5AASA

The selective autophagy receptor tax1bp1 is required for autophagy- dependent capture of cytosolic salmonella typhimurium
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
63
structure length
63
Chain Sequence
SSFDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords TAX1-BINDING PROTEIN 1
publication title The Autophagy Receptor Tax1BP1 and the Molecular Motor Myosin Vi are Required for Clearance of Salmonella Typhimurium by Autophagy.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2015-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18112 Zn-C2H2_12 Autophagy receptor zinc finger-C2H2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.550 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5aasA00
5AASA 2M7QA 4BMJA
chains in the Genus database with same CATH superfamily
1PJQA 2EM5A 4IJDA 1IMUA 2CSHA 3AUZA 2ENCA 3ECRA 2DB2A 4LU9A 1UBDC 1IQOA 1RC7A 5IWAE 4DR3E 2JVAA 4JV5E 4M9VC 2MKDA 2WBTA 4R2CA 2EPLX 3BIDA 2YTOA 4LF9E 3P1XA 2EMIA 4LFAE 4JYAE 1TF3A 3J7Yp 4DR5E 2EL4A 3RMPA 5A6AA 4JI2E 2YZTA 2EQ3A 4OOGC 4R03A 4WPYA 2CTDA 2JOXA 4ZYDA 1ZAAC 1KYQA 4LTYA 5BR8E 2EPMX 4LFBE 2ENHA 2DSYA 4BHCA 2L2NA 2EMLA 4J8ZA 3VK6A 3T1YE 3KZZA 3BGHA 4ZYGA 4Q28A 4F6NA 4JI8E 2GLIA 2UUAE 1HNWE 4X65E 1UHZA 1ZBQA 4NHRA 2EWLA 2JY9A 4ZYEA 2MKNA 2EMFA 1T4OA 2EMCA 4I8OA 2LMZA 2RSIA 4F6MA 1YYWA 2EM3A 4R2EA 5KL2A 1P47A 2EPUA 1SFEA 5A6BD 1AH5A 4R2RA 1F2IG 1N33E 3EPJA 2L8TA 4WYQB 1FJGE 4F9AB 4O43A 4JI7E 4WSPA 3ADGA 2L2KB 2WBUA 4GKJE 4X9JA 2IHR1 5IT9C 2UUBE 4LF8E 2DRPA 4GZNC 2G7HA 2EPNA 4O24A 4DV1E 1TF6A 1FKAE 5LL6R 2EM8A 2B3TB 2EP3A 2LV2A 4DR7E 3DF6A 1N3GA 3L00A 4NZVA 4BS9A 2R1FA 2NA2A 2HJJA 1T4NA 3JU0A 2ENAA 4NXNE 3IWDA 4X64E 3ADLA 2YTGA 2EMGA 5KL5A 4AQYE 1IBLE 4GKKE 1YPNA 2FGGA 4P7DA 2EOOA 3H09A 2EM7A 1WXRA 1PDAA 4ZYHA 2LO3A 2L33A 2NABA 1ZBTA 2DIXA 1WRJA 5LMNE 2EOEA 2EJ4A 5F3WA 2V89A 2YTDA 2YU8A 2K4VA 2WCC3 4IS1C 1BBGA 1T38A 2LUQA 4LFCE 2V8QB 2L3CA 2NUEA 2EMWA 3T1HE 2EQ1A 2B7TA 2DMIA 3BF2A 2JPAA 4B3SE 4X66E 2LTSA 4X8WA 2EPZA 4M30A 4NXME 1YFHA 1JK1A 4JI1E 3EQ1A 2DLQA 2LUPB 2EN8A 4BMJA 2EOYA 1A1HA 