4 E;  4L8N A;  2WBT A;  5A6A A;  4F9C B;  4B3S E;  1AH5 A;  2EPZ A;  5KL5 A;  3ADL A;  1PJT A;  3JTZ A;  4ZYD A;  1KYQ A;  1ZAA C;  1SR9 A;  2YTG A;  4ZYH A;  4MLV A;  3VHT B;  4R2P A;  4KHP E;  2EN6 A;  1LLM C;  4X9J A;  2V83 A;  3J7A G;  4BHB A;  2LBS B;  2JWO A;  2NUE A;  1UIL A;  2NAB A;  4LFC E;  4F9B B;  1RMD A;  3THO B;  5A6K A;  2FV4 B;  3MSW A;  2M9A A;  3JU0 A;  2L2M A;  2L6M A;  4WX9 A;  3OML A;  2EOY A;  2EM0 A;  2EN4 A;  5KL2 A;  4O43 A;  3ADG A;  4BC7 A;  3EPL A;  4JI3 E;  2VQE E;  2JXP A;  5LMU E;  3F6H A;  2YRM A;  4GEQ B;  4NHR A;  1EH6 A;  4JI8 E;  1GTK A;  3HPZ A;  5AE3 A;  2WZO A;  4R2R A;  1PJS A;  3H09 A;  2EMG A;  2EM6 A;  2E5L E;  2EMC A;  2UXB E;  1N36 E;  1WHN A;  2IHR 1;  2YRK A;  1YSA C;  1SFE A;  3KZY A;  1YZ9 A;  2EMK A;  2DLK A;  2LO3 A;  2WBS A;  3MHH C;  4BC9 A;  4X65 E;  2Q8U A;  5AC5 A;  2A25 A;  2EM2 A;  4LF7 E;  2NA2 A;  1YYO A;  2EPP A;  1FKA E;  2EOX A;  2EOI A;  4X8W A;  2EOS A;  1PDA A;  2YWQ A;  4WYQ B;  3UK3 C;  1UHZ A;  4I8O A;  2YTE A;  2YT4 A;  4LFA E;  2F8B A;  2L8T A;  1XNR E;  3THN A;  2LTS A;  4B3M E;  2EPL X;  5A6J A;  4JI2 E;  2RSI A;  1EKZ A;  4M2Z A;  2KHX A;  4DUY E;  2EN1 A;  4P78 A;  4BMJ A;  2V86 A;  4DR1 E;  3ZOQ B;  5IXM B;  4BCA A;  1QNT A;  4LF4 E;  4IJD A;  2EMF A;  4ZYE A;  3MHS C;  1MGT A;  3IWD A;  2KON A;  4DUZ E;  2RSM A;  4M0V A;  2EM5 A;  2E1M A;  4JV5 E;  2EPR A;  1ZBT A;  2LVH A;  4JI5 E;  4TUI A;  3J80 C;  2LCE A;  4OOG C;  2ZM6 E;  3BF2 A;  1GQE A;  1J26 A;  5IV8 B;  2EOE A;  4R2C A;  2L3J A;  2EP3 A;  4DV3 E;  2EMW A;  4RHB B;  2JY9 A;  2EOF A;  1DQ3 A;  2EOQ A;  2EN7 A;  1TF6 A;  3DJW A;  1N3G A;  3EPH A;  4LFB E;  5BR8 E;  4F6N A;  2UU9 E;  1DI2 A;  2EOO A;  5AE1 A;  2NUG A;  2NUF A;  1L4S A;  4JI1 E;  2VQF E;  4R2Q A;  3LML A;  4M9V C;  4LTY A;  4R2A A;  2G7H A;  2RPC A;  4O5G A;  5IWA E;  1O0W A;  1XNQ E;  2VRD A;  2L3C A;  2YTQ A;  2EOZ A;  1YYW A;  5CFF E;  2PRT A;  2YPN A;  1X6H A;  4DR2 E;  4K0K E;  2FGG A;  3P1X A;  4M30 A;  3OTO E;  2H36 X;  4O4K A;  2EPM X;  