4NHRA

Crystal structure of the outer membrane lipopolysaccharide transport protein lpte (rlpb)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
137
structure length
137
Chain Sequence
MKVMILDSGDPNGPLSRAVRNQLRLNGVELLDKETTRKDVPSLRLGKVSIAKDTASVFRNGQTAEYQMIMTVNATVLIPGRDIYPISAKVFRSFFDNPQMALAKDNEQDMIVKEMYDRAAEQLIRKLPSIRAADIRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LPS-assembly lipoprotein LptE
publication title LptE binds to and alters the physical state of LPS to catalyze its assembly at the cell surface.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lipid binding protein
total genus 30
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2013-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04390 LptE Lipopolysaccharide-assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 4nhrA00
5IV8B 4RHBB 4N4RB 3BF2A 4NHRA 5IXMB 4RH8A 2N8XA 2R76A 5TSEA 2JXPA 4KWYA 4Q35B
chains in the Genus database with same CATH superfamily
3HQ1A 5AE3A 2G7HA 5KL5A 1G2FC 2F4VE 1YYOA 2EOFA 1XMOE 2LJUA 4OX9E 4I8OA 1MGTA 5IXMB 4F6NA 1YSAC 1G2DC 1A1HA 2DMYA 3ZOQB 4R2RA 5A6AA 2V8QB 2M9AA 2LJHA 1UN6B 1WRJA 2LBSB 4NXNE 4L8NA 2EN7A 4IJDA 2DMIA 4X9JA 1TN9A 3JAMC 3C4TA 3ECRA 4DUYE 5AE2A 2UUAE 2DLKA 2EOMA 2D9HA 1IBLE 4DR1E 3BF2A 4F54A 1BB8A 5AC4A 1X48A 2HGHA 1XNQE 2EN8A 1BBGA 2MKDA 2GHFA 2L2MA 4NHRA 1STUA 5A69A 4JI5E 1WHNA 1X47A 2EMCA 2EOIA 3J80C 1MEYC 4DV2E 4X65E 1AAYA 3KZZA 4JV5E 2EMZA 3HXLA 1YYKA 2LUQA 4KHPE 2EMXA 1A1JA 4ZYEA 1NCSA 4DV4E 2DB2A 2JWOA 2EPLX 4Q28A 4GKJE 4WFTA 2EM0A 2JOXA 2CT1A 4R2AA 2ADRA 2DLQA 2EOYA 5LMUE 4DUZE 2EQ1A 2EMYA 2LO3A 1RC7A 3FIGA 1T38A 2RPCA 2EMKA 2EMIA 1YUIA 3MHHC 2EPAA 4K0KE 4R03A 3EPHA 1PDAA 2LTSA 2HHHE 2EE8A 4DV7E 5LLQA 2EM3A 4TUGA 2YTIA 2DSYA 2ODRC 2CTDA 2WBTA 4JI6E 4B3RE 4R2SA 1N33E 2V86A 3JU0A 4ZYHA 2EQ3A 2EZ6A 4DR3E 2BB8A 2JOBA 4LF9E 4R2CA 1JK2A 2JY9A 2YU5A 5TSEA 4B3SE 1EH6A 2WCC3 4X64E 1A1GA 1X6EA 2EM5A 1WXRA 2LTRA 2UU9E 3F6HA 2E72A 1T4OA 2NABA 1A1KA 2F8BA 2JPAA 3VK6A 2EOEA 4LF4E 1NEIA 5CFFE 2YTFA 2K4VA 3DF6A 4YY3E 2EORA 2EL5A 1EH8A 4LF5E 2ZM6E 2EMBA 5KL4A 1HR0E 3K6QA 4AQYE 4NXME 2WZOA 