2LJHA 2YTIA 4O5GA 2YTFA 1HR0E 1XNRE 2EMAA 3KWRA 5LLQA 1YUJA 3AV0A 2EOQA 1N34E 2EPRA 4TUGA 3MHHC 1DGCA 2LBSB 3EPHA 2MC6A 2E1MA 2HC5A 4DV3E 1X6EA 5KL6A 2VQFE 3JAMC 4F2JC 2FV4B 1YYOA 2KHXA 1I94E 1EH7A 2GPIA 1TN9A 2NUFA 3TQMA 1SR9A 2ELYA 2EPCA 4DKKA 1WJPA 4P78A 4R2AA 4X62E 2LCEA 3HXLA 2M4IA 4YHHE 2EOSA 2LRSA 4LF6E 4M2ZA 4DV6E 5FLXC 2YRHA 1QU6A 2EMXA 1UN6B 2EOMA 4DV2E 4RH8A 1EKZA 1T39A 3ZOQB 4BHBA 3HTXA 2EPKX 2EM4A 4TUIA 2RQLA 1BBOA 2J7JA 1X49A 3ADJA 2EOXA 2JYAA 1X5WA 5KL4A 1WHNA 2RS6A 2RS7A 4LF4E 2WZOA 2VRDA 5AC5A 4R2SA 3EPKA 1N36E 3UK3C 3LMLA 4OX9E 4MLQA 2CPNA 2EN2A 2K7IA 2Q8UA 4WX9A 2EM0A 4YY3E 4N4RB 5KL3A 1N32E 4GEQB 2LE2A 4WSGA 1T4LB 4F54A 3J80C 3M99B 3QG5C 2MDRA 3K6QA 2HHHE 2EOZA 3VHTB 2BB8A 2VF1A 4F9BB 3HPZA 5A6KA 1B69A 4LF7E 1YZ9A 1KJKA 2V83A 4LF5E 3FIGA 1X47A 4DV7E 4DR6E 5DNYA 2VQEE 4R8OA 2A25A 1X3CA 2LTRA 5AC4A 2EM9A 4MLVA 2EPAA 1IQSA 5AE2A 2BBGA 2UXBE 3OTOE 5LMUE 2CT1A 3MHSC 2I9IA 1MEYC 4JI6E 4B3RE 4M0VA 3HQ1A 3IWCA 2I13A 2RSMA 2M9AA 2YTNA 2KONA 1ZU1A 2RTXA 2YRKA 5AE3A 1EH6A 4F9CB 2EN4A 1A1GA 4JI5E 2EOHA 2N8XA 2EN7A 5IV8B 1HNZE 2EN6A 2GHFA 2JP9A 4DR4E 1LLMC 3THNA 2JXPA 2EL6A 4BC9A 2YTJA 1PJTA 2EMBA 5AASA 4B3ME 1GZ6A 2M7QA 4JI4E 3DJWA 2ADRA 3J7AG 2EPPA 1IBKE 4FK5C 1A1FA 2EMKA 2EORA 1DI2A 2L3JA 1JK2A 1IBME 2KOUA 4RHBB 2E72A 1BB8A 2EL5A 1PKPA 1YUIA 4K0KE 1GTKA 4BBYA 4B3TE 2ODRD 1YSAC 3HPSA 2YTPA 4Q35B 2MC5A 2EMZA 3C4TA 2MDGA 3BBGA 2UXDE 2FTXB 1STUA 4DUZE 2JWOA 5A2QC 5A6BA 3C6MA 4HTGA 3VYYA 2YT4A 2RPCA 1A1KA 3IWBA 5KL7A 3C4BA 2ELZA 4L5NC 2LT7A 2EM6A 2B7VA 2YTQA 4R2PA 1QNTA 2V86A 4L8NA 2EPOA 2V85A 2L6MA 2YU5A 2EMYA 1PJSA 1XMOE 3JTZA 3F6GA 4O4KA 2EPXA 2V87A 2L2MA 5A69A 3LLHA 1RQ0A 2EN1A 2F4VE 3EPLA 1NCSA 1AAYA 2EE8A 2EOFA 1ZR9A 2LVHA 3OMLA 1EH8A 4DV5E 2PRTA 1G2DC 2DGCA 1XMQE 1G2FC 3VYXA 2YWQA 2R76A 2B9DA 4KZSA 4DV0E 4DUYE 2DMYA 1DQ3A 2WBSA 1Z1BA 4JI3E 1X6HA 2YRMA 5T6JA 2H36X 3KZYA 1RMDA 2EOIA 1WHQA 1J26A 2UUCE 1O0WA 4DR1E 4WXDA 2EZ6A 3C6KA 2N3GA 2NUGA 4WXCA 1A1LA 1A1IA 2EOJA 2EN3A 2V88A 4HEIA 2YTEA 3THOB 2EM2A 2EQ0A 2M1SA 2ODRC 2E5LE 2EMHA 2JOBA 1J5EE 2VE7C 2YSPA 4KWYA 2YPNA 1NEIA 2LJUA 2N3HA 1YYKA 4BCAA 2JR1A 2L92A 5AE1A 2UU9E 1MGTA 4WFTA 4R2DA 2ZM6E 4JI0E 3MSWA 2HGHA 1A1JA 1L4SA 2DLKA 2YSOA 1XNQE 2F8BA 2UXCE 1X6FA 1X48A 2D9HA 3F6HA 3ADIA 4R2QA 4KHPE 1HNXE 1UILA 4BC7A 1GQEA 5TSEA 5CFFE 3J81C 5ADZA 5A6JA 4DR2E 4DV4E 4DMIA 5IXMB
