2EOYA

Solution structure of the c2h2 type zinc finger (region 557-589) of human zinc finger protein 473
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
b'GSSGSSGQKEKCFKCNKCEKTFSCSKYLTQHERIHTRGVKSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 473
publication title Solution structure of the C2H2 type zinc finger (region 557-589) of human Zinc finger protein 473
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eoyA01
2E72A 2EM5A 2EMFA 2EL4A 3VHTB 2EMIA 2EMGA 2YU5A 2EMBA 1B69A 2EMCA 2J7JA 2M9AA 1KJKA 1A1HA 1DGCA 2EM3A 1YUJA 2YTOA 1UN6B 2EN4A 2GHFA 1A1JA 1ZAAC 3MHHC 3EPHA 2MDGA 2DRPA 2WBUA 2EMXA 5KL3A 2EN1A 2EOQA 2YTQA 2YTIA 2YRKA 2I13A 4R2DA 2EQ3A 1P47A 2EOXA 2EE8A 2EN8A 3EPLA 1A1IA 2EMWA 2LCEA 2YRHA 2EORA 2DGCA 2EOSA 1UBDC 1X3CA 2YTNA 1WJPA 2EPUA 1A1FA 2EQ0A 2YSPA 2RPCA 2EPPA 1X6HA 2YSOA 4R2SA 2LT7A 1JK2A 2JP9A 1G2DC 2EOYA 2BB8A 4GZNC 4R2PA 1YSAC 2NABA 2EOOA 2EM7A 1YUIA 1JK1A 5KL6A 2WBTA 1TN9A 2YTJA 1X6EA 1X6FA 4R2AA 4R2EA 4R2CA 4R2QA 2EMAA 2MKDA 2RSIA 3MHSC 1Z1BA 2DLQA 1MEYC 1TF3A 2YTFA 4F6MA 2EM8A 2MKNA 2EMLA 2EOMA 5KL4A 1BB8A 4F6NA 2R1FA 2EOJA 2YTDA 2JPAA 1G2FC 2EPZA 2EP3A 1BBOA 2YTGA 1LLMC 2EOIA 4WSGA 2D9HA 4FK5C 4X9JA 2EMZA 2EOHA 5KL7A 1AAYA 1TF6A 2EM2A 2EN3A 2ELYA 2PRTA 5KL5A 2EPRA 1ZR9A 2CT1A 2EM0A 2ENCA 2LV2A 2EJ4A 2ENAA 2EM9A 4IS1C 2YRMA 1X5WA 2EOEA 2YTEA 2EN6A 3UK3C 2ADRA 2EPAA 1ZU1A 1A1GA 3EPJA 1F2IG 2GLIA 4M9VC 1RMDA 5KL2A 4F2JC 4R2RA 3M99B 2EPXA 2CSHA 2EL5A 2EN2A 2YTPA 1A1KA 2EQ1A 2A25A 2WCC3 2ENHA 2EMHA 2LO3A 2YU8A 3EPKA 1NCSA 2DMIA 2EL6A 2EOZA 2EPCA 2WBSA 2CTDA 2EM6A 2HGHA 4IJDA 2LVHA 2VRDA 2EMYA 1A1LA 2EN7A 2DLKA 2EOFA 2EM4A 2EMKA 2ELZA
chains in the Genus database with same CATH superfamily