3EPJA 1SFEA 3BGHA 3T1HE 1T4NA 2B7VA 2L2NA 1RQ0A 4ZYDA 1EH7A 5KL7A 2LRSA 2FTXB 5T6JA 2E1MA 2EQ0A 3BIDA 2ELYA 4RH8A 2YTJA 2M7QA 3ADLA 1PJTA 2V85A 4DV3E 4LF8E 4X8WA 5FLXC 3VYXA 1L4SA 1FKAE 2NUFA 1LLMC 2LMZA 2IHR1 2LV2A 4M2ZA 4LF7E 2N3HA 2B7TA 2CPNA 4DR4E 4BBYA 2A25A 2YTPA 2UXCE 1F2IG 2ENAA 2EMLA 3KZYA 2ODRD 5LMNE 1X3CA 4MLVA 2KONA 2WBSA 2EOZA 4LFAE 3M99B 1QU6A 1N32E 2YWQA 3C6KA 4J8ZA 2RSIA 4WXCA 2EP3A 1IQSA 2YTGA 4O43A 2EOHA 2N8XA 4WXDA 5LL6R 1HNXE 1WJPA 4GKKE 1TF6A 2VQEE 2CSHA 1IQOA 1XMQE 2I9IA 4MLQA 4JI1E 2EPRA 2EOQA 2EMFA 2L3CA 4F6MA 2EN3A 2MDRA 2EJ4A 1YFHA 1T4LB 3OMLA 1Z1BA 3HTXA 2YTNA 4R2EA 2GLIA 2H36X 2VF1A 4F2JC 3J7AG 2FV4B 1X6FA 2NUGA 4DR7E 2EPOA 1YUJA 1GZ6A 2EL6A 2EMAA 2BBGA 2JVAA 3LLHA 4P7DA 3T1YE 2MDGA 2WBUA 2EM9A 1PJSA 2EM6A 4WSPA 1ZBTA 2EPNA 4OOGC 1KJKA 2EOXA 5A6BD 2LCEA 4DR2E 1HNWE 3MSWA 2JR1A 4Q35B 1A1IA 4HEIA 3MHSC 2EN4A 2EPPA 4M0VA 1UHZA 5KL6A 1DGCA 1JK1A 4JI7E 2EWLA 5A6BA 2V89A 5DNYA 2NA2A 4ZYGA 1J5EE 4JI0E 2RQLA 4YHHE 4WPYA 1B69A 2RS7A 4JYAE 3EPLA 4WSGA 2RTXA 2UUCE 5A2QC 1AH5A 4IS1C 1YPNA 1DI2A 2JXPA 1EKZA 2ENCA 5ADZA 4BC7A 2HJJA 1N3GA 4M9VC 2YPNA 4O24A 3UK3C 3RMPA 5BR8E 2ELZA 2KHXA 4WX9A 2HC5A 3LMLA 3HPSA 4R2PA 4DV1E 4JI8E 3TQMA 1ZBQA 2EPXA 4RHBB 3F6GA 4NZVA 1ZAAC 4DR5E 2L2KB 2V88A 3EQ1A 2L6MA 2M1SA 2E5LE 1QNTA 1P47A 4DV5E 2YRMA 2V87A 4BHCA 2Q8UA 2EPCA 2UXDE 2LE2A 1DQ3A 4F9AB 4F9BB 2YRKA 2L3JA 2B9DA 2NUEA 2LUPB 4R8OA 2RSMA 4R2DA 1J26A 3ADJA 2L92A 1YZ9A 2EN2A 2YRHA 2VQFE 1T39A 2YT4A 2EPZA 2FGGA 4B3ME 5A6KA 4DR6E 2M4IA 2EM8A 3EPKA 1X6HA 1PJQA 4LFCE 4GEQB 2LVHA 2EL4A 2YTEA 4L5NC 2JP9A 2UXBE 4O4KA 3IWBA 1UILA 4BHBA 2R76A 5KL2A 1N34E 2B3TB 1YYWA 1HNZE 4M30A 3OTOE 4BC9A 3JTZA 1BBOA 4JI2E 2YZTA 4N4RB 3QG5C 3VHTB 5KL3A 2EM2A 2EM4A 2YTQA 3HPZA 4P78A 3P1XA 4DV0E 4DMIA 3KWRA 2N3GA 2L8TA 3IWCA 1X49A 5AC5A 3THOB 1IMUA 3VYYA 2DRPA 1XNRE 5AE1A 2PRTA 3IWDA 3DJWA 1WHQA 4LF6E 4DKKA 4X66E 3THNA 1SR9A 4KZSA 4WYQB 2YSOA 2EN6A 1TF3A 3C4BA 1IBKE 1PKPA 2YTDA 5AASA 4O5GA 4BS9A 2EPMX 2YTOA 2UUBE 2EOJA 2EOOA 4R2QA 2J7JA 4BCAA 2MC6A 2EN1A 2K7IA 4X62E 1IBME 2LT7A 2V83A 3AUZA 1I94E 1N36E 3BBGA 2DIXA 4KWYA 3J7Yp 4DV6E 1UBDC 