chains in the Genus database with same CATH topology
2DIXA 5LMNE 3HPSA 1N36E 4OX9E 3LMLA 2MC5A 3AUZA 2CPNA 2DB2A 3C4TA 4LU9A 5F3WA 2V89A 2K4VA 2UXDE 2FTXB 5IWAE 1STUA 4YY3E 4DUZE 4DR3E 2JWOA 2JVAA 1RC7A 5A2QC 4JV5E 1N32E 4GEQB 2LE2A 3VYYA 2YT4A 1T4LB 3IWBA 2LUQA 4F54A 3J80C 3C4BA 4LFCE 2V8QB 2L3CA 2NUEA 4L5NC 2MDRA 3K6QA 3T1HE 2HHHE 4LF9E 2B7VA 2VF1A 3P1XA 4LFAE 4F9BB 3HPZA 2B7TA 2V86A 4B3SE 4JYAE 4X66E 4L8NA 2V85A 2UXCE 3J7Yp 2L6MA 4DR5E 2LTSA 4X8WA 4LF7E 4M30A 1XMOE 4NXME 3RMPA 1YZ9A 2V83A 3JTZA 3F6GA 4JI2E 4JI1E 2YZTA 2V87A 4OOGC 4R03A 2L2MA 3FIGA 4LF5E 3LLHA 1X47A 1RQ0A 4WPYA 2JOXA 4DV7E 2LUPB 4DR6E 2F4VE 5BR8E 4LTYA 4BMJA 5DNYA 2LJHA 4LFBE 2VQEE 4R8OA 2DSYA 1HR0E 2L2NA 2LTRA 1XNRE 4J8ZA 3VK6A 3T1YE 3KWRA 3OMLA 4DV5E 3AV0A 5AE2A 1N34E 4Q28A 1XMQE 4JI8E 4TUGA 2UXBE 3VYXA 3OTOE 5LMUE 2UUAE 1HNWE 4X65E 2LBSB 1UHZA 2B9DA 4KZSA 1ZBQA 4DUYE 2DMYA 1DQ3A 2EWLA 4DV0E 2JY9A 2MC6A 1T4OA 4JI3E 2E1MA 4I8OA 4JI6E 4DV3E 5T6JA 2LMZA 4B3RE 2H36X 4M0VA 3HQ1A 3IWCA 4DMIA 2VQFE 3JAMC 1YYWA 2FV4B 2RSMA 1WHQA 1YYOA 1J26A 2UUCE 2KHXA 1I94E 2KONA 1O0WA 4DR1E 2RTXA 2NUFA 2EZ6A 1SR9A 1N33E 2L8TA 4WYQB 5AE3A 2N3GA 4DKKA 4F9AB 1FJGE 2NUGA 4P78A 4WSPA 3ADGA 4JI7E 2L2KB 4F9CB 4X62E 4GKJE 2IHR1 3HXLA 5IT9C 2M4IA 4YHHE 2UUBE 2V88A 4LF8E 2G7HA 4JI5E 2M1SA 1HNZE 2LRSA 4DV1E 2ODRC 2E5LE 4DV6E 4LF6E 4M2ZA 1FKAE 4DR4E 2JOBA 5LL6R 5FLXC 2VE7C 1J5EE 2B3TB 4DR7E 1QU6A 3DF6A 2N3HA 4BC9A 4DV2E 1YYKA 5AASA 4B3ME 1GZ6A 2M7QA 4JI4E 3DJWA 1EKZA 4BCAA 4BS9A 2JR1A 2L92A 3ZOQB 5AE1A 1IBME 2ZM6E 4WFTA 2UU9E 2NA2A 4JI0E 1T4NA 3JU0A 4NXNE 3J7AG 3MSWA 1IBKE 3HTXA 3IWDA 4X64E 4TUIA 3ADLA 1XNQE 1DI2A 4AQYE 2F8BA 2L3JA 1IBLE 1X49A 1X48A 2FGGA 3ADJA 2KOUA 3F6HA 4P7DA 3H09A 4GKKE 3ADIA 4KHPE 1PKPA 1HNXE 1UILA 1WHNA 4BC7A 1GQEA 2RS6A 1WXRA 4K0KE 2RS7A 5CFFE 4BBYA 3J81C 5ADZA 4LF4E 2WZOA 4DR2E 4B3TE 4DV4E 2ODRD 2L33A 1ZBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AAS A;  2M7Q A;  4BMJ A; 
