5AASA

The selective autophagy receptor tax1bp1 is required for autophagy- dependent capture of cytosolic salmonella typhimurium
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
63
structure length
63
Chain Sequence
SSFDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAX1-BINDING PROTEIN 1
publication title The Autophagy Receptor Tax1BP1 and the Molecular Motor Myosin Vi are Required for Clearance of Salmonella Typhimurium by Autophagy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 12
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2015-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18112 Zn-C2H2_12 Autophagy receptor zinc finger-C2H2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.550 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5aasA00
4BMJA 2M7QA 5AASA
chains in the Genus database with same CATH superfamily
4ZYHA 2DMYA 4R2PA 1EKZA 5BR8E 3BBGA 4IS1C 1N33E 1T39A 4B3RE 2EJ4A 2RQLA 1NCSA 3FIGA 2EPPA 1FJGE 2M4IA 2V83A 3ADIA 4HEIA 2UU9E 1HNWE 2EMKA 2EM9A 3HTXA 3BF2A 1X3CA 1IQOA 2EM8A 2LV2A 1A1FA 3ADJA 2MDGA 5KL5A 3F6HA 1ZU1A 3AUZA 1YYKA 2ENAA 2YRMA 4JV5E 1WRJA 2KONA 4DUYE 5LLQA 1HNZE 2FGGA 5AE3A 2DLKA 4X66E 4DR7E 5IT9C 2EMXA 2HJJA 2E1MA 2EOJA 5ADZA 3T1YE 1IBKE 2CPNA 3L00A 4F2JC 3K6QA 2YWQA 2EM3A 1X48A 4M2ZA 2JOXA 2PRTA 1DGCA 4BHBA 1L4SA 2EE8A 2EPOA 3EPJA 1FKAE 2MKDA 3MHHC 2EN4A 4K0KE 1WXRA 2YPNA 1YUIA 2KHXA 1HR0E 1MGTA 1PJTA 2EMYA 1WJPA 3H09A 4B3ME 4DR4E 1P47A 4F54A 2H36X 4WXDA 2L33A 1UILA 4RH8A 5IWAE 3AV0A 2RSMA 2CT1A 5A6JA 2L2NA 2NA2A 1WHQA 4B3TE 1STUA 2VQFE 2UXBE 4P7DA 1GZ6A 1RC7A 2ODRD 2EOMA 2J7JA 5AE2A 4LF8E 2L3CA 1JK1A 4YY3E 2YU8A 2YU5A 1YYOA 4F6NA 1PKPA 3EPKA 2YSPA 4JI5E 1IBLE 2HHHE 4BBYA 2EMWA 4Q28A 4R2DA 4DR5E 1A1LA 4Q35B 2EWLA 4ZYGA 1X6EA 2I13A 2B7TA 2EN8A 2V8QB 4J8ZA 2Q8UA 2MKNA 2NUGA 2WBSA 2EPAA 2EMLA 3DJWA 2N3HA 4GKJE 4BHCA 3HPZA 1N32E 2EPKX 2DRPA 2VE7C 3J80C 2EL6A 2ADRA 2EOFA 4JI3E 2V88A 2CSHA 1PJQA 3KZZA 4X8WA 1RQ0A 4LF7E 1PJSA 2EMAA 2LMZA 2YTFA 4X9JA 1KYQA 2F8BA 4DUZE 2DSYA 2V86A 1GTKA 3C6KA 1IQSA 1EH7A 2EL5A 4KWYA 3UK3C 4GEQB 4M9VC 2N3GA 4DV4E 