5AASA

The selective autophagy receptor tax1bp1 is required for autophagy- dependent capture of cytosolic salmonella typhimurium
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
63
structure length
63
Chain Sequence
SSFDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Autophagy Receptor Tax1BP1 and the Molecular Motor Myosin Vi are Required for Clearance of Salmonella Typhimurium by Autophagy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords TAX1-BINDING PROTEIN 1
total genus 12
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2015-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18112 Zn-C2H2_12 Autophagy receptor zinc finger-C2H2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.550 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5aasA00
2M7QA 4BMJA 5AASA
chains in the Genus database with same CATH superfamily
2LO3A 1N36E 4NXNE 4R2QA 4BC9A 2HJJA 2EMFA 2EN8A 4ZYHA 2F8BA 2EOOA 3OMLA 2ODRD 2HGHA 2V83A 4F2JC 2YRHA 4O4KA 1AAYA 2E72A 2LTSA 3K6QA 2UU9E 3C4TA 4WSPA 2EOMA 2JP9A 1YSAC 1X49A 2EN6A 1IBKE 3BGHA 2ENAA 4N4RB 1A1FA 2MC5A 4F9BB 1FKAE 4DV6E 2EPPA 2L6MA 2YTDA 2MC6A 2J7JA 2WZOA 2EN1A 4R2SA 4JI3E 2EOFA 1HNWE 2WBTA 4JI5E 1IQSA 5CFFE 2RQLA 2FV4B 2ODRC 2YZTA 4YHHE 2V86A 1XMQE 5TSEA 4WFTA 2JPAA 2K7IA 2EL5A 2B7VA 2YTOA 4LF5E 5T6JA 4R2AA 2FTXB 4B3ME 2DIXA 2LV2A 5LMNE 4WX9A 2YTFA 1YYKA 4ZYGA 5KL3A 4GKKE 4LF8E 4LU9A 5AC4A 2EN7A 2ENCA 4K0KE 2LTRA 2UUCE 2EPUA 2VE7C 1F2IG 2LUPB 3HPSA 4F9CB 4B3SE 2EPRA 2M4IA 4DV5E 4LF4E 2EPMX 5IWAE 2EM9A 3L00A 1DI2A 1Z1BA 4M9VC 3MSWA 2EMBA 2LBSB 1KJKA 2EOSA 4F54A 2EZ6A 4MLVA 2F4VE 3IWDA 1T38A 1HNZE 5DNYA 1BB8A 2N8XA 4RHBB 4BCAA 3JTZA 4OOGC 4BHCA 4P7DA 4KHPE 2M7QA 2V8QB 3MHSC 1XNQE 4NXME 2K4VA 4JYAE 5BR8E 2JXPA 4Q35B 3EPKA 3C4BA 4DV7E 2GHFA 2EOZA 1PJTA 1X6HA 4TUGA 2VRDA 2E1MA 2MKDA 4O24A 4R03A 2WBSA 2YTPA 2EM5A 2EMYA 2UXBE 1GQEA 1T4LB 1FJGE 3QG5C 2UUBE 2EP3A 2JY9A 2YTNA 4MLQA 4R2CA 3EPHA 4GZNC 3C6MA 5KL5A 2ELZA 2L92A 2I9IA 3JU0A 1I94E 2EJ4A 2EOYA 2L33A 3DF6A 1G2DC 2LUQA 1EKZA 1KYQA 4J8ZA 4JI8E 1YZ9A 3ADIA 2V88A 2EMWA 4LFAE 3ADLA 1N32E 1J26A 4I8OA 