4GZNC 2EPUA 4LFBE 1A1LA 2EPKX 1GTKA 5A6JA 5IV8B 1GQEA 2VE7C 2EM7A 2YSPA 2EMWA 2VRDA 4B3TE 2EMGA 3J81C 4FK5C 3ADIA 2GPIA 5IWAE 4JI4E 2RS6A 1KYQA 5F3WA 1ZR9A 1ZU1A 4JI3E 1FJGE 4LTYA 1O0WA 2EOSA 3ADGA 2EMHA 4F9CB 4LU9A 2DGCA 2I13A 2JYAA 1RMDA 1X5WA 2L33A 2R1FA 3L00A 3H09A 3AV0A 5IT9C 2MKNA 4HTGA 1A1FA 2MC5A 2YU8A 4BMJA 2KOUA 4TUIA 2ENHA 3C6MA
chains in the Genus database with same CATH topology
5IV8B 4RHBB 4N4RB 3BF2A 4NHRA 5IXMB 4RH8A 2N8XA 2R76A 5TSEA 2JXPA 4KWYA 4Q35B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IV8 B;  4RHB B;  4N4R B;  3BF2 A;  4NHR A;  5IXM B;  4RH8 A;  2N8X A;  2R76 A;  5TSE A;  2JXP A;  4KWY A;  4Q35 B; 
#chains in the Genus database with same CATH topology
 3HQ1 A;  5AE3 A;  2G7H A;  5KL5 A;  1G2F C;  2F4V E;  1YYO A;  2EOF A;  1XMO E;  2LJU A;  4OX9 E;  4I8O A;  1MGT A;  5IXM B;  4F6N A;  1YSA C;  1G2D C;  1A1H A;  2DMY A;  3ZOQ B;  4R2R A;  5A6A A;  2V8Q B;  2M9A A;  2LJH A;  1UN6 B;  1WRJ A;  2LBS B;  4NXN E;  4L8N A;  2EN7 A;  4IJD A;  2DMI A;  4X9J A;  1TN9 A;  3JAM C;  3C4T A;  3ECR A;  4DUY E;  5AE2 A;  2UUA E;  2DLK A;  2EOM A;  2D9H A;  1IBL E;  4DR1 E;  3BF2 A;  4F54 A;  1BB8 A;  5AC4 A;  1X48 A;  2HGH A;  1XNQ E;  2EN8 A;  1BBG A;  2MKD A;  2GHF A;  2L2M A;  4NHR A;  1STU A;  5A69 A;  4JI5 E;  1WHN A;  1X47 A;  2EMC A;  2EOI A;  3J80 C;  1MEY C;  4DV2 E;  4X65 E;  1AAY A;  3KZZ A;  4JV5 E;  2EMZ A;  3HXL A;  1YYK A;  2LUQ A;  4KHP E;  2EMX A;  1A1J A;  4ZYE A;  1NCS A;  4DV4 E;  2DB2 A;  2JWO A;  2EPL X;  4Q28 A;  4GKJ E;  4WFT A;  2EM0 A;  2JOX A;  2CT1 A;  4R2A A;  2ADR A;  2DLQ A;  2EOY A;  5LMU E;  4DUZ E;  2EQ1 A;  2EMY A;  2LO3 A;  1RC7 A;  3FIG A;  1T38 A;  2RPC A;  2EMK A;  2EMI A;  1YUI A;  3MHH C;  2EPA A;  4K0K E;  4R03 A;  3EPH A;  1PDA A;  2LTS A;  2HHH E;  2EE8 A;  4DV7 E;  5LLQ A;  2EM3 A;  4TUG A;  2YTI A;  2DSY A;  2ODR C;  2CTD A;  2WBT A;  4JI6 E;  4B3R E;  4R2S A;  1N33 E;  2V86 A;  3JU0 A;  4ZYH A;  2EQ3 A;  2EZ6 A;  4DR3 E;  2BB8 A;  2JOB A;  4LF9 E;  4R2C A;  1JK2 A;  2JY9 A;  2YU5 A;  5TSE A;  4B3S E;  1EH6 A;  2WCC 3;  4X64 E;  1A1G A;  1X6E A;  