3QG5C 1A1IA 5KL6A 2EMGA 3OTOE 3THNA 2EPXA 2UXCE 1AH5A 2RPCA 4TUGA 2YTOA 4P78A 2LUPB 4NHRA 4DV0E 3OMLA 4JI7E 2VQEE 4O43A 5LMUE 5AC4A 4RHBB 3BIDA 2YZTA 2LE2A 2JWOA 2EN2A 4F9AB 2YTDA 1J5EE 5A2QC 2E5LE 4R2EA 3JAMC 2LJUA 3RMPA 2EM4A 2MDRA 4LF5E 4DV1E 1N36E 4AQYE 2BB8A 2EPCA 1J26A 1NEIA 4OOGC 1BB8A 2JP9A 5KL3A 1KJKA 4DR1E 4O5GA 2LJHA 2YTQA 2UUCE 3VYXA 4DR2E 2V87A 2UUBE 2R1FA 2EPRA 2A25A 2LCEA 2I9IA 2LTSA 2EP3A 2NUFA 3BGHA 2EPNA 4WFTA 4GKKE 2YT4A 3C6MA 2EN6A 4DKKA 2EM6A 3T1HE 2DIXA 4LFCE 2EL4A 1AAYA 1MEYC 1YZ9A 4LF4E 1A1JA 4R2CA 5CFFE 3EPHA 2UUAE 4X62E 2HC5A 2FV4B 4M0VA 1BBOA 3LLHA 1ZAAC 1YPNA 3IWCA 1G2DC 1EH6A 2YTPA 4OX9E 3IWBA 1X49A 2CTDA 1X47A 1G2FC 4GZNC 4L5NC 4DV5E 3EPLA 3JU0A 2DB2A 2K4VA 5TSEA 4WYQB 3C4BA 2YTIA 2B9DA 2IHR1 4I8OA 1YSAC 2B3TB 2EMBA 4F9CB 1SFEA 4NZVA 2LBSB 2RTXA 4DR3E 2YTJA 3C4TA 4YHHE 5A69A 2EOIA 2NABA 4TUIA 3EQ1A 1HNXE 2M9AA 4R2QA 2WZOA 2M1SA 1QU6A 4LFAE 2HGHA 2V89A 4LFBE 3MHSC 5IXMB 4BCAA 2WBUA 3ZOQB 1XNRE 1JK2A 2EOSA 4WPYA 2RSIA 5AASA 1YFHA 4WX9A 1ZR9A 2EPUA 4JI4E 1N3GA 2EPLX 2DMIA 2WCC3 1X6HA 3J7Yp 2RS6A 2JXPA 2G7HA 2EOZA 5AE1A 2K7IA 2DLQA 1YYWA 5LMNE 4O4KA 3TQMA 4LTYA 2ELYA 3MSWA 2LTRA 3LMLA 2EM5A 2ELZA 2EOXA 1Z1BA 2B7VA 2DGCA 2UXDE 1WHNA 2EOEA 4ZYEA 5A6BD 1TF6A 3ECRA 1IBME 2EMFA 4WXCA 1DQ3A 1TF3A 2EORA 5T6JA 2EQ0A 2ENHA 2KOUA 2M7QA 1N34E 5KL7A 2D9HA 4KZSA 4FK5C 4HTGA 1ZBQA 3ADLA 3F6GA 3HXLA 4BC7A 5F3WA 4DR6E 2L8TA 2JPAA 3THOB 2LRSA 4F6MA 2EN3A 4R8OA 4JI8E 2BBGA 2EMZA 2EQ3A 2N8XA 2V85A 1B69A 4DV2E 1PDAA 1T4OA 5KL4A 2JYAA 3P1XA 4F9BB 4R2SA 2VF1A 2GLIA 4KHPE 1BBGA 2YSOA 4DV7E 2EOHA 4N4RB 3KWRA 2EOYA 1XMQE 1A1HA 2ENCA 2LUQA 5LL6R 4LF6E 2EOQA 2EN1A 1A1GA 2EM2A 2EMHA 2L2MA 1QNTA 3HPSA 2YRHA 2EN7A 4R03A 1LLMC 2EM7A 3ADGA 4JI2E 3HQ1A 4JI6E 1SR9A 4X65E 4BMJA 1O0WA 5IV8B 2JR1A 4M30A 3KZYA 4DMIA 1XNQE 1EH8A 4LU9A 2L6MA 4X64E 3VYYA 4JYAE 1UHZA 1I94E 4BC9A 2F4VE 2FTXB 1ZBTA 1TN9A 2EPMX 1T4LB 3M99B 4BS9A 1A1KA 2LVHA 2ZM6E 2EM0A 2LT7A 2LO3A 2MC5A 3JTZA 2GHFA 2MC6A 1X6FA 2YTGA 2EMIA 4WSPA 2L2KB 4L8NA 2WBTA 5A6BA 5DNYA 4O24A 5A6AA 4R2RA 1RMDA 2EMCA 4IJDA 1XMOE 4NXNE 1F2IG 2EZ6A 4MLQA 4B3SE 1YUJA 4ZYDA 4NXME 2JY9A 2NUEA 3J81C 5A6KA 4LF9E 1GQEA 5AC5A 4DV3E 4JI0E 2YTNA 2JOBA 2E72A 1DI2A 2EQ1A 3IWDA 4R2AA 2RS7A 4MLVA 1UN6B 3DF6A 2YRKA 1T38A 2ODRC 4DV6E 2YTEA 3J7AG 1T4NA 5KL2A 1X5WA 2VRDA 3VK6A 1IMUA 1UBDC 2EPZA 2GPIA 2R76A 3VHTB 2EOOA 5FLXC 2L3JA 4WSGA 2L92A 2JVAA 4JI1E