2EM7A 3H09A 1YPNA 1IMUA 1IBLE 2CSHA 2WBUA 4NHRA 5LMUE 4YY3E 2V85A 4X65E 5LLQA 4P78A 1XMOE 3BF2A 3ZOQB 2EM2A 3BIDA 1L4SA 2JOBA 2DMIA 2YU8A 3ADGA 4DV0E 3VYXA 5KL4A 4F6NA 4DR2E 1DQ3A 1PDAA 3UK3C 1YUIA 4B3TE 1HR0E 5AE3A 2EM0A 2NUGA 5A2QC 2B9DA 2CTDA 4R2RA 3TQMA 2M9AA 1IQOA 3BBGA 5KL2A 2YTIA 2EMGA 1ZU1A 2B3TB 2EMCA 1SFEA 4DR7E 5F3WA 2DSYA 4F9AB 2EM4A 1HNXE 4OX9E 5ADZA 2EMZA 2LCEA 2KONA 2MKNA 2RSMA 5AE2A 2FGGA 2N3GA 2EORA 1X6EA 3F6HA 2EN2A 2EWLA 2JWOA 1BBGA 1LLMC 1NCSA 2YT4A 4BHBA 2EMHA 3EPLA 4L5NC 4TUIA 3J7AG 2RPCA 1X5WA 1MGTA 3J80C 4DV2E 2DB2A 2MDGA 1EH6A 4R2PA 2CT1A 1N34E 3T1HE 2L3CA 3KZYA 3RMPA 1QNTA 1GZ6A 1YYOA 1A1IA 2B7TA 2VF1A 4HTGA 2PRTA 2DMYA 2EOXA 4DR1E 5A6BD 3M99B 3F6GA 4WPYA 1T39A 1RQ0A 2YTJA 3KZZA 3AUZA 2EOEA 2M1SA 4KZSA 1O0WA 1WJPA 3IWBA 1YFHA 1A1JA 2GLIA 5FLXC 5AE1A 4JI2E 2LVHA 1QU6A 4DKKA 2EPXA 2YRMA 2EMAA 1JK1A 2EM3A 2EQ1A 1XNRE 3HTXA 4F6MA 4JI6E 2CPNA 4RH8A 1ZAAC 4JI4E 2YSPA 4DR4E 2ZM6E 1G2FC 2LT7A 2LRSA 4FK5C 2EMIA 1MEYC 1NEIA 1AH5A 3THOB 3HQ1A 5AASA 5KL6A 1A1GA 4X64E 2YSOA 4LF6E 2EM8A 2EOJA 5IT9C 3ADJA 1UBDC 2EN4A 3MHHC 2EN3A 2NUFA 4M2ZA 2EPOA 5A69A 2EPZA 2JOXA 1T4NA 4M0VA 1EH8A 4DR5E 4LFBE 1ZBTA 2EQ3A 4BBYA 1J5EE 2LJHA 4JI7E 1UILA 4AQYE 3LLHA 4WSGA 2EL4A 2EMLA 3LMLA 4O43A 4DMIA 2G7HA 4B3RE 2RSIA 4LF7E 2RS6A 2DRPA 2JYAA 2E5LE 2L2KB 1TF3A 2NA2A 1B69A 1P47A 2I13A 2YWQA 4WXDA 4BC7A 2YTGA 2LJUA 3VHTB 3EQ1A 2EPAA 2JVAA 2LE2A 2L8TA 4DR3E 2YTQA 2MDRA 1X47A 2UXDE 1N33E 1TN9A 2YPNA 1ZBQA 2ADRA 1EH7A 2EMXA 2H36X 3EPJA 3VK6A 1STUA 1JK2A 5KL7A 4DV4E 2D9HA 2HHHE 1ZR9A 2L2MA 4GEQB 5A6BA 2EE8A 3HXLA 5AC5A 2R76A 2YTEA 1PJSA 1WRJA 5LL6R 2BB8A 4R8OA 1IBME 2ELYA 4WXCA 4JV5E 1DGCA 4IJDA 4LTYA 2EQ0A 3P1XA 4ZYDA 1BBOA 2NABA 2KHXA 4O5GA 5A6JA 1RC7A 1X48A 2R1FA 1N3GA 1PKPA 1YYWA 4DR6E 2HC5A 2LMZA 2EMKA 5IV8B 1TF6A 4HEIA 1T4OA 2DLQA 1SR9A 2RTXA 1X3CA 2V89A 2YRKA 2YU5A 1A1HA 4Q28A 1GTKA 2JR1A 2L3JA 2BBGA 2GPIA 5A6KA 2EM6A 4IS1C 3T1YE 4DV1E 1YUJA 2EL6A 3J7Yp 1WHQA 3JAMC 4X8WA 4X62E 4LFCE 3HPZA 3FIGA 4R2EA 2EOHA 3OTOE 2V87A 2EPLX 4NZVA 3AV0A 2DLKA 2Q8UA 4JI0E 4M30A 4KWYA 2VQFE 3J81C 2UXCE 2WCC3 4JI1E 4BS9A 2L2NA 2DGCA 3THNA 2KOUA 1WHNA 2EOIA 3KWRA 3IWCA 1A1LA 2EPNA 2N3HA 3DJWA 4BMJA 4L8NA 4ZYEA 4LF9E 4X9JA 2A25A 4DV3E 4DUZE 3C6KA 3ECRA 1WXRA 4GKJE 2IHR1 1PJQA 1A1KA 4DUYE 5IXMB 2UUAE 5A6AA 1UHZA 4X66E 1UN6B 2NUEA 3VYYA 1RMDA 2ENHA 4WYQB 2VQEE 1X6FA 2RS7A 4R2DA 2EOQA 2EPKX 2EPCA
