4NHRA

Crystal structure of the outer membrane lipopolysaccharide transport protein lpte (rlpb)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
137
structure length
137
Chain Sequence
MKVMILDSGDPNGPLSRAVRNQLRLNGVELLDKETTRKDVPSLRLGKVSIAKDTASVFRNGQTAEYQMIMTVNATVLIPGRDIYPISAKVFRSFFDNPQMALAKDNEQDMIVKEMYDRAAEQLIRKLPSIRAADIRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords LPS-assembly lipoprotein LptE
publication title LptE binds to and alters the physical state of LPS to catalyze its assembly at the cell surface.
pubmed doi rcsb
source organism Escherichia coli
total genus 30
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2013-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04390 LptE Lipopolysaccharide-assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 4nhrA00
3BF2A 5TSEA 5IXMB 4N4RB 4RH8A 2JXPA 2R76A 4KWYA 2N8XA 4NHRA 4Q35B 5IV8B 4RHBB
chains in the Genus database with same CATH superfamily
3JTZA 2WBTA 2EJ4A 2N3GA 2ELZA 4R2DA 1KJKA 2EN7A 2BBGA 2LT7A 2UXDE 3KWRA 4LU9A 2EPLX 1N32E 1PDAA 4X62E 1B69A 4DR3E 2YWQA 4GEQB 2EN6A 1SR9A 4AQYE 2YTOA 2EPOA 1IBLE 4LFCE 1UN6B 5LMNE 2RS7A 2RSMA 2YTQA 4JI4E 4I8OA 2EMXA 2EOMA 2B7VA 2DGCA 4WFTA 4R2CA 1A1KA 2UU9E 4YHHE 2DMIA 4LFBE 2A25A 1A1LA 3J7AG 4BCAA 4KHPE 1A1GA 2EMWA 2MDRA 4O43A 1YYWA 2LE2A 4F2JC 4DV4E 4LFAE 4K0KE 1YUJA 2EOFA 2EPRA 2YRHA 4HEIA 1N36E 3VHTB 2EMIA 2F8BA 2L33A 2YTIA 2ENCA 2YTPA 2JOBA 1BB8A 4M0VA 3KZZA 4M9VC 1IBKE 1STUA 2V89A 4BS9A 2VQFE 2B3TB 2EN2A 2EM0A 4MLQA 2CTDA 5AASA 2LO3A 2EL6A 2KONA 2EZ6A 1IQSA 1PJTA 2V8QB 4DUZE 4DKKA 2EWLA 1G2DC 2M1SA 2L2NA 4BHCA 4NXME 3JU0A 4JI6E 2EQ0A 2JR1A 5AE2A 2UUBE 3THOB 1WHQA 2NUFA 2D9HA 3AUZA 2LV2A 4MLVA 2EPCA 2EOXA 1GQEA 2NABA 2EMZA 2YTDA 2UUAE 4LF7E 3EPJA 2EN3A 1ZAAC 2EMHA 2EPAA 1YZ9A 2L3CA 1GZ6A 4LTYA 2M9AA 2NA2A 3IWDA 2YRKA 2RQLA 1WHNA 2EP3A 1ZBTA 1IMUA 4DR7E 2V87A 4X66E 1YYKA 2EPKX 1Z1BA 2L2KB 2PRTA 3EPLA 5AC4A 4R2SA 3M99B 4LF4E 2NUGA 3VK6A 4OX9E 2MC5A 4DV3E 4JI0E 1AH5A 3P1XA 4Q35B 4DV6E 1LLMC 2ENHA 1WXRA 3VYXA 1EH7A 4P7DA 4P78A 3ADIA 3RMPA 1T4LB 2R1FA 1X6HA 2EM4A 2MKNA 2KHXA 5BR8E 4BHBA 3LMLA 