chains in the Genus database with same CATH topology
4DV2E 2DMYA 4LFCE 1T4OA 2B7TA 1EKZA 2V8QB 3P1XA 4F9BB 1YZ9A 5BR8E 4J8ZA 4LF4E 2NUGA 2VF1A 5CFFE 4KHPE 2UUAE 4DV7E 4B3RE 1N33E 4X62E 3DJWA 2FV4B 3FIGA 3KWRA 2N3HA 4M0VA 1XMQE 3LLHA 4GKJE 2LUQA 5LL6R 2M4IA 4LF6E 1FJGE 2V83A 3HPZA 2UU9E 3ADIA 1HNWE 3IWCA 1N32E 2VE7C 3HTXA 4OX9E 3IWBA 1X49A 3J80C 2L2MA 1X47A 3HPSA 4R03A 4L5NC 3ADJA 4JI3E 3ADGA 4DV5E 3F6HA 3JU0A 2DB2A 2V88A 4JI2E 3HQ1A 2K4VA 4JI6E 1SR9A 4WYQB 4X8WA 3AUZA 4BMJA 4X65E 1YYKA 1RQ0A 4LF7E 1O0WA 4JV5E 3C4BA 2KONA 2B9DA 2IHR1 2JR1A 2LMZA 4I8OA 4M30A 4DUYE 1HNZE 2FGGA 2B3TB 2F8BA 4DMIA 1XNQE 4F9CB 5AE3A 4DUZE 2DSYA 2LBSB 2V86A 2RTXA 4X66E 4LU9A 4DR3E 3C4TA 4YHHE 4DR7E 5IT9C 2L6MA 4TUIA 1HNXE 2E1MA 4X64E 5ADZA 2WZOA 3T1YE 2M1SA 3VYYA 1QU6A 1UHZA 2CPNA 1I94E 3K6QA 1IBKE 4BC9A 2V89A 4LFAE 4GEQB 2F4VE 2FTXB 4LFBE 2N3GA 1X48A 2V85A 4M2ZA 1ZBTA 4DV4E 2JOXA 4JYAE 3OTOE 4BCAA 3ZOQB 1T4LB 2UXCE 1FKAE 4BS9A 4TUGA 4P78A 2LUPB 1XNRE 4K0KE 4WPYA 2ZM6E 4DV0E 1WXRA 5AASA 3JTZA 2MC5A 3OMLA 4JI7E 2VQEE 2KHXA 2MC6A 5LMUE 1HR0E 4JI4E 4WSPA 2L2KB 2YZTA 2LE2A 3H09A 2JWOA 4L8NA 4F9AB 2RS6A 3J7Yp 1J5EE 5A2QC 5DNYA 2G7HA 4B3ME 4DR4E 4F54A 2H36X 5AE1A 2E5LE 3JAMC 1YYWA 5LMNE 2L33A 3RMPA 4LTYA 3MSWA 2LTRA 1UILA 2MDRA 3LMLA 5IWAE 4LF5E 1XMOE 3AV0A 2RSMA 4DV1E 2B7VA 4NXNE 2L2NA 2EZ6A 2UXDE 1WHNA 1N36E 2NA2A 4B3SE 1WHQA 4B3TE 1STUA 4NXME 4AQYE 2JY9A 2VQFE 1IBME 2NUEA 3J81C 2UXBE 4P7DA 4LF9E 1J26A 1GQEA 1DQ3A 1GZ6A 4OOGC 4DV3E 1RC7A 4JI0E 2ODRD 5T6JA 2JOBA 1DI2A 4DR1E 2KOUA 2M7QA 2LJHA 1N34E 3IWDA 5AE2A 2UUCE 4DR2E 2RS7A 4KZSA 2V87A 2UUBE 4LF8E 3VYXA 2L3CA 3DF6A 1ZBQA 4YY3E 3ADLA 3F6GA 3HXLA 4BC7A 1YYOA 5F3WA 2ODRC 4DV6E 2L8TA 4DR6E 3J7AG 1PKPA 1T4NA 2LTSA 4JI5E 1IBLE 2HHHE 2LRSA 4BBYA 2NUFA 4JI8E 4R8OA 4WFTA 3VK6A 4Q28A 4GKKE 2YT4A 5FLXC 4DR5E 2L3JA 4DKKA 2L92A 2EWLA 3T1HE 2JVAA 4JI1E 2DIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BMJ A;  2M7Q A;  5AAS A; 