#chains in the Genus database with same CATH topology
 1PJQ A;  2EM5 A;  4IJD A;  1IMU A;  2CSH A;  3AUZ A;  2ENC A;  3ECR A;  2DB2 A;  4LU9 A;  1UBD C;  1IQO A;  1RC7 A;  5IWA E;  4DR3 E;  2JVA A;  4JV5 E;  4M9V C;  2MKD A;  2WBT A;  4R2C A;  2EPL X;  3BID A;  2YTO A;  4LF9 E;  3P1X A;  2EMI A;  4LFA E;  4JYA E;  1TF3 A;  3J7Y p;  4DR5 E;  2EL4 A;  3RMP A;  5A6A A;  4JI2 E;  2YZT A;  2EQ3 A;  4OOG C;  4R03 A;  4WPY A;  2CTD A;  2JOX A;  4ZYD A;  1ZAA C;  1KYQ A;  4LTY A;  5BR8 E;  2EPM X;  4LFB E;  2ENH A;  2DSY A;  4BHC A;  2L2N A;  2EML A;  4J8Z A;  3VK6 A;  3T1Y E;  3KZZ A;  3BGH A;  4ZYG A;  4Q28 A;  4F6N A;  4JI8 E;  2GLI A;  2UUA E;  1HNW E;  4X65 E;  1UHZ A;  1ZBQ A;  4NHR A;  2EWL A;  2JY9 A;  4ZYE A;  2MKN A;  2EMF A;  1T4O A;  2EMC A;  4I8O A;  2LMZ A;  2RSI A;  4F6M A;  1YYW A;  2EM3 A;  4R2E A;  5KL2 A;  1P47 A;  2EPU A;  1SFE A;  5A6B D;  1AH5 A;  4R2R A;  1F2I G;  1N33 E;  3EPJ A;  2L8T A;  4WYQ B;  1FJG E;  4F9A B;  4O43 A;  4JI7 E;  4WSP A;  3ADG A;  2L2K B;  2WBU A;  4GKJ E;  4X9J A;  2IHR 1;  5IT9 C;  2UUB E;  4LF8 E;  2DRP A;  4GZN C;  2G7H A;  2EPN A;  4O24 A;  4DV1 E;  1TF6 A;  1FKA E;  5LL6 R;  2EM8 A;  2B3T B;  2EP3 A;  2LV2 A;  4DR7 E;  3DF6 A;  1N3G A;  3L00 A;  4NZV A;  4BS9 A;  2R1F A;  2NA2 A;  2HJJ A;  1T4N A;  3JU0 A;  2ENA A;  4NXN E;  3IWD A;  4X64 E;  3ADL A;  2YTG A;  2EMG A;  5KL5 A;  4AQY E;  1IBL E;  4GKK E;  1YPN A;  2FGG A;  4P7D A;  2EOO A;  3H09 A;  2EM7 A;  1WXR A;  1PDA A;  4ZYH A;  2LO3 A;  2L33 A;  2NAB A;  1ZBT A;  2DIX A;  1WRJ A;  5LMN E;  2EOE A;  2EJ4 A;  5F3W A;  2V89 A;  2YTD A;  2YU8 A;  2K4V A;  2WCC 3;  4IS1 C;  1BBG A;  1T38 A;  2LUQ A;  4LFC E;  2V8Q B;  2L3C A;  2NUE A;  2EMW A;  3T1H E;  2EQ1 A;  2B7T A;  2DMI A;  3BF2 A;  2JPA A;  4B3S E;  4X66 E;  2LTS A;  4X8W A;  2EPZ A;  4M30 A;  4NXM E;  1YFH A;  1JK1 A;  4JI1 E;  3EQ1 A;  2DLQ A;  2LUP B;  2EN8 A;  4BMJ A;  2EOY A;  1A1H A;  2LJH A;  2YTI A;  4O5G A;  2YTF A;  1HR0 E;  1XNR E;  