2E72A 3VHTB 5A6JA 3T1YE 1B69A 2EMCA 2J7JA 2JOBA 5CFFE 2YTOA 4BCAA 2GHFA 4YY3E 1ZAAC 4MLQA 5AASA 3MHHC 2R76A 2V87A 1HNXE 4LU9A 2MDGA 5AE1A 1PJTA 2DRPA 2N3GA 4DR4E 2ODRC 5KL3A 5FLXC 2EOQA 3BF2A 2M4IA 4M2ZA 3TQMA 2YTQA 2YTIA 2EQ3A 1O0WA 2HHHE 4LTYA 1WHQA 1P47A 1QU6A 3JU0A 2EE8A 3JAMC 4NZVA 1T4NA 5IV8B 3DJWA 1HNWE 1X3CA 2YTNA 4JI1E 3L00A 4DR5E 3IWDA 2LRSA 2YSOA 1T38A 3KZZA 4LFCE 4ZYGA 2EOYA 5AC5A 2LMZA 1EH7A 1YUIA 1JK1A 3HXLA 2EPOA 3VYYA 1IBME 2L92A 2MKDA 1TF3A 4WXCA 1UHZA 4O43A 2KOUA 1BB8A 4F6NA 4JI4E 2EOJA 2EP3A 2NUGA 2NUFA 4NHRA 2HJJA 2BBGA 2EMZA 2EOHA 1RC7A 5KL7A 1AAYA 3LMLA 1IMUA 2PRTA 4B3ME 1YYOA 4P78A 1ZR9A 1PJSA 1YYWA 1XMOE 2ENAA 2LUPB 4WX9A 1X5WA 3C4BA 3C4TA 2V88A 1HR0E 3FIGA 4M9VC 2UXDE 2NUEA 5KL2A 5TSEA 3M99B 3BIDA 4B3SE 4BC9A 1HNZE 1GQEA 2YTPA 3J81C 1A1KA 4LF6E 4RHBB 3HPZA 2B9DA 2LO3A 4M0VA 2H36X 4KWYA 2EPCA 2RS7A 1EKZA 2EMYA 5A6KA 4DV6E 3J7Yp 2DB2A 2L3CA 2ELZA 4WSPA 4GKJE 2EM5A 2EMFA 4RH8A 2EMIA 2EMGA 2YU5A 2GPIA 2EMBA 2IHR1 4DV4E 4J8ZA 2LTSA 1KJKA 1DGCA 1EH8A 2YT4A 3AUZA 4JI0E 1UN6B 5A6BD 2UXCE 1EH6A 4LF5E 4KZSA 4BHCA 2LJHA 1DQ3A 3T1HE 2WBUA 3HQ1A 2V85A 4GEQB 2LE2A 2L33A 4NXNE 2FTXB 2M1SA 1N32E 4R2DA 3IWBA 3QG5C 4BHBA 3EPLA 4DR7E 2EORA 2DGCA 3C6KA 3RMPA 1X49A 2RPCA 4R2SA 2I9IA 1JK2A 2B3TB 4O4KA 5A6AA 4R2PA 2L2KB 2EOOA 2ODRD 2L3JA 4AQYE 4B3TE 2N3HA 1X6EA 1X6FA 2EWLA 5F3WA 2RQLA 2YPNA 4O24A 4L8NA 1MEYC 2EPKX 4JI5E 2F8BA 4TUIA 5BR8E 4K0KE 4P7DA 4N4RB 4DR2E 2YTDA 2ZM6E 4WPYA 4BC7A 4WSGA 3KZYA 1N34E 5IT9C 1XNRE 2KHXA 2DMYA 2ENCA 1T4OA 5DNYA 2LV2A 2FV4B 4JI2E 4IS1C 2FGGA 3ZOQB 2EOEA 2YTEA 4JI3E 1UILA 3UK3C 2CPNA 2ADRA 3ECRA 1ZU1A 5AC4A 1F2IG 1AH5A 1RMDA 4R2RA 5AE2A 3K6QA 1RQ0A 2CSHA 2EL5A 2EN2A 3BBGA 5T6JA 3H09A 3J80C 2WCC3 2LUQA 2DMIA 2EOZA 2L2NA 2EM6A 4OOGC 2HGHA 2LVHA 2L6MA 2EN7A 2UU9E 2E1MA 2JYAA 3HTXA 5LMUE 3AV0A 3F6GA 2LBSB 4LF8E 1PJQA 2EM3A 2JVAA 2L8TA 2YZTA 2EN4A 4DR1E 4JV5E 4DV3E 1GTKA 1MGTA 1XNQE 2JXPA 4HEIA 3HPSA 1J5EE 4ZYHA 2MC6A 2K7IA 2EMWA 2LCEA 2YRHA 3VYXA 2EOSA 1FJGE 1STUA 2EPUA 