#chains in the Genus database with same CATH topology
 4ZYH A;  2DMY A;  4R2P A;  1EKZ A;  5BR8 E;  3BBG A;  4IS1 C;  1N33 E;  1T39 A;  4B3R E;  2EJ4 A;  2RQL A;  1NCS A;  3FIG A;  2EPP A;  1FJG E;  2M4I A;  2V83 A;  3ADI A;  4HEI A;  2UU9 E;  1HNW E;  2EMK A;  2EM9 A;  3HTX A;  3BF2 A;  1X3C A;  1IQO A;  2EM8 A;  2LV2 A;  1A1F A;  3ADJ A;  2MDG A;  5KL5 A;  3F6H A;  1ZU1 A;  3AUZ A;  1YYK A;  2ENA A;  2YRM A;  4JV5 E;  1WRJ A;  2KON A;  4DUY E;  5LLQ A;  1HNZ E;  2FGG A;  5AE3 A;  2DLK A;  4X66 E;  4DR7 E;  5IT9 C;  2EMX A;  2HJJ A;  2E1M A;  2EOJ A;  5ADZ A;  3T1Y E;  1IBK E;  2CPN A;  3L00 A;  4F2J C;  3K6Q A;  2YWQ A;  2EM3 A;  1X48 A;  4M2Z A;  2JOX A;  2PRT A;  1DGC A;  4BHB A;  1L4S A;  2EE8 A;  2EPO A;  3EPJ A;  1FKA E;  2MKD A;  3MHH C;  2EN4 A;  4K0K E;  1WXR A;  2YPN A;  1YUI A;  2KHX A;  1HR0 E;  1MGT A;  1PJT A;  2EMY A;  1WJP A;  3H09 A;  4B3M E;  4DR4 E;  1P47 A;  4F54 A;  2H36 X;  4WXD A;  2L33 A;  1UIL A;  4RH8 A;  5IWA E;  3AV0 A;  2RSM A;  2CT1 A;  5A6J A;  2L2N A;  2NA2 A;  1WHQ A;  4B3T E;  1STU A;  2VQF E;  2UXB E;  4P7D A;  1GZ6 A;  1RC7 A;  2ODR D;  2EOM A;  2J7J A;  5AE2 A;  4LF8 E;  2L3C A;  1JK1 A;  4YY3 E;  2YU8 A;  2YU5 A;  1YYO A;  4F6N A;  1PKP A;  3EPK A;  2YSP A;  4JI5 E;  1IBL E;  2HHH E;  4BBY A;  2EMW A;  4Q28 A;  4R2D A;  4DR5 E;  1A1L A;  4Q35 B;  2EWL A;  4ZYG A;  1X6E A;  2I13 A;  2B7T A;  2EN8 A;  2V8Q B;  4J8Z A;  2Q8U A;  2MKN A;  2NUG A;  2WBS A;  2EPA A;  2EML A;  3DJW A;  2N3H A;  4GKJ E;  4BHC A;  3HPZ A;  1N32 E;  2EPK X;  2DRP A;  2VE7 C;  3J80 C;  2EL6 A;  2ADR A;  2EOF A;  4JI3 E;  2V88 A;  2CSH A;  1PJQ A;  3KZZ A;  4X8W A;  1RQ0 A;  4LF7 E;  1PJS A;  2EMA A;  2LMZ A;  2YTF A;  4X9J A;  1KYQ A;  2F8B A;  4DUZ E;  2DSY A;  2V86 A;  1GTK A;  3C6K A;  1IQS A;  1EH7 A;  2EL5 A;  4KWY A;  3UK3 C;  4GEQ B;  4M9V C;  2N3G A;  4DV4 E;  3QG5 C;  1A1I A;  5KL6 A;  2EMG A;  3OTO E;  3THN A;  2EPX A;  2UXC E;  1AH5 A;  2RPC A;  4TUG