4X65E 1ZR9A 2YU8A 4WPYA 1UILA 2WCC3 2YU5A 4R03A 2EOJA 5A69A 1YFHA 2FTXB 4DV2E 5KL2A 4JI2E 1J5EE 2CSHA 3ADGA 1FKAE 4NZVA 2EPZA 4R2QA 1HNZE 1UBDC 3C4TA 4F54A 2YPNA 1BBGA 3ADJA 2EM6A 5IV8B 2YTJA 2EOOA 4F6NA 1IBME 2EM9A 4WXDA 4TUGA 2RPCA 5F3WA 4LF8E 5KL5A 4DR1E 1A1HA 5KL4A 5A6BD 1QU6A 4ZYHA 1JK1A 2JP9A 5A6JA 2ZM6E 1G2FC 2YTFA 4R2EA 2DSYA 1P47A 2CPNA 4O5GA 4M2ZA 4JV5E 3MHSC 2EOEA 2JVAA 3L00A 4BC9A 2L2MA 4WX9A 4R2AA 4F9AB 3QG5C 4B3SE 5A2QC 1YPNA 2Q8UA 2HC5A 2LUPB 2EOIA 2R76A 4KWYA 1F2IG 3C4BA 1GTKA 4R2PA 1T38A 2E5LE 2LUQA 2E72A 1TN9A 5CFFE 2EMGA 2E1MA 4HTGA 1XNRE 1KYQA 1MGTA 5IXMB 2LCEA 1BBOA 3DF6A 2EPMX 2GPIA 1UHZA 4DR4E 2EE8A 4DR2E 3DJWA 3MHHC 2DB2A 2EM2A 2FGGA 3J7Yp 1N33E 2WZOA 2EOZA 1XNQE 4ZYEA 4X8WA 4O4KA 1O0WA 2DLQA 2V85A 3HTXA 1XMOE 2EM3A 4BMJA 1X47A 4ZYDA 1IQOA 2DLKA 2UUCE 3EPHA 2F4VE 2EPPA 2EMLA 2JWOA 2EMCA 3OTOE 3VYYA 2I13A 5AC5A 2EN1A 2EPNA 2JYAA 2YTGA 1EH6A 2I9IA 2JXPA 2L6MA 4LF5E 2YSOA 2G7HA 4WSGA 2EPUA 2YT4A 2VRDA 1PKPA 1WRJA 2LRSA 3J81C 1YUIA 4YY3E 2LVHA 2N3HA 2EMKA 4WSPA 4DR5E 1ZBQA 4R8OA 3HPZA 4M30A 2JOXA 2UXBE 2HJJA 3KZYA 2NUEA 2ENAA 2GHFA 1DGCA 1QNTA 1L4SA 5ADZA 4IJDA 1FJGE 4JI3E 2EN4A 1HNXE 1HNWE 4O24A 1WJPA 3ECRA 1HR0E 2EM8A 4RHBB 2V88A 2LJHA 2UXCE 4X9JA 2FV4B 3F6HA 3UK3C 3JAMC 5LL6R 2EM5A 2ODRD 1X6EA 1AAYA 3EQ1A 5FLXC 2EMBA 3BGHA 2EOQA 2L8TA 3HXLA 2V86A 1A1IA 2YTEA 5IWAE 2YSPA 2EL4A 2IHR1 4L5NC 5KL7A 3T1HE 3K6QA 4NHRA 2ELYA 1I94E 2VF1A 1RC7A 4DV5E 3THNA 1PJQA 4DMIA 2HHHE 2JY9A 2VQEE 2YRMA 3C6MA 4FK5C 2M4IA 3H09A 4GKKE 4B3ME 2EOSA 2K7IA 4L8NA 2RS6A 4X64E 2DMYA 4LF6E 4OOGC 4J8ZA 1NEIA 2H36X 4JYAE 4DV1E 5AE1A 2EL5A 2KOUA 3OMLA 4JI1E 2K4VA 2WBSA 4F6MA 1N3GA 4ZYGA 1SFEA 1X3CA 4DV7E 1T4OA 1YYOA 1RQ0A 1TF6A 1T4NA 4KZSA 3AV0A 2WBUA 4DR6E 3HQ1A 2YTNA 2LJUA 1TF3A 1PJSA 2L92A 4F9BB 3BF2A 5TSEA 1N34E 3EPKA 2EMAA 2EQ1A 2ODRC 2LTSA 4B3TE 5DNYA 5LMUE 1X49A 4BBYA 4DUYE 3T1YE 2B9DA 4NXNE 4GZNC 2EN8A 1YSAC 2EM7A 2BB8A 2EPXA 4WXCA 1T39A 2M7QA 3MSWA 3LLHA 2B7TA 1X5WA 4TUIA 4JI8E 5A6KA 2GLIA 4LF9E 3TQMA 4GKJE 1A1JA 4JI5E 2RTXA 1RMDA 4WYQB 5T6JA 2VE7C 2LTRA 1XMQE 1J26A 5LLQA 3J80C 3HPSA 3C6KA 2L3JA 2JPAA 1X6FA 