2EMA A;  3KWR A;  5LLQ A;  1YUJ A;  3AV0 A;  2EOQ A;  1N34 E;  2EPR A;  4TUG A;  3MHH C;  1DGC A;  2LBS B;  3EPH A;  2MC6 A;  2E1M A;  2HC5 A;  4DV3 E;  1X6E A;  5KL6 A;  2VQF E;  3JAM C;  4F2J C;  2FV4 B;  1YYO A;  2KHX A;  1I94 E;  1EH7 A;  2GPI A;  1TN9 A;  2NUF A;  3TQM A;  1SR9 A;  2ELY A;  2EPC A;  4DKK A;  1WJP A;  4P78 A;  4R2A A;  4X62 E;  2LCE A;  3HXL A;  2M4I A;  4YHH E;  2EOS A;  2LRS A;  4LF6 E;  4M2Z A;  4DV6 E;  5FLX C;  2YRH A;  1QU6 A;  2EMX A;  1UN6 B;  2EOM A;  4DV2 E;  4RH8 A;  1EKZ A;  1T39 A;  3ZOQ B;  4BHB A;  3HTX A;  2EPK X;  2EM4 A;  4TUI A;  2RQL A;  1BBO A;  2J7J A;  1X49 A;  3ADJ A;  2EOX A;  2JYA A;  1X5W A;  5KL4 A;  1WHN A;  2RS6 A;  2RS7 A;  4LF4 E;  2WZO A;  2VRD A;  5AC5 A;  4R2S A;  3EPK A;  1N36 E;  3UK3 C;  3LML A;  4OX9 E;  4MLQ A;  2CPN A;  2EN2 A;  2K7I A;  2Q8U A;  4WX9 A;  2EM0 A;  4YY3 E;  4N4R B;  5KL3 A;  1N32 E;  4GEQ B;  2LE2 A;  4WSG A;  1T4L B;  4F54 A;  3J80 C;  3M99 B;  3QG5 C;  2MDR A;  3K6Q A;  2HHH E;  2EOZ A;  3VHT B;  2BB8 A;  2VF1 A;  4F9B B;  3HPZ A;  5A6K A;  1B69 A;  4LF7 E;  1YZ9 A;  1KJK A;  2V83 A;  4LF5 E;  3FIG A;  1X47 A;  4DV7 E;  4DR6 E;  5DNY A;  2VQE E;  4R8O A;  2A25 A;  1X3C A;  2LTR A;  5AC4 A;  2EM9 A;  4MLV A;  2EPA A;  1IQS A;  5AE2 A;  2BBG A;  2UXB E;  3OTO E;  5LMU E;  2CT1 A;  3MHS C;  2I9I A;  1MEY C;  4JI6 E;  4B3R E;  4M0V A;  3HQ1 A;  3IWC A;  2I13 A;  2RSM A;  2M9A A;  2YTN A;  2KON A;  1ZU1 A;  2RTX A;  2YRK A;  5AE3 A;  1EH6 A;  4F9C B;  2EN4 A;  1A1G A;  4JI5 E;  2EOH A;  2N8X A;  2EN7 A;  5IV8 B;  1HNZ E;  2EN6 A;  2GHF A;  2JP9 A;  4DR4 E;  1LLM C;  3THN A;  2JXP A;  2EL6 A;  4BC9 A;  2YTJ A;  1PJT A;  2EMB A;  5AAS A;  4B3M E;  1GZ6 A;  2M7Q A;  4JI4 E;  3DJW A;  2ADR A;  3J7A G;  2EPP A;  1IBK E;  4FK5 C;  1A1F A;  2EMK A;  2EOR A;  1DI2 A;  2L3J A;  1JK2 A;  1IBM E;  2KOU A;  4RHB B;  2E72 A;  1BB8 A;  2EL5 A;  1PKP A;  1YUI A;  4K0K E;  1GTK A;  4BBY A;  4B3T E;  2ODR D;  1YSA C;  3HPS A;  2YTP A;  4Q35 B;  2MC5 A;  2EMZ A;  3C4T A;  2MDG A;  3BBG A;  2UXD E;  2FTX B;  1STU A;  4DUZ E;  2JWO A;  