chains in the Genus database with same CATH topology
5BR8E 2MDRA 1N36E 4NXNE 1X47A 3F6HA 4BC9A 2UXDE 1N33E 2EWLA 1ZBQA 3C4BA 2JWOA 4DV7E 2F8BA 2YT4A 4TUGA 2H36X 2E1MA 4L5NC 3OMLA 1STUA 2ODRD 3VK6A 4TUIA 4DV4E 4R03A 2V83A 2HHHE 2L2MA 4GEQB 3J7AG 3HXLA 3J80C 4DV2E 2DB2A 2LTSA 3K6QA 2UU9E 2UXBE 3C4TA 1GQEA 4WSPA 5LL6R 3T1HE 1T4LB 1N34E 1FJGE 2L3CA 4R8OA 1IBME 3RMPA 2UUBE 1GZ6A 2JY9A 4LTYA 1YYOA 4JV5E 2B7TA 2VF1A 1X49A 3P1XA 1IBKE 2DMYA 4DR1E 2KHXA 2L92A 2NUEA 1RC7A 1X48A 2MC5A 3F6GA 4F9BB 4WPYA 1FKAE 1PKPA 1RQ0A 4DV6E 3JU0A 1I94E 1YYWA 3AUZA 2LMZA 4DR6E 2M1SA 2L6MA 1O0WA 4KZSA 3IWBA 2MC6A 1T4OA 2WZOA 2L33A 3DF6A 1SR9A 2RTXA 5FLXC 2V89A 5AE1A 2LUQA 4JI2E 4Q28A 4JI3E 1EKZA 1YZ9A 4J8ZA 4JI8E 1HNWE 2JR1A 1QU6A 2L3JA 5CFFE 4JI5E 2V88A 3ADIA 4DKKA 4LFAE 2FV4B 2ODRC 2YZTA 4YHHE 3T1YE 1N32E 2V86A 1XMQE 3ADLA 1J26A 4DV1E 4I8OA 4WFTA 3J7Yp 1WHQA 3JAMC 3VYXA 4X8WA 3H09A 4X62E 4LFCE 3HPZA 3FIGA 2B7VA 1IBLE 4JYAE 1XNRE 4LF5E 3HTXA 5T6JA 3OTOE 5LMUE 2FTXB 4B3ME 2DIXA 2CPNA 4JI6E 2V87A 4YY3E 2V85A 5LMNE 4JI4E 3AV0A 4DR4E 4X65E 2ZM6E 4JI0E 1YYKA 4P78A 4M30A 1XMOE 4GKKE 2VQFE 2LRSA 3ZOQB 3J81C 4LF8E 2UXCE 4LU9A 4JI1E 4BS9A 2L2NA 2JOBA 3HQ1A 5AASA 4K0KE 2KOUA 2LTRA 4X64E 1WHNA 3ADGA 4DV0E 2UUCE 3KWRA 2VE7C 4LF6E 3IWCA 4DR2E 5IT9C 1DQ3A 2LUPB 3ADJA 4DR3E 3HPSA 4F9CB 4B3SE 2M4IA 2N3HA 3DJWA 4BMJA 4L8NA 4DV5E 2NUFA 4B3TE 4LF4E 1HR0E 4LF9E 4M2ZA 5IWAE 5AE3A 1DI2A 4DV3E 4DUZE 2JOXA 1T4NA 2B9DA 4M0VA 5A2QC 2NUGA 3MSWA 1WXRA 2LBSB 4DR5E 4LFBE 4GKJE 1ZBTA 2IHR1 4F54A 4BBYA 1J5EE 2EZ6A 2LJHA 4JI7E 2F4VE 1UILA 2B3TB 3IWDA 3LLHA 4AQYE 1HNZE 5DNYA 3LMLA 4DMIA 4DUYE 2UUAE 4DR7E 5F3WA 2G7HA 4B3RE 1UHZA 2DSYA 2RS6A 4F9AB 4X66E 4BCAA 1HNXE 3VYYA 5ADZA 4LF7E 4OX9E 4WYQB 3JTZA 2E5LE 2VQEE 2L2KB 2NA2A 4OOGC 4P7DA 2KONA 4KHPE 2RSMA 2RS7A 4BC7A 2M7QA 5AE2A 2FGGA 2JVAA 2V8QB 2LE2A 1XNQE 4NXME 2N3GA 2L8TA 2K4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M7Q A;  4BMJ A;  5AAS A; 