A;  2YTO A;  4P78 A;  2LUP B;  4NHR A;  4DV0 E;  3OML A;  4JI7 E;  2VQE E;  4O43 A;  5LMU E;  5AC4 A;  4RHB B;  3BID A;  2YZT A;  2LE2 A;  2JWO A;  2EN2 A;  4F9A B;  2YTD A;  1J5E E;  5A2Q C;  2E5L E;  4R2E A;  3JAM C;  2LJU A;  3RMP A;  2EM4 A;  2MDR A;  4LF5 E;  4DV1 E;  1N36 E;  4AQY E;  2BB8 A;  2EPC A;  1J26 A;  1NEI A;  4OOG C;  1BB8 A;  2JP9 A;  5KL3 A;  1KJK A;  4DR1 E;  4O5G A;  2LJH A;  2YTQ A;  2UUC E;  3VYX A;  4DR2 E;  2V87 A;  2UUB E;  2R1F A;  2EPR A;  2A25 A;  2LCE A;  2I9I A;  2LTS A;  2EP3 A;  2NUF A;  3BGH A;  2EPN A;  4WFT A;  4GKK E;  2YT4 A;  3C6M A;  2EN6 A;  4DKK A;  2EM6 A;  3T1H E;  2DIX A;  4LFC E;  2EL4 A;  1AAY A;  1MEY C;  1YZ9 A;  4LF4 E;  1A1J A;  4R2C A;  5CFF E;  3EPH A;  2UUA E;  4X62 E;  2HC5 A;  2FV4 B;  4M0V A;  1BBO A;  3LLH A;  1ZAA C;  1YPN A;  3IWC A;  1G2D C;  1EH6 A;  2YTP A;  4OX9 E;  3IWB A;  1X49 A;  2CTD A;  1X47 A;  1G2F C;  4GZN C;  4L5N C;  4DV5 E;  3EPL A;  3JU0 A;  2DB2 A;  2K4V A;  5TSE A;  4WYQ B;  3C4B A;  2YTI A;  2B9D A;  2IHR 1;  4I8O A;  1YSA C;  2B3T B;  2EMB A;  4F9C B;  1SFE A;  4NZV A;  2LBS B;  2RTX A;  4DR3 E;  2YTJ A;  3C4T A;  4YHH E;  5A69 A;  2EOI A;  2NAB A;  4TUI A;  3EQ1 A;  1HNX E;  2M9A A;  4R2Q A;  2WZO A;  2M1S A;  1QU6 A;  4LFA E;  2HGH A;  2V89 A;  4LFB E;  3MHS C;  5IXM B;  4BCA A;  2WBU A;  3ZOQ B;  1XNR E;  1JK2 A;  2EOS A;  4WPY A;  2RSI A;  5AAS A;  1YFH A;  4WX9 A;  1ZR9 A;  2EPU A;  4JI4 E;  1N3G A;  2EPL X;  2DMI A;  2WCC 3;  1X6H A;  3J7Y p;  2RS6 A;  2JXP A;  2G7H A;  2EOZ A;  5AE1 A;  2K7I A;  2DLQ A;  1YYW A;  5LMN E;  4O4K A;  3TQM A;  4LTY A;  2ELY A;  3MSW A;  2LTR A;  3LML A;  2EM5 A;  2ELZ A;  2EOX A;  1Z1B A;  2B7V A;  2DGC A;  2UXD E;  1WHN A;  2EOE A;  4ZYE A;  5A6B D;  1TF6 A;  3ECR A;  1IBM E;  2EMF A;  4WXC A;  1DQ3 A;  1TF3 A;  2EOR A;  5T6J A;  2EQ0 A;  2ENH A;  2KOU A;  2M7Q A;  1N34 E;  5KL7 A;  2D9H A;  4KZS A;  4FK5 C;  4HTG A;  1ZBQ A;  3ADL A;  3F6G A;  3HXL A;  4BC7 A;  5F3W A;  4DR6 E;  2L8T A;  2JPA A;  3THO B;  2LRS A;  4F6M A;  2EN3 A;  4R8O A;  4JI8 E;  2BBG A;  2EMZ A;  2EQ3 A;  2N8X