5A2Q C;  5A6B A;  3C6M A;  4HTG A;  3VYY A;  2YT4 A;  2RPC A;  1A1K A;  3IWB A;  5KL7 A;  3C4B A;  2ELZ A;  4L5N C;  2LT7 A;  2EM6 A;  2B7V A;  2YTQ A;  4R2P A;  1QNT A;  2V86 A;  4L8N A;  2EPO A;  2V85 A;  2L6M A;  2YU5 A;  2EMY A;  1PJS A;  1XMO E;  3JTZ A;  3F6G A;  4O4K A;  2EPX A;  2V87 A;  2L2M A;  5A69 A;  3LLH A;  1RQ0 A;  2EN1 A;  2F4V E;  3EPL A;  1NCS A;  1AAY A;  2EE8 A;  2EOF A;  1ZR9 A;  2LVH A;  3OML A;  1EH8 A;  4DV5 E;  2PRT A;  1G2D C;  2DGC A;  1XMQ E;  1G2F C;  3VYX A;  2YWQ A;  2R76 A;  2B9D A;  4KZS A;  4DV0 E;  4DUY E;  2DMY A;  1DQ3 A;  2WBS A;  1Z1B A;  4JI3 E;  1X6H A;  2YRM A;  5T6J A;  2H36 X;  3KZY A;  1RMD A;  2EOI A;  1WHQ A;  1J26 A;  2UUC E;  1O0W A;  4DR1 E;  4WXD A;  2EZ6 A;  3C6K A;  2N3G A;  2NUG A;  4WXC A;  1A1L A;  1A1I A;  2EOJ A;  2EN3 A;  2V88 A;  4HEI A;  2YTE A;  3THO B;  2EM2 A;  2EQ0 A;  2M1S A;  2ODR C;  2E5L E;  2EMH A;  2JOB A;  1J5E E;  2VE7 C;  2YSP A;  4KWY A;  2YPN A;  1NEI A;  2LJU A;  2N3H A;  1YYK A;  4BCA A;  2JR1 A;  2L92 A;  5AE1 A;  2UU9 E;  1MGT A;  4WFT A;  4R2D A;  2ZM6 E;  4JI0 E;  3MSW A;  2HGH A;  1A1J A;  1L4S A;  2DLK A;  2YSO A;  1XNQ E;  2F8B A;  2UXC E;  1X6F A;  1X48 A;  2D9H A;  3F6H A;  3ADI A;  4R2Q A;  4KHP E;  1HNX E;  1UIL A;  4BC7 A;  1GQE A;  5TSE A;  5CFF E;  3J81 C;  5ADZ A;  5A6J A;  4DR2 E;  4DV4 E;  4DMI A;  5IXM B; 
#chains in the Genus database with same CATH homology
 2DIX A;  5LMN E;  3HPS A;  1N36 E;  4OX9 E;  3LML A;  2MC5 A;  3AUZ A;  2CPN A;  2DB2 A;  3C4T A;  4LU9 A;  5F3W A;  2V89 A;  2K4V A;  2UXD E;  2FTX B;  5IWA E;  1STU A;  4YY3 E;  4DUZ E;  4DR3 E;  2JWO A;  2JVA A;  1RC7 A;  5A2Q C;  4JV5 E;  1N32 E;  4GEQ B;  2LE2 A;  3VYY A;  2YT4 A;  1T4L B;  3IWB A;  2LUQ A;  4F54 A;  3J80 C;  3C4B A;  4LFC E;  2V8Q B;  2L3C A;  2NUE A;  4L5N C;  2MDR A;  3K6Q A;  3T1H E;  2HHH E;  4LF9 E;  2B7V A;  2VF1 A;  3P1X A;  4LFA E;  4F9B B;  3HPZ A;  2B7T A;  2V86 A;  4B3S E;  4JYA E;  4X66 E;  4L8N A;  2V85 A;  2UXC E;  3J7Y p;  2L6M A;  4DR5 E;  2LTS A;  4X8W A;  4LF7 E;  4M30 A;  1XMO E;  4NXM E;  3RMP