2CTD A;  2V85 A;  5ADZ A;  3C6M A;  2WCC 3;  4X64 E;  5KL6 A;  2LV2 A;  1I94 E;  4JI7 E;  3KZZ A;  3VYY A;  1P47 A;  1NCS A;  4R2D A;  1A1F A;  1T4O A;  4WSG A;  3EQ1 A;  2DB2 A;  1A1L A;  1Z1B A;  2JP9 A;  3J7Y p;  1IQS A;  2YTD A;  2EMB A;  1G2D C;  3ADI A;  4R03 A;  4X62 E;  2EMZ A;  1F2I G;  4DV5 E;  4X66 E;  3RMP A;  3C6K A;  2L2N A;  4LF8 E;  5KL4 A;  3DF6 A;  1WHQ A;  1YUJ A;  1G2F C;  3TQM A;  4J8Z A;  2JPA A;  4N4R B;  2LTR A;  2HHH E;  2ODR C;  2LUP B;  1PJQ A;  2HJJ A;  2M4I A;  1A1I A;  1UBD C;  2LT7 A;  1ZU1 A;  4BBY A;  4DMI A;  1KJK A;  2N8X A;  1STU A;  1JK2 A;  2RQL A;  1WJP A;  2EQ3 A;  1JK1 A;  2R1F A;  1IBL E;  3IWC A;  1UN6 B;  2YTO A;  2JR1 A;  1ZR9 A;  4DR6 E;  1HNW E;  3VK6 A;  2LE2 A;  2B7T A;  2RS6 A;  2EOM A;  1N33 E;  3HQ1 A;  2EPU A;  1IQO A;  2MC6 A;  2V87 A;  1MEY C;  3BGH A;  3M99 B;  3LLH A;  2BB8 A;  2LJU A;  5FLX C;  3HXL A;  4DV7 E;  3KWR A;  4LF9 E;  4YHH E;  2EPC A;  3EPJ A;  4GKJ E;  1TF3 A;  4F2J C;  4IS1 C;  2VE7 C;  2MKD A;  4DR7 E;  1PKP A;  2EN8 A;  1A1H A;  4JI4 E;  3T1H E;  4JYA E;  5AE2 A;  2EMY A;  1HR0 E;  4MLQ A;  2EE8 A;  4JI6 E;  1BBG A;  3AUZ A;  2EN2 A;  2EWL A;  4FK5 C;  2EPA A;  2B3T B;  2V89 A;  4BHC A;  4LF6 E;  2EPO A;  4WPY A;  1FJG E;  4DR4 E;  1HNX E;  1X3C A;  2GPI A;  1X6E A;  4HEI A;  4P7D A;  4DV1 E;  1YFH A;  2EM7 A;  2B7V A;  4ZYG A;  3T1Y E;  1IBK E;  1A1K A;  2ENC A;  3HTX A;  2YSO A;  1IMU A;  4DKK A;  2EMI A;  2EPK X;  2HC5 A;  5DNY A;  2EPX A;  2EOH A;  2MKN A;  2MC5 A;  2EMH A;  2UUC E;  2BBG A;  2JYA A;  3AV0 A;  1T4N A;  4AQY E;  2UXC E;  5AAS A;  3QG5 C;  4R2E A;  2EL6 A;  4WSP A;  2YTI A;  2ADR A;  2EM4 A;  4Q28 A;  2L2K B;  2LRS A;  2WBU A;  4F54 A;  1AAY A;  2YU8 A;  2EQ1 A;  4NXM E;  2I9I A;  1N32 E;  3VYX A;  5KL3 A;  4DV6 E;  2EZ6 A;  5IT9 C;  2EQ0 A;  1YPN A;  5LL6 R;  4NXN E;  2DMI A;  5AC4 A;  5A2Q C;  2J7J A;  4HTG A;  2LUQ A;  1EH7 A;  4NZV A;  2JOX A;  2EN3 A;  1X6F A;  2YTF A;  2YTJ A;  2KOU A;  2DRP A;  2RTX A;  2EMX A;  2ELZ A;  2R76 A;  4L5N C;  2L92 