#chains in the Genus database with same CATH topology
 2LO3 A;  1N36 E;  4NXN E;  4R2Q A;  4BC9 A;  2HJJ A;  2EMF A;  2EN8 A;  4ZYH A;  2F8B A;  2EOO A;  3OML A;  2ODR D;  2HGH A;  2V83 A;  4F2J C;  2YRH A;  4O4K A;  1AAY A;  2E72 A;  2LTS A;  3K6Q A;  2UU9 E;  3C4T A;  4WSP A;  2EOM A;  2JP9 A;  1YSA C;  1X49 A;  2EN6 A;  1IBK E;  3BGH A;  2ENA A;  4N4R B;  1A1F A;  2MC5 A;  4F9B B;  1FKA E;  4DV6 E;  2EPP A;  2L6M A;  2YTD A;  2MC6 A;  2J7J A;  2WZO A;  2EN1 A;  4R2S A;  4JI3 E;  2EOF A;  1HNW E;  2WBT A;  4JI5 E;  1IQS A;  5CFF E;  2RQL A;  2FV4 B;  2ODR C;  2YZT A;  4YHH E;  2V86 A;  1XMQ E;  5TSE A;  4WFT A;  2JPA A;  2K7I A;  2EL5 A;  2B7V A;  2YTO A;  4LF5 E;  5T6J A;  4R2A A;  2FTX B;  4B3M E;  2DIX A;  2LV2 A;  5LMN E;  4WX9 A;  2YTF A;  1YYK A;  4ZYG A;  5KL3 A;  4GKK E;  4LF8 E;  4LU9 A;  5AC4 A;  2EN7 A;  2ENC A;  4K0K E;  2LTR A;  2UUC E;  2EPU A;  2VE7 C;  1F2I G;  2LUP B;  3HPS A;  4F9C B;  4B3S E;  2EPR A;  2M4I A;  4DV5 E;  4LF4 E;  2EPM X;  5IWA E;  2EM9 A;  3L00 A;  1DI2 A;  1Z1B A;  4M9V C;  3MSW A;  2EMB A;  2LBS B;  1KJK A;  2EOS A;  4F54 A;  2EZ6 A;  4MLV A;  2F4V E;  3IWD A;  1T38 A;  1HNZ E;  5DNY A;  1BB8 A;  2N8X A;  4RHB B;  4BCA A;  3JTZ A;  4OOG C;  4BHC A;  4P7D A;  4KHP E;  2M7Q A;  2V8Q B;  3MHS C;  1XNQ E;  4NXM E;  2K4V A;  4JYA E;  5BR8 E;  2JXP A;  4Q35 B;  3EPK A;  3C4B A;  4DV7 E;  2GHF A;  2EOZ A;  1PJT A;  1X6H A;  4TUG A;  2VRD A;  2E1M A;  2MKD A;  4O24 A;  4R03 A;  2WBS A;  2YTP A;  2EM5 A;  2EMY A;  2UXB E;  1GQE A;  1T4L B;  1FJG E;  3QG5 C;  2UUB E;  2EP3 A;  2JY9 A;  2YTN A;  4MLQ A;  4R2C A;  3EPH A;  4GZN C;  3C6M A;  5KL5 A;  2ELZ A;  2L92 A;  2I9I A;  3JU0 A;  1I94 E;  2EJ4 A;  2EOY A;  2L33 A;  3DF6 A;  1G2D C;  2LUQ A;  1EKZ A;  1KYQ A;  4J8Z A;  4JI8 E;  1YZ9 A;  3ADI A;  2V88 A;  2EMW A;  4LFA E;  3ADL A;  1N32 E;  1J26 A;  4I8O A;  2EM7 A;  3H09 A;  1YPN A;  1IMU A;  1IBL E;  2CSH A;  2WBU A;  4NHR A;  5LMU E;  4YY3 E;  