A;  1YZ9 A;  2V83 A;  3JTZ A;  3F6G A;  4JI2 E;  4JI1 E;  2YZT A;  2V87 A;  4OOG C;  4R03 A;  2L2M A;  3FIG A;  4LF5 E;  3LLH A;  1X47 A;  1RQ0 A;  4WPY A;  2JOX A;  4DV7 E;  2LUP B;  4DR6 E;  2F4V E;  5BR8 E;  4LTY A;  4BMJ A;  5DNY A;  2LJH A;  4LFB E;  2VQE E;  4R8O A;  2DSY A;  1HR0 E;  2L2N A;  2LTR A;  1XNR E;  4J8Z A;  3VK6 A;  3T1Y E;  3KWR A;  3OML A;  4DV5 E;  3AV0 A;  5AE2 A;  1N34 E;  4Q28 A;  1XMQ E;  4JI8 E;  4TUG A;  2UXB E;  3VYX A;  3OTO E;  5LMU E;  2UUA E;  1HNW E;  4X65 E;  2LBS B;  1UHZ A;  2B9D A;  4KZS A;  1ZBQ A;  4DUY E;  2DMY A;  1DQ3 A;  2EWL A;  4DV0 E;  2JY9 A;  2MC6 A;  1T4O A;  4JI3 E;  2E1M A;  4I8O A;  4JI6 E;  4DV3 E;  5T6J A;  2LMZ A;  4B3R E;  2H36 X;  4M0V A;  3HQ1 A;  3IWC A;  4DMI A;  2VQF E;  3JAM C;  1YYW A;  2FV4 B;  2RSM A;  1WHQ A;  1YYO A;  1J26 A;  2UUC E;  2KHX A;  1I94 E;  2KON A;  1O0W A;  4DR1 E;  2RTX A;  2NUF A;  2EZ6 A;  1SR9 A;  1N33 E;  2L8T A;  4WYQ B;  5AE3 A;  2N3G A;  4DKK A;  4F9A B;  1FJG E;  2NUG A;  4P78 A;  4WSP A;  3ADG A;  4JI7 E;  2L2K B;  4F9C B;  4X62 E;  4GKJ E;  2IHR 1;  3HXL A;  5IT9 C;  2M4I A;  4YHH E;  2UUB E;  2V88 A;  4LF8 E;  2G7H A;  4JI5 E;  2M1S A;  1HNZ E;  2LRS A;  4DV1 E;  2ODR C;  2E5L E;  4DV6 E;  4LF6 E;  4M2Z A;  1FKA E;  4DR4 E;  2JOB A;  5LL6 R;  5FLX C;  2VE7 C;  1J5E E;  2B3T B;  4DR7 E;  1QU6 A;  3DF6 A;  2N3H A;  4BC9 A;  4DV2 E;  1YYK A;  5AAS A;  4B3M E;  1GZ6 A;  2M7Q A;  4JI4 E;  3DJW A;  1EKZ A;  4BCA A;  4BS9 A;  2JR1 A;  2L92 A;  3ZOQ B;  5AE1 A;  1IBM E;  2ZM6 E;  4WFT A;  2UU9 E;  2NA2 A;  4JI0 E;  1T4N A;  3JU0 A;  4NXN E;  3J7A G;  3MSW A;  1IBK E;  3HTX A;  3IWD A;  4X64 E;  4TUI A;  3ADL A;  1XNQ E;  1DI2 A;  4AQY E;  2F8B A;  2L3J A;  1IBL E;  1X49 A;  1X48 A;  2FGG A;  3ADJ A;  2KOU A;  3F6H A;  4P7D A;  3H09 A;  4GKK E;  3ADI A;  4KHP E;  1PKP A;  1HNX E;  1UIL A;  1WHN A;  4BC7 A;  1GQE A;  2RS6 A;  1WXR A;  4K0K E;  2RS7 A;  5CFF E;  4BBY A;  3J81 C;  5ADZ A;  4LF4 E;  2WZO A;  4DR2 E;  4B3T E;  4DV4 E;  2ODR D;  2L33 A;  1ZBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...