4B3RE 2LMZA 1NCSA 2J7JA 3IWBA 4Q28A 1EKZA 1DQ3A 3BBGA 1A1FA 2EMFA 2EMYA 2EOYA 4IS1C 3ADLA 2EQ3A 3ZOQB 2CT1A 2MDGA 3FIGA 5KL6A 2DRPA 3BIDA 2HGHA 1EH8A 2EOHA 2DIXA 1X48A 2MKDA 3IWCA 4RH8A 4BC7A 2LBSB 2V83A 4R2RA 1ZU1A 2ADRA 1DI2A 1MEYC 5A6AA 4F9CB 2MC6A 5A6BA 4DV0E 3F6GA 5AE3A 2YZTA 2N8XA 1JK2A 2EORA 4JI7E 4N4RB 5IT9C 5KL3A 2RSIA
chains in the Genus database with same CATH topology
3BF2A 5TSEA 5IXMB 4N4RB 4RH8A 2JXPA 2R76A 4KWYA 2N8XA 4NHRA 4Q35B 5IV8B 4RHBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BF2 A;  5TSE A;  5IXM B;  4N4R B;  4RH8 A;  2JXP A;  2R76 A;  4KWY A;  2N8X A;  4NHR A;  4Q35 B;  5IV8 B;  4RHB B; 
#chains in the Genus database with same CATH topology
 3JTZ A;  2WBT A;  2EJ4 A;  2N3G A;  2ELZ A;  4R2D A;  1KJK A;  2EN7 A;  2BBG A;  2LT7 A;  2UXD E;  3KWR A;  4LU9 A;  2EPL X;  1N32 E;  1PDA A;  4X62 E;  1B69 A;  4DR3 E;  2YWQ A;  4GEQ B;  2EN6 A;  1SR9 A;  4AQY E;  2YTO A;  2EPO A;  1IBL E;  4LFC E;  1UN6 B;  5LMN E;  2RS7 A;  2RSM A;  2YTQ A;  4JI4 E;  4I8O A;  2EMX A;  2EOM A;  2B7V A;  2DGC A;  4WFT A;  4R2C A;  1A1K A;  2UU9 E;  4YHH E;  2DMI A;  4LFB E;  2A25 A;  1A1L A;  3J7A G;  4BCA A;  4KHP E;  1A1G A;  2EMW A;  2MDR A;  4O43 A;  1YYW A;  2LE2 A;  4F2J C;  4DV4 E;  4LFA E;  4K0K E;  1YUJ A;  2EOF A;  2EPR A;  2YRH A;  4HEI A;  1N36 E;  3VHT B;  2EMI A;  2F8B A;  2L33 A;  2YTI A;  2ENC A;  2YTP A;  2JOB A;  1BB8 A;  4M0V A;  3KZZ A;  4M9V C;  1IBK E;  1STU A;  2V89 A;  4BS9 A;  2VQF E;  2B3T B;  2EN2 A;  2EM0 A;  4MLQ A;  2CTD A;  5AAS A;  2LO3 A;  2EL6 A;  2KON A;  2EZ6 A;  1IQS A;  1PJT A;  2V8Q B;  4DUZ E;  4DKK A;  2EWL A;  1G2D C;  2M1S A;  2L2N A;  4BHC A;  4NXM E;  3JU0 A;  4JI6 E;  2EQ0 A;  2JR1 A;  5AE2 A;  2UUB E;  3THO B;  1WHQ A;  2NUF A;  2D9H A;  3AUZ A;  2LV2 A;  4MLV A;  2EPC A;  2EOX A;  1GQE A;  2NAB A;  2EMZ A;  2YTD A;  2UUA E;  4LF7 E;  3EPJ A;  2EN3 A;  1ZAA C;  2EMH A;  2EPA A;  1YZ9 A;  2L3C A;  1GZ6 A;  4LTY A;  2M9A A;  2NA2 A;  3IWD A;  2YRK A;  2RQL A;  1WHN A;  2EP3 A;  1ZBT A;  1IMU A;  4DR7 E;  2V87 A;  4X66 E;  1YYK A;  2EPK X;  1Z1B A;  2L2K B;  