A;  1RQ0 A;  2DGC A;  1WRJ A;  5LLQ A;  2EM3 A;  2YTP A;  1J5E E;  3FIG A;  1ZBQ A;  2EM9 A;  4R8O A;  2YTN A;  4TUG A;  3EPK A;  4DR5 E;  1N34 E;  2E72 A;  2DLQ A;  2MDG A;  2YU5 A;  3JAM C;  5LMN E;  3C4B A;  5F3W A;  5A69 A;  4OX9 E;  2CT1 A;  1QU6 A;  2M1S A;  4KWY A;  5A6B A;  5TSE A;  4WXD A;  2I13 A;  2V8Q B;  2CPN A;  2GLI A;  4YY3 E;  2K7I A;  2RS7 A;  4WFT A;  1B69 A;  2N3H A;  1X49 A;  2B9D A;  1T4L B;  4WXC A;  4GKK E;  1T38 A;  2UUA E;  2ELY A;  1HNZ E;  3BBG A;  4JI0 E;  2EML A;  1DGC A;  4B3T E;  3BID A;  3J81 C;  4F9A B;  1NEI A;  2EMA A;  2UXD E;  2V88 A;  1BBO A;  1IBM E;  4B3R E;  3L00 A;  2DMY A;  2ODR D;  2EL5 A;  1WXR A;  1A1J A;  3C4T A;  2F4V E;  2HGH A;  3F6G A;  4GZN C;  1EH8 A;  1T39 A;  3HPS A;  2DIX A;  1X5W A;  1YUI A;  4F6M A;  2FTX B;  3ECR A;  1XMO E;  2LMZ A;  2EOR A;  2N3G A;  2GHF A;  5T6J A;  2UUB E;  2YZT A;  2MDR A;  1TN9 A;  4DR3 E;  1X47 A;  2DSY A;  4O24 A;  2ENH A;  2YRH A;  1BB8 A;  4DV2 E;  4BS9 A;  4RH8 A;  2VF1 A;  2EL4 A;  2JVA A;  3IWB A;  2LJH A;  1GZ6 A;  3ADJ A;  4Q35 B;  2ENA A;  2JOB A;  2L33 A;  2D9H A;  4R2S A;  2K4V A;  4KZS A;  1YYK A;  4LU9 A;  1XMQ E;  1A1G A;  4LF5 E;  1X48 A;  2EJ4 A;  2CSH A;  2EPN A;  5KL7 A;  2EOJ A;  2EM8 A;  2YSP A;  3K6Q A; 
#chains in the Genus database with same CATH homology
 1RC7 A;  4NXM E;  4DV6 E;  2EZ6 A;  2L2N A;  5IT9 C;  4LF8 E;  3IWD A;  4DV0 E;  2KON A;  2M7Q A;  4DUZ E;  2RSM A;  4L8N A;  5LL6 R;  4DV4 E;  4NXN E;  4M0V A;  4F9C B;  4B3S E;  5A2Q C;  3DF6 A;  1WHQ A;  3ADL A;  2LUQ A;  3JTZ A;  2E1M A;  4J8Z A;  2JOX A;  2LTR A;  1SR9 A;  2HHH E;  2ODR C;  2LUP B;  4JV5 E;  2KOU A;  2M4I A;  2RTX A;  1ZBT A;  4DMI A;  4BBY A;  4JI5 E;  4L5N C;  4TUI A;  2L92 A;  1RQ0 A;  3J80 C;  4KHP E;  4OOG C;  1STU A;  1J5E E;  2ZM6 E;  3FIG A;  1ZBQ A;  4R8O A;  1GQE A;  4TUG A;  1IBL E;  3IWC A;  2V83 A;  4DR5 E;  1N34 E;  1J26 A;  3J7A G;  2L3J A;  3JAM C;  5LMN E;  2JR1 A;  3C4B A;  4DV3 E;  2JWO A;  2LBS B;  5F3W A;  1UIL A;  4OX9 E;  4LFC E;  2NUE A;  3VK6 A;  1QU6 A;  2M1S A;  4F9B B;  2LE2 A;  2B7T A;  2V8Q B;  2JY9 A;  2FV4 B;  2RS6 A;  3MSW A;  1N33 E;  2CPN A;  1DQ3 A;  3HQ1 A;  3DJW A;  3JU0 A;  4LFB E;  2MC6 A;  2V87 A;  5BR8 E;  2L2M A;  4YY3 E;  2UU9 E;  2L6M A;  1DI2 A;  2RS7 A;  3LLH A;  3OML A;  4WFT A;  5FLX C;  5AE1 A;  3HXL A;  4DV7 E;  2N3H A;  3KWR A;  1X49 A;  2B9D A;  4YHH E;  2NUF A;  4LF9 E;  2NUG A;  4GKJ E;  3ADG A;  4BC7 A;  1T4L B;  4JI1 E;  2VE7 C;  2VQE E;  2VQF E;  5LMU E;  2UUA E;  4JI3 E;  4GKK E;  3F6H A;  1HNZ E;  3LML A;  4GEQ B;  4DR7 E;  1PKP A;  4LTY A;  4JI4 E;  4JI0 E;  2G7H A;  4JI8 E;  3T1H E;  5IWA E;  3HPZ A;  1O0W A;  5AE3 A;  5AE2 A;  4B3T E;  4JYA E;  3J81 C;  1HR0 E;  2WZO A;  4F9A B;  4JI6 E;  1XNQ E;  3AUZ A;  2UXD E;  2V88 A;  2L3C A;  2EWL A;  3VYX A;  3H09 A;  2V89 A;  2B3T B;  1IBM E;  1YYW A;  4B3R E;  5CFF E;  2DMY A;  4LF6 E;  2ODR D;  4DR6 E;  3K6Q A;  1WXR A;  4WPY A;  3C4T A;  2E5L E;  2F4V E;  2UXB E;  4DR2 E;  1N36 E;  1FJG E;  3F6G A;  4K0K E;  1WHN A;  2IHR 1;  2FGG A;  3P1X A;  1HNX E;  1YZ9 A;  4DR4 E;  4M30 A;  4DV1 E;  3HPS A;  4P7D A;  2DIX A;  3OTO E;  2H36 X;  4BC9 A;  4X65 E;  2FTX B;  4LF7 E;  1XMO E;  2V85 A;  2LMZ A;  2N3G A;  5ADZ A;  5T6J A;  1YYO A;  2B7V A;  2UUB E;  2YZT A;  2MDR A;  4X64 E;  3T1Y E;  4DR3 E;  1I94 E;  1X47 A;  2DSY A;  4JI7 E;  1IBK E;  1FKA E;  3HTX A;  4X8W A;  3VYY A;  4DKK A;  4DV2 E;  4BS9 A;  1T4O A;  2VF1 A;  5DNY A;  4WYQ B;  1UHZ A;  4I8O A;  2YT4 A;  2JVA A;  4LFA E;  1HNW E;  2F8B A;  2L8T A;  3IWB A;  2MC5 A;  2DB2 A;  1XNR E;  2LJH A;  2LTS A;  1GZ6 A;  3ADJ A;  2UUC E;  4B3M E;  3AV0 A;  3J7Y p;  4JI2 E;  2JOB A;  1EKZ A;  2L33 A;  1T4N A;  3ADI A;  4M2Z A;  2K4V A;  2KHX A;  4KZS A;  4R03 A;  4P78 A;  5AAS A;  4X62 E;  4BMJ A;  4DUY E;  4AQY E;  1YYK A;  4DV5 E;  4LU9 A;  4BCA A;  2V86 A;  4WSP A;  1XMQ E;  4LF5 E;  1X48 A;  4X66 E;  4DR1 E;  4Q28 A;  2L2K B;  3ZOQ B;  2UXC E;  3RMP A;  2LRS A;  4LF4 E;  4F54 A;  2NA2 A;  1N32 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...