A;  2V85 A;  1B69 A;  4DV2 E;  1PDA A;  1T4O A;  5KL4 A;  2JYA A;  3P1X A;  4F9B B;  4R2S A;  2VF1 A;  2GLI A;  4KHP E;  1BBG A;  2YSO A;  4DV7 E;  2EOH A;  4N4R B;  3KWR A;  2EOY A;  1XMQ E;  1A1H A;  2ENC A;  2LUQ A;  5LL6 R;  4LF6 E;  2EOQ A;  2EN1 A;  1A1G A;  2EM2 A;  2EMH A;  2L2M A;  1QNT A;  3HPS A;  2YRH A;  2EN7 A;  4R03 A;  1LLM C;  2EM7 A;  3ADG A;  4JI2 E;  3HQ1 A;  4JI6 E;  1SR9 A;  4X65 E;  4BMJ A;  1O0W A;  5IV8 B;  2JR1 A;  4M30 A;  3KZY A;  4DMI A;  1XNQ E;  1EH8 A;  4LU9 A;  2L6M A;  4X64 E;  3VYY A;  4JYA E;  1UHZ A;  1I94 E;  4BC9 A;  2F4V E;  2FTX B;  1ZBT A;  1TN9 A;  2EPM X;  1T4L B;  3M99 B;  4BS9 A;  1A1K A;  2LVH A;  2ZM6 E;  2EM0 A;  2LT7 A;  2LO3 A;  2MC5 A;  3JTZ A;  2GHF A;  2MC6 A;  1X6F A;  2YTG A;  2EMI A;  4WSP A;  2L2K B;  4L8N A;  2WBT A;  5A6B A;  5DNY A;  4O24 A;  5A6A A;  4R2R A;  1RMD A;  2EMC A;  4IJD A;  1XMO E;  4NXN E;  1F2I G;  2EZ6 A;  4MLQ A;  4B3S E;  1YUJ A;  4ZYD A;  4NXM E;  2JY9 A;  2NUE A;  3J81 C;  5A6K A;  4LF9 E;  1GQE A;  5AC5 A;  4DV3 E;  4JI0 E;  2YTN A;  2JOB A;  2E72 A;  1DI2 A;  2EQ1 A;  3IWD A;  4R2A A;  2RS7 A;  4MLV A;  1UN6 B;  3DF6 A;  2YRK A;  1T38 A;  2ODR C;  4DV6 E;  2YTE A;  3J7A G;  1T4N A;  5KL2 A;  1X5W A;  2VRD A;  3VK6 A;  1IMU A;  1UBD C;  2EPZ A;  2GPI A;  2R76 A;  3VHT B;  2EOO A;  5FLX C;  2L3J A;  4WSG A;  2L92 A;  2JVA A;  4JI1 E; 
#chains in the Genus database with same CATH homology
 4DV2 E;  2DMY A;  4LFC E;  1T4O A;  2B7T A;  1EKZ A;  2V8Q B;  3P1X A;  4F9B B;  1YZ9 A;  5BR8 E;  4J8Z A;  4LF4 E;  2NUG A;  2VF1 A;  5CFF E;  4KHP E;  2UUA E;  4DV7 E;  4B3R E;  1N33 E;  4X62 E;  3DJW A;  2FV4 B;  3FIG A;  3KWR A;  2N3H A;  4M0V A;  1XMQ E;  3LLH A;  4GKJ E;  2LUQ A;  5LL6 R;  2M4I A;  4LF6 E;  1FJG E;  2V83 A;  3HPZ A;  2UU9 E;  3ADI A;  1HNW E;  3IWC A;  1N32 E;  2VE7 C;  3HTX A;  4OX9 E;  3IWB A;  1X49 A;  3J80 C;  2L2M A;  1X47 A;  3HPS A;  4R03 A;  4L5N C;  3ADJ A;  4JI3 E;  3ADG A;  4DV5 E;  3F6H A;  3JU0 A;  2DB2 A;  2V88 A;  4JI2 E;  3HQ1 A;  2K4V A;  4JI6 E;  1SR9 A;  4WYQ B;  4X8W A;  3AUZ A;  4BMJ A;  