1A1FA 2JP9A 2EPPA 2EPLX 1G2DC 2BB8A 1YSAC 2NABA 3OMLA 2EM7A 4LFBE 5KL6A 2YTJA 3OTOE 2V86A 4R2AA 4R2EA 5A6BA 1T39A 4X8WA 2JOXA 1YFHA 4JYAE 4F9CB 2YTFA 4F6MA 2UUBE 4DUZE 2EMLA 2R1FA 2JPAA 1G2FC 4DV1E 2L2MA 4R03A 2YTGA 4DV5E 2DIXA 2V83A 5LL6R 2D9HA 4BMJA 5ADZA 1KYQA 4X66E 2JR1A 2LTRA 1SR9A 4LFAE 1IQOA 4F9AB 3DF6A 4NXME 5LLQA 5LMNE 5KL5A 2YWQA 2CT1A 2EM0A 3ADLA 4LF9E 2EJ4A 4KHPE 2EM9A 2YRMA 1NEIA 3F6HA 2EN6A 4BS9A 2EPAA 1IBLE 1A1GA 2GLIA 3EQ1A 2M7QA 3KWRA 4ZYDA 4Q35B 4DMIA 4LF7E 2EQ1A 2ENHA 1WHNA 2YU8A 2UUCE 4B3RE 1NCSA 2WBSA 2EL6A 4YHHE 2KONA 2CTDA 4IJDA 2HC5A 1A1LA 2EOFA 1BBGA 2MDRA 2EL4A 4F54A 4Q28A 4X62E 4MLVA 2JY9A 2M9AA 1QNTA 1A1HA 4GKKE 1YUJA 1WRJA 4I8OA 2N8XA 1A1JA 5IWAE 3ADJA 1J26A 3EPHA 2VE7C 4X65E 3THOB 4DV2E 2EMXA 2EN1A 1N36E 1ZBTA 2LJUA 2YRKA 4O5GA 2I13A 1ZBQA 4WYQB 2EMKA 2EOXA 2EN8A 1X48A 2EZ6A 1A1IA 1L4SA 5IXMB 1UBDC 4F9BB 1WJPA 4DR3E 2EQ0A 1SFEA 4OX9E 2YSPA 2RSMA 2EPMX 2B7VA 2V8QB 1X6HA 2LT7A 1YZ9A 5AE3A 2JWOA 3LLHA 4GZNC 2VF1A 2RS6A 3THNA 4M30A 3ADGA 2WBTA 1TN9A 2MC5A 4R2CA 4R2QA 2EMAA 2VQFE 3MHSC 2RSIA 1Z1BA 2DLQA 2Q8UA 4X64E 2EM8A 2MKNA 5A2QC 1YYKA 4HTGA 4R8OA 2EOMA 5KL4A 1PDAA 3BGHA 3ADIA 1IQSA 1GZ6A 3JTZA 2EPNA 1I94E 2EPZA 4DV0E 1BBOA 4JI8E 1LLMC 2RTXA 2EOIA 2G7HA 4FK5C 4X9JA 4L5NC 1XMQE 2DSYA 1TF6A 4WFTA 2EM2A 2WZOA 1X47A 2EN3A 2ELYA 3J7AG 4DR6E 2NA2A 4WXDA 4JI6E 2EPRA 2V89A 1N3GA 4LF4E 3P1XA 2F4VE 3IWCA 2UXBE 1N33E 1DI2A 1T4LB 3EPJA 2UUAE 4DV7E 3VK6A 4TUGA 4F2JC 4DKKA 2E5LE 2EPXA 4BBYA 3C6MA 1IBKE 2A25A 2EMHA 4ZYEA 3EPKA 2B7TA 4JI7E 5A69A 2VQEE 1FKAE 2VRDA 1WXRA 2DLKA 2EM4A 3MSWA 4DUYE 2K4VA 1PKPA 1YPNA
chains in the Genus database with same CATH topology