2V85 A;  4X65 E;  5LLQ A;  4P78 A;  1XMO E;  3BF2 A;  3ZOQ B;  2EM2 A;  3BID A;  1L4S A;  2JOB A;  2DMI A;  2YU8 A;  3ADG A;  4DV0 E;  3VYX A;  5KL4 A;  4F6N A;  4DR2 E;  1DQ3 A;  1PDA A;  3UK3 C;  1YUI A;  4B3T E;  1HR0 E;  5AE3 A;  2EM0 A;  2NUG A;  5A2Q C;  2B9D A;  2CTD A;  4R2R A;  3TQM A;  2M9A A;  1IQO A;  3BBG A;  5KL2 A;  2YTI A;  2EMG A;  1ZU1 A;  2B3T B;  2EMC A;  1SFE A;  4DR7 E;  5F3W A;  2DSY A;  4F9A B;  2EM4 A;  1HNX E;  4OX9 E;  5ADZ A;  2EMZ A;  2LCE A;  2KON A;  2MKN A;  2RSM A;  5AE2 A;  2FGG A;  2N3G A;  2EOR A;  1X6E A;  3F6H A;  2EN2 A;  2EWL A;  2JWO A;  1BBG A;  1LLM C;  1NCS A;  2YT4 A;  4BHB A;  2EMH A;  3EPL A;  4L5N C;  4TUI A;  3J7A G;  2RPC A;  1X5W A;  1MGT A;  3J80 C;  4DV2 E;  2DB2 A;  2MDG A;  1EH6 A;  4R2P A;  2CT1 A;  1N34 E;  3T1H E;  2L3C A;  3KZY A;  3RMP A;  1QNT A;  1GZ6 A;  1YYO A;  1A1I A;  2B7T A;  2VF1 A;  4HTG A;  2PRT A;  2DMY A;  2EOX A;  4DR1 E;  5A6B D;  3M99 B;  3F6G A;  4WPY A;  1T39 A;  1RQ0 A;  2YTJ A;  3KZZ A;  3AUZ A;  2EOE A;  2M1S A;  4KZS A;  1O0W A;  1WJP A;  3IWB A;  1YFH A;  1A1J A;  2GLI A;  5FLX C;  5AE1 A;  4JI2 E;  2LVH A;  1QU6 A;  4DKK A;  2EPX A;  2YRM A;  2EMA A;  1JK1 A;  2EM3 A;  2EQ1 A;  1XNR E;  3HTX A;  4F6M A;  4JI6 E;  2CPN A;  4RH8 A;  1ZAA C;  4JI4 E;  2YSP A;  4DR4 E;  2ZM6 E;  1G2F C;  2LT7 A;  2LRS A;  4FK5 C;  2EMI A;  1MEY C;  1NEI A;  1AH5 A;  3THO B;  3HQ1 A;  5AAS A;  5KL6 A;  1A1G A;  4X64 E;  2YSO A;  4LF6 E;  2EM8 A;  2EOJ A;  5IT9 C;  3ADJ A;  1UBD C;  2EN4 A;  3MHH C;  2EN3 A;  2NUF A;  4M2Z A;  2EPO A;  5A69 A;  2EPZ A;  2JOX A;  1T4N A;  4M0V A;  1EH8 A;  4DR5 E;  4LFB E;  1ZBT A;  2EQ3 A;  4BBY A;  1J5E E;  2LJH A;  4JI7 E;  1UIL A;  4AQY E;  3LLH A;  4WSG A;  2EL4 A;  2EML A;  3LML A;  4O43 A;  4DMI A;  2G7H A;  4B3R E;  2RSI A;  4LF7 E;  2RS6 A;  2DRP A;  2JYA A;  2E5L E;  2L2K B;  1TF3 A;  2NA2 A;  1B69 A;  1P47 A;  2I13 A;  2YWQ A;  4WXD A;  4BC7 A;  2YTG A;  2LJU A;  3VHT B;  3EQ1 A;  2EPA A;  2JVA A;  2LE2 A;  2L8T A;  4DR3 E;  2YTQ A;  2MDR A;  1X47 A;  2UXD E;  1N33 E;  1TN9 A;  2YPN A;  1ZBQ A;  2ADR A;  1EH7 A;  2EMX A;  2H36 X;  3EPJ A;  3VK6 A;  1STU A;  1JK2 A;  5KL7 A;  4DV4 E;  2D9H A;  2HHH E;  1ZR9 A;  2L2M A;  4GEQ B;  5A6B A;  2EE8 A;  3HXL A;  5AC5 A;  2R76 A;  2YTE A;  1PJS A;  1WRJ A;  5LL6 R;  2BB8 A;  4R8O A;  1IBM E;  2ELY A;  4WXC A;  4JV5 E;  1DGC A;  4IJD A;  4LTY A;  2EQ0 A;  3P1X A;  4ZYD A;  1BBO A;  2NAB A;  2KHX A;  4O5G A;  5A6J A;  1RC7 A;  1X48 A;  2R1F A;  1N3G A;  1PKP A;  1YYW A;  4DR6 E;  2HC5 A;  2LMZ A;  2EMK A;  5IV8 B;  1TF6 A;  4HEI A;  1T4O A;  2DLQ A;  1SR9 A;  2RTX A;  1X3C A;  2V89 A;  2YRK A;  2YU5 A;  1A1H A;  4Q28 A;  1GTK A;  2JR1 A;  2L3J A;  2BBG A;  2GPI A;  5A6K A;  2EM6 A;  4IS1 C;  3T1Y E;  4DV1 E;  1YUJ A;  2EL6 A;  3J7Y p;  1WHQ A;  3JAM C;  4X8W A;  4X62 E;  4LFC E;  3HPZ A;  3FIG A;  4R2E A;  2EOH A;  3OTO E;  2V87 A;  2EPL X;  4NZV A;  3AV0 A;  2DLK A;  2Q8U A;  4JI0 E;  4M30 A;  4KWY A;  2VQF E;  3J81 C;  2UXC E;  2WCC 3;  4JI1 E;  4BS9 A;  2L2N A;  2DGC A;  3THN A;  2KOU A;  1WHN A;  2EOI A;  3KWR A;  3IWC A;  1A1L A;  2EPN A;  2N3H A;  3DJW A;  4BMJ A;  4L8N A;  4ZYE A;  4LF9 E;  4X9J A;  2A25 A;  4DV3 E;  4DUZ E;  3C6K A;  3ECR A;  1WXR A;  4GKJ E;  2IHR 1;  1PJQ A;  1A1K A;  4DUY E;  5IXM B;  2UUA E;  5A6A A;  1UHZ A;  4X66 E;  1UN6 B;  2NUE A;  3VYY A;  1RMD A;  2ENH A;  4WYQ B;  2VQE E;  1X6F A;  2RS7 A;  4R2D A;  2EOQ A;  2EPK X;  2EPC A; 
#chains in the Genus database with same CATH homology
 5BR8 E;  2MDR A;  1N36 E;  4NXN E;  1X47 A;  3F6H A;  4BC9 A;  2UXD E;  1N33 E;  2EWL A;  1ZBQ A;  3C4B A;  2JWO A;  4DV7 E;  2F8B A;  2YT4 A;  4TUG A;  2H36 X;  2E1M A;  4L5N C;  3OML A;  1STU A;  2ODR D;  3VK6 A;  4TUI A;  4DV4 E;  4R03 A;  2V83 A;  2HHH E;  2L2M A;  4GEQ B;  3J7A G;  3HXL A;  3J80 C;  4DV2 E;  2DB2 A;  2LTS A;  3K6Q A;  2UU9 E;  2UXB E;  3C4T A;  1GQE A;  4WSP A;  5LL6 R;  3T1H E;  1T4L B;  1N34 E;  1FJG E;  2L3C A;  4R8O A;  1IBM E;  3RMP A;  2UUB E;  1GZ6 A;  2JY9 A;  4LTY A;  1YYO A;  4JV5 E;  2B7T A;  2VF1 A;  1X49 A;  3P1X A;  1IBK E;  2DMY A;  4DR1 E;  2KHX A;  2L92 A;  2NUE A;  1RC7 A;  1X48 A;  2MC5 A;  