2PRT A;  3EPL A;  5AC4 A;  4R2S A;  3M99 B;  4LF4 E;  2NUG A;  3VK6 A;  4OX9 E;  2MC5 A;  4DV3 E;  4JI0 E;  1AH5 A;  3P1X A;  4Q35 B;  4DV6 E;  1LLM C;  2ENH A;  1WXR A;  3VYX A;  1EH7 A;  4P7D A;  4P78 A;  3ADI A;  3RMP A;  1T4L B;  2R1F A;  1X6H A;  2EM4 A;  2MKN A;  2KHX A;  5BR8 E;  4BHB A;  3LML A;  4X65 E;  1ZR9 A;  2YU8 A;  4WPY A;  1UIL A;  2WCC 3;  2YU5 A;  4R03 A;  2EOJ A;  5A69 A;  1YFH A;  2FTX B;  4DV2 E;  5KL2 A;  4JI2 E;  1J5E E;  2CSH A;  3ADG A;  1FKA E;  4NZV A;  2EPZ A;  4R2Q A;  1HNZ E;  1UBD C;  3C4T A;  4F54 A;  2YPN A;  1BBG A;  3ADJ A;  2EM6 A;  5IV8 B;  2YTJ A;  2EOO A;  4F6N A;  1IBM E;  2EM9 A;  4WXD A;  4TUG A;  2RPC A;  5F3W A;  4LF8 E;  5KL5 A;  4DR1 E;  1A1H A;  5KL4 A;  5A6B D;  1QU6 A;  4ZYH A;  1JK1 A;  2JP9 A;  5A6J A;  2ZM6 E;  1G2F C;  2YTF A;  4R2E A;  2DSY A;  1P47 A;  2CPN A;  4O5G A;  4M2Z A;  4JV5 E;  3MHS C;  2EOE A;  2JVA A;  3L00 A;  4BC9 A;  2L2M A;  4WX9 A;  4R2A A;  4F9A B;  3QG5 C;  4B3S E;  5A2Q C;  1YPN A;  2Q8U A;  2HC5 A;  2LUP B;  2EOI A;  2R76 A;  4KWY A;  1F2I G;  3C4B A;  1GTK A;  4R2P A;  1T38 A;  2E5L E;  2LUQ A;  2E72 A;  1TN9 A;  5CFF E;  2EMG A;  2E1M A;  4HTG A;  1XNR E;  1KYQ A;  1MGT A;  5IXM B;  2LCE A;  1BBO A;  3DF6 A;  2EPM X;  2GPI A;  1UHZ A;  4DR4 E;  2EE8 A;  4DR2 E;  3DJW A;  3MHH C;  2DB2 A;  2EM2 A;  2FGG A;  3J7Y p;  1N33 E;  2WZO A;  2EOZ A;  1XNQ E;  4ZYE A;  4X8W A;  4O4K A;  1O0W A;  2DLQ A;  2V85 A;  3HTX A;  1XMO E;  2EM3 A;  4BMJ A;  1X47 A;  4ZYD A;  1IQO A;  2DLK A;  2UUC E;  3EPH A;  2F4V E;  2EPP A;  2EML A;  2JWO A;  2EMC A;  3OTO E;  3VYY A;  2I13 A;  5AC5 A;  2EN1 A;  2EPN A;  2JYA A;  2YTG A;  1EH6 A;  2I9I A;  2JXP A;  2L6M A;  4LF5 E;  2YSO A;  2G7H A;  4WSG A;  2EPU A;  2YT4 A;  2VRD A;  1PKP A;  1WRJ A;  2LRS A;  3J81 C;  1YUI A;  4YY3 E;  2LVH A;  2N3H A;  2EMK A;  4WSP A;  4DR5 E;  1ZBQ A;  4R8O A;  3HPZ A;  4M30 A;  2JOX A;  2UXB E;  2HJJ A;  3KZY A;  2NUE A;  2ENA A;  2GHF A;  1DGC A;  1QNT A;  1L4S A;  5ADZ A;  4IJD A;  1FJG E;  4JI3 E;  2EN4 A;  1HNX E;  1HNW E;  4O24 A;  1WJP A;  3ECR A;  1HR0 E;  2EM8 A;  