4X65 E;  1YYK A;  1RQ0 A;  4LF7 E;  1O0W A;  4JV5 E;  3C4B A;  2KON A;  2B9D A;  2IHR 1;  2JR1 A;  2LMZ A;  4I8O A;  4M30 A;  4DUY E;  1HNZ E;  2FGG A;  2B3T B;  2F8B A;  4DMI A;  1XNQ E;  4F9C B;  5AE3 A;  4DUZ E;  2DSY A;  2LBS B;  2V86 A;  2RTX A;  4X66 E;  4LU9 A;  4DR3 E;  3C4T A;  4YHH E;  4DR7 E;  5IT9 C;  2L6M A;  4TUI A;  1HNX E;  2E1M A;  4X64 E;  5ADZ A;  2WZO A;  3T1Y E;  2M1S A;  3VYY A;  1QU6 A;  1UHZ A;  2CPN A;  1I94 E;  3K6Q A;  1IBK E;  4BC9 A;  2V89 A;  4LFA E;  4GEQ B;  2F4V E;  2FTX B;  4LFB E;  2N3G A;  1X48 A;  2V85 A;  4M2Z A;  1ZBT A;  4DV4 E;  2JOX A;  4JYA E;  3OTO E;  4BCA A;  3ZOQ B;  1T4L B;  2UXC E;  1FKA E;  4BS9 A;  4TUG A;  4P78 A;  2LUP B;  1XNR E;  4K0K E;  4WPY A;  2ZM6 E;  4DV0 E;  1WXR A;  5AAS A;  3JTZ A;  2MC5 A;  3OML A;  4JI7 E;  2VQE E;  2KHX A;  2MC6 A;  5LMU E;  1HR0 E;  4JI4 E;  4WSP A;  2L2K B;  2YZT A;  2LE2 A;  3H09 A;  2JWO A;  4L8N A;  4F9A B;  2RS6 A;  3J7Y p;  1J5E E;  5A2Q C;  5DNY A;  2G7H A;  4B3M E;  4DR4 E;  4F54 A;  2H36 X;  5AE1 A;  2E5L E;  3JAM C;  1YYW A;  5LMN E;  2L33 A;  3RMP A;  4LTY A;  3MSW A;  2LTR A;  1UIL A;  2MDR A;  3LML A;  5IWA E;  4LF5 E;  1XMO E;  3AV0 A;  2RSM A;  4DV1 E;  2B7V A;  4NXN E;  2L2N A;  2EZ6 A;  2UXD E;  1WHN A;  1N36 E;  2NA2 A;  4B3S E;  1WHQ A;  4B3T E;  1STU A;  4NXM E;  4AQY E;  2JY9 A;  2VQF E;  1IBM E;  2NUE A;  3J81 C;  2UXB E;  4P7D A;  4LF9 E;  1J26 A;  1GQE A;  1DQ3 A;  1GZ6 A;  4OOG C;  4DV3 E;  1RC7 A;  4JI0 E;  2ODR D;  5T6J A;  2JOB A;  1DI2 A;  4DR1 E;  2KOU A;  2M7Q A;  2LJH A;  1N34 E;  3IWD A;  5AE2 A;  2UUC E;  4DR2 E;  2RS7 A;  4KZS A;  2V87 A;  2UUB E;  4LF8 E;  3VYX A;  2L3C A;  3DF6 A;  1ZBQ A;  4YY3 E;  3ADL A;  3F6G A;  3HXL A;  4BC7 A;  1YYO A;  5F3W A;  2ODR C;  4DV6 E;  2L8T A;  4DR6 E;  3J7A G;  1PKP A;  1T4N A;  2LTS A;  4JI5 E;  1IBL E;  2HHH E;  2LRS A;  4BBY A;  2NUF A;  4JI8 E;  4R8O A;  4WFT A;  3VK6 A;  4Q28 A;  4GKK E;  2YT4 A;  5FLX C;  4DR5 E;  2L3J A;  4DKK A;  2L92 A;  2EWL A;  3T1H E;  2JVA A;  4JI1 E;  2DIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...