2EM5 A;  1WXR A;  2LTR A;  2UU9 E;  3F6H A;  2E72 A;  1T4O A;  2NAB A;  1A1K A;  2F8B A;  2JPA A;  3VK6 A;  2EOE A;  4LF4 E;  1NEI A;  5CFF E;  2YTF A;  2K4V A;  3DF6 A;  4YY3 E;  2EOR A;  2EL5 A;  1EH8 A;  4LF5 E;  2ZM6 E;  2EMB A;  5KL4 A;  1HR0 E;  3K6Q A;  4AQY E;  4NXM E;  2WZO A;  3EPJ A;  1SFE A;  3BGH A;  3T1H E;  1T4N A;  2B7V A;  2L2N A;  1RQ0 A;  4ZYD A;  1EH7 A;  5KL7 A;  2LRS A;  2FTX B;  5T6J A;  2E1M A;  2EQ0 A;  3BID A;  2ELY A;  4RH8 A;  2YTJ A;  2M7Q A;  3ADL A;  1PJT A;  2V85 A;  4DV3 E;  4LF8 E;  4X8W A;  5FLX C;  3VYX A;  1L4S A;  1FKA E;  2NUF A;  1LLM C;  2LMZ A;  2IHR 1;  2LV2 A;  4M2Z A;  4LF7 E;  2N3H A;  2B7T A;  2CPN A;  4DR4 E;  4BBY A;  2A25 A;  2YTP A;  2UXC E;  1F2I G;  2ENA A;  2EML A;  3KZY A;  2ODR D;  5LMN E;  1X3C A;  4MLV A;  2KON A;  2WBS A;  2EOZ A;  4LFA E;  3M99 B;  1QU6 A;  1N32 E;  2YWQ A;  3C6K A;  4J8Z A;  2RSI A;  4WXC A;  2EP3 A;  1IQS A;  2YTG A;  4O43 A;  2EOH A;  2N8X A;  4WXD A;  5LL6 R;  1HNX E;  1WJP A;  4GKK E;  1TF6 A;  2VQE E;  2CSH A;  1IQO A;  1XMQ E;  2I9I A;  4MLQ A;  4JI1 E;  2EPR A;  2EOQ A;  2EMF A;  2L3C A;  4F6M A;  2EN3 A;  2MDR A;  2EJ4 A;  1YFH A;  1T4L B;  3OML A;  1Z1B A;  3HTX A;  2YTN A;  4R2E A;  2GLI A;  2H36 X;  2VF1 A;  4F2J C;  3J7A G;  2FV4 B;  1X6F A;  2NUG A;  4DR7 E;  2EPO A;  1YUJ A;  1GZ6 A;  2EL6 A;  2EMA A;  2BBG A;  2JVA A;  3LLH A;  4P7D A;  3T1Y E;  2MDG A;  2WBU A;  2EM9 A;  1PJS A;  2EM6 A;  4WSP A;  1ZBT A;  2EPN A;  4OOG C;  1KJK A;  2EOX A;  5A6B D;  2LCE A;  4DR2 E;  1HNW E;  3MSW A;  2JR1 A;  4Q35 B;  1A1I A;  4HEI A;  3MHS C;  2EN4 A;  2EPP A;  4M0V A;  1UHZ A;  5KL6 A;  1DGC A;  1JK1 A;  4JI7 E;  2EWL A;  5A6B A;  2V89 A;  5DNY A;  2NA2 A;  4ZYG A;  1J5E E;  4JI0 E;  2RQL A;  4YHH E;  4WPY A;  1B69 A;  2RS7 A;  4JYA E;  3EPL A;  4WSG A;  2RTX A;  2UUC E;  5A2Q C;  1AH5 A;  4IS1 C;  1YPN A;  1DI2 A;  2JXP A;  1EKZ A;  2ENC A;  5ADZ A;  4BC7 A;  2HJJ A;  1N3G A;  4M9V C;  2YPN A;  4O24 A;  3UK3 C;  3RMP A;  5BR8 E;  2ELZ A;  2KHX A;  4WX9 A;  2HC5 A;  3LML A;  3HPS A;  4R2P A;  4DV1 E;  4JI8 E;  3TQM A;  1ZBQ A;  2EPX