3F6G A;  4F9B B;  4WPY A;  1FKA E;  1PKP A;  1RQ0 A;  4DV6 E;  3JU0 A;  1I94 E;  1YYW A;  3AUZ A;  2LMZ A;  4DR6 E;  2M1S A;  2L6M A;  1O0W A;  4KZS A;  3IWB A;  2MC6 A;  1T4O A;  2WZO A;  2L33 A;  3DF6 A;  1SR9 A;  2RTX A;  5FLX C;  2V89 A;  5AE1 A;  2LUQ A;  4JI2 E;  4Q28 A;  4JI3 E;  1EKZ A;  1YZ9 A;  4J8Z A;  4JI8 E;  1HNW E;  2JR1 A;  1QU6 A;  2L3J A;  5CFF E;  4JI5 E;  2V88 A;  3ADI A;  4DKK A;  4LFA E;  2FV4 B;  2ODR C;  2YZT A;  4YHH E;  3T1Y E;  1N32 E;  2V86 A;  1XMQ E;  3ADL A;  1J26 A;  4DV1 E;  4I8O A;  4WFT A;  3J7Y p;  1WHQ A;  3JAM C;  3VYX A;  4X8W A;  3H09 A;  4X62 E;  4LFC E;  3HPZ A;  3FIG A;  2B7V A;  1IBL E;  4JYA E;  1XNR E;  4LF5 E;  3HTX A;  5T6J A;  3OTO E;  5LMU E;  2FTX B;  4B3M E;  2DIX A;  2CPN A;  4JI6 E;  2V87 A;  4YY3 E;  2V85 A;  5LMN E;  4JI4 E;  3AV0 A;  4DR4 E;  4X65 E;  2ZM6 E;  4JI0 E;  1YYK A;  4P78 A;  4M30 A;  1XMO E;  4GKK E;  2VQF E;  2LRS A;  3ZOQ B;  3J81 C;  4LF8 E;  2UXC E;  4LU9 A;  4JI1 E;  4BS9 A;  2L2N A;  2JOB A;  3HQ1 A;  5AAS A;  4K0K E;  2KOU A;  2LTR A;  4X64 E;  1WHN A;  3ADG A;  4DV0 E;  2UUC E;  3KWR A;  2VE7 C;  4LF6 E;  3IWC A;  4DR2 E;  5IT9 C;  1DQ3 A;  2LUP B;  3ADJ A;  4DR3 E;  3HPS A;  4F9C B;  4B3S E;  2M4I A;  2N3H A;  3DJW A;  4BMJ A;  4L8N A;  4DV5 E;  2NUF A;  4B3T E;  4LF4 E;  1HR0 E;  4LF9 E;  4M2Z A;  5IWA E;  5AE3 A;  1DI2 A;  4DV3 E;  4DUZ E;  2JOX A;  1T4N A;  2B9D A;  4M0V A;  5A2Q C;  2NUG A;  3MSW A;  1WXR A;  2LBS B;  4DR5 E;  4LFB E;  4GKJ E;  1ZBT A;  2IHR 1;  4F54 A;  4BBY A;  1J5E E;  2EZ6 A;  2LJH A;  4JI7 E;  2F4V E;  1UIL A;  2B3T B;  3IWD A;  3LLH A;  4AQY E;  1HNZ E;  5DNY A;  3LML A;  4DMI A;  4DUY E;  2UUA E;  4DR7 E;  5F3W A;  2G7H A;  4B3R E;  1UHZ A;  2DSY A;  2RS6 A;  4F9A B;  4X66 E;  4BCA A;  1HNX E;  3VYY A;  5ADZ A;  4LF7 E;  4OX9 E;  4WYQ B;  3JTZ A;  2E5L E;  2VQE E;  2L2K B;  2NA2 A;  4OOG C;  4P7D A;  2KON A;  4KHP E;  2RSM A;  2RS7 A;  4BC7 A;  2M7Q A;  5AE2 A;  2FGG A;  2JVA A;  2V8Q B;  2LE2 A;  1XNQ E;  4NXM E;  2N3G A;  2L8T A;  2K4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...