4RHB B;  2V88 A;  2LJH A;  2UXC E;  4X9J A;  2FV4 B;  3F6H A;  3UK3 C;  3JAM C;  5LL6 R;  2EM5 A;  2ODR D;  1X6E A;  1AAY A;  3EQ1 A;  5FLX C;  2EMB A;  3BGH A;  2EOQ A;  2L8T A;  3HXL A;  2V86 A;  1A1I A;  2YTE A;  5IWA E;  2YSP A;  2EL4 A;  2IHR 1;  4L5N C;  5KL7 A;  3T1H E;  3K6Q A;  4NHR A;  2ELY A;  1I94 E;  2VF1 A;  1RC7 A;  4DV5 E;  3THN A;  1PJQ A;  4DMI A;  2HHH E;  2JY9 A;  2VQE E;  2YRM A;  3C6M A;  4FK5 C;  2M4I A;  3H09 A;  4GKK E;  4B3M E;  2EOS A;  2K7I A;  4L8N A;  2RS6 A;  4X64 E;  2DMY A;  4LF6 E;  4OOG C;  4J8Z A;  1NEI A;  2H36 X;  4JYA E;  4DV1 E;  5AE1 A;  2EL5 A;  2KOU A;  3OML A;  4JI1 E;  2K4V A;  2WBS A;  4F6M A;  1N3G A;  4ZYG A;  1SFE A;  1X3C A;  4DV7 E;  1T4O A;  1YYO A;  1RQ0 A;  1TF6 A;  1T4N A;  4KZS A;  3AV0 A;  2WBU A;  4DR6 E;  3HQ1 A;  2YTN A;  2LJU A;  1TF3 A;  1PJS A;  2L92 A;  4F9B B;  3BF2 A;  5TSE A;  1N34 E;  3EPK A;  2EMA A;  2EQ1 A;  2ODR C;  2LTS A;  4B3T E;  5DNY A;  5LMU E;  1X49 A;  4BBY A;  4DUY E;  3T1Y E;  2B9D A;  4NXN E;  4GZN C;  2EN8 A;  1YSA C;  2EM7 A;  2BB8 A;  2EPX A;  4WXC A;  1T39 A;  2M7Q A;  3MSW A;  3LLH A;  2B7T A;  1X5W A;  4TUI A;  4JI8 E;  5A6K A;  2GLI A;  4LF9 E;  3TQM A;  4GKJ E;  1A1J A;  4JI5 E;  2RTX A;  1RMD A;  4WYQ B;  5T6J A;  2VE7 C;  2LTR A;  1XMQ E;  1J26 A;  5LLQ A;  3J80 C;  3HPS A;  3C6K A;  2L3J A;  2JPA A;  1X6F A;  4B3R E;  2LMZ A;  1NCS A;  2J7J A;  3IWB A;  4Q28 A;  1EKZ A;  1DQ3 A;  3BBG A;  1A1F A;  2EMF A;  2EMY A;  2EOY A;  4IS1 C;  3ADL A;  2EQ3 A;  3ZOQ B;  2CT1 A;  2MDG A;  3FIG A;  5KL6 A;  2DRP A;  3BID A;  2HGH A;  1EH8 A;  2EOH A;  2DIX A;  1X48 A;  2MKD A;  3IWC A;  4RH8 A;  4BC7 A;  2LBS B;  2V83 A;  4R2R A;  1ZU1 A;  2ADR A;  1DI2 A;  1MEY C;  5A6A A;  4F9C B;  2MC6 A;  5A6B A;  4DV0 E;  3F6G A;  5AE3 A;  2YZT A;  2N8X A;  1JK2 A;  2EOR A;  4JI7 E;  4N4R B;  5IT9 C;  5KL3 A;  2RSI A; 
#chains in the Genus database with same CATH homology
 3BF2 A;  5TSE A;  5IXM B;  4N4R B;  4RH8 A;  2JXP A;  2R76 A;  4KWY A;  2N8X A;  4NHR A;  4Q35 B;  5IV8 B;  4RHB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...