A;  4RHB B;  3F6G A;  4NZV A;  1ZAA C;  4DR5 E;  2L2K B;  2V88 A;  3EQ1 A;  2L6M A;  2M1S A;  2E5L E;  1QNT A;  1P47 A;  4DV5 E;  2YRM A;  2V87 A;  4BHC A;  2Q8U A;  2EPC A;  2UXD E;  2LE2 A;  1DQ3 A;  4F9A B;  4F9B B;  2YRK A;  2L3J A;  2B9D A;  2NUE A;  2LUP B;  4R8O A;  2RSM A;  4R2D A;  1J26 A;  3ADJ A;  2L92 A;  1YZ9 A;  2EN2 A;  2YRH A;  2VQF E;  1T39 A;  2YT4 A;  2EPZ A;  2FGG A;  4B3M E;  5A6K A;  4DR6 E;  2M4I A;  2EM8 A;  3EPK A;  1X6H A;  1PJQ A;  4LFC E;  4GEQ B;  2LVH A;  2EL4 A;  2YTE A;  4L5N C;  2JP9 A;  2UXB E;  4O4K A;  3IWB A;  1UIL A;  4BHB A;  2R76 A;  5KL2 A;  1N34 E;  2B3T B;  1YYW A;  1HNZ E;  4M30 A;  3OTO E;  4BC9 A;  3JTZ A;  1BBO A;  4JI2 E;  2YZT A;  4N4R B;  3QG5 C;  3VHT B;  5KL3 A;  2EM2 A;  2EM4 A;  2YTQ A;  3HPZ A;  4P78 A;  3P1X A;  4DV0 E;  4DMI A;  3KWR A;  2N3G A;  2L8T A;  3IWC A;  1X49 A;  5AC5 A;  3THO B;  1IMU A;  3VYY A;  2DRP A;  1XNR E;  5AE1 A;  2PRT A;  3IWD A;  3DJW A;  1WHQ A;  4LF6 E;  4DKK A;  4X66 E;  3THN A;  1SR9 A;  4KZS A;  4WYQ B;  2YSO A;  2EN6 A;  1TF3 A;  3C4B A;  1IBK E;  1PKP A;  2YTD A;  5AAS A;  4O5G A;  4BS9 A;  2EPM X;  2YTO A;  2UUB E;  2EOJ A;  2EOO A;  4R2Q A;  2J7J A;  4BCA A;  2MC6 A;  2EN1 A;  2K7I A;  4X62 E;  1IBM E;  2LT7 A;  2V83 A;  3AUZ A;  1I94 E;  1N36 E;  3BBG A;  2DIX A;  4KWY A;  3J7Y p;  4DV6 E;  1UBD C;  4GZN C;  2EPU A;  4LFB E;  1A1L A;  2EPK X;  1GTK A;  5A6J A;  5IV8 B;  1GQE A;  2VE7 C;  2EM7 A;  2YSP A;  2EMW A;  2VRD A;  4B3T E;  2EMG A;  3J81 C;  4FK5 C;  3ADI A;  2GPI A;  5IWA E;  4JI4 E;  2RS6 A;  1KYQ A;  5F3W A;  1ZR9 A;  1ZU1 A;  4JI3 E;  1FJG E;  4LTY A;  1O0W A;  2EOS A;  3ADG A;  2EMH A;  4F9C B;  4LU9 A;  2DGC A;  2I13 A;  2JYA A;  1RMD A;  1X5W A;  2L33 A;  2R1F A;  3L00 A;  3H09 A;  3AV0 A;  5IT9 C;  2MKN A;  4HTG A;  1A1F A;  2MC5 A;  2YU8 A;  4BMJ A;  2KOU A;  4TUI A;  2ENH A;  3C6M A; 
#chains in the Genus database with same CATH homology
 5IV8 B;  4RHB B;  4N4R B;  3BF2 A;  4NHR A;  5IXM B;  4RH8 A;  2N8X A;  2R76 A;  5TSE A;  2JXP A;  4KWY A;  4Q35 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...