2E72A 2EM5A 2EMFA 2EL4A 3VHTB 2EMIA 2EMGA 2YU5A 2EMBA 1B69A 2EMCA 2J7JA 2M9AA 1KJKA 1A1HA 1DGCA 2EM3A 1YUJA 2YTOA 1UN6B 2EN4A 2GHFA 1A1JA 1ZAAC 3MHHC 3EPHA 2MDGA 2DRPA 2WBUA 2EMXA 5KL3A 2EN1A 2EOQA 2YTQA 2YTIA 2YRKA 2I13A 4R2DA 2EQ3A 1P47A 2EOXA 2EE8A 2EN8A 3EPLA 1A1IA 2EMWA 2LCEA 2YRHA 2EORA 2DGCA 2EOSA 1UBDC 1X3CA 2YTNA 1WJPA 2EPUA 1A1FA 2EQ0A 2YSPA 2RPCA 2EPPA 1X6HA 2YSOA 4R2SA 2LT7A 1JK2A 2JP9A 1G2DC 2EOYA 2BB8A 4GZNC 4R2PA 1YSAC 2NABA 2EOOA 2EM7A 1YUIA 1JK1A 5KL6A 2WBTA 1TN9A 2YTJA 1X6EA 1X6FA 4R2AA 4R2EA 4R2CA 4R2QA 2EMAA 2MKDA 2RSIA 3MHSC 1Z1BA 2DLQA 1MEYC 1TF3A 2YTFA 4F6MA 2EM8A 2MKNA 2EMLA 2EOMA 5KL4A 1BB8A 4F6NA 2R1FA 2EOJA 2YTDA 2JPAA 1G2FC 2EPZA 2EP3A 1BBOA 2YTGA 1LLMC 2EOIA 4WSGA 2D9HA 4FK5C 4X9JA 2EMZA 2EOHA 5KL7A 1AAYA 1TF6A 2EM2A 2EN3A 2ELYA 2PRTA 5KL5A 2EPRA 1ZR9A 2CT1A 2EM0A 2ENCA 2LV2A 2EJ4A 2ENAA 2EM9A 4IS1C 2YRMA 1X5WA 2EOEA 2YTEA 2EN6A 3UK3C 2ADRA 2EPAA 1ZU1A 1A1GA 3EPJA 1F2IG 2GLIA 4M9VC 1RMDA 5KL2A 4F2JC 4R2RA 3M99B 2EPXA 2CSHA 2EL5A 2EN2A 2YTPA 1A1KA 2EQ1A 2A25A 2WCC3 2ENHA 2EMHA 2LO3A 2YU8A 3EPKA 1NCSA 2DMIA 2EL6A 2EOZA 2EPCA 2WBSA 2CTDA 2EM6A 2HGHA 4IJDA 2LVHA 2VRDA 2EMYA 1A1LA 2EN7A 2DLKA 2EOFA 2EM4A 2EMKA 2ELZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E72 A;  2EM5 A;  2EMF A;  2EL4 A;  3VHT B;  2EMI A;  2EMG A;  2YU5 A;  2EMB A;  1B69 A;  2EMC A;  2J7J A;  2M9A A;  1KJK A;  1A1H A;  1DGC A;  2EM3 A;  1YUJ A;  2YTO A;  1UN6 B;  2EN4 A;  2GHF A;  1A1J A;  1ZAA C;  3MHH C;  3EPH A;  2MDG A;  2DRP A;  2WBU A;  2EMX A;  5KL3 A;  2EN1 A;  2EOQ A;  2YTQ A;  2YTI A;  2YRK A;  2I13 A;  4R2D A;  2EQ3 A;  1P47 A;  2EOX A;  2EE8 A;  2EN8 A;  3EPL A;  1A1I A;  2EMW A;  2LCE A;  2YRH A;  2EOR A;  2DGC A;  2EOS A;  1UBD C;  1X3C A;  2YTN A;  1WJP A;  2EPU A;  1A1F A;  2EQ0 A;  2YSP A;  2RPC A;  2EPP A;  1X6H A;  2YSO A;  4R2S A;  2LT7 A;  1JK2 A;  2JP9 A;  1G2D C;  2EOY A;  2BB8 A;  4GZN C;  4R2P A;  1YSA C;  2NAB A;  2EOO A;  2EM7 A;  1YUI A;  1JK1 A;  5KL6 A;  2WBT A;  1TN9 A;  2YTJ A;  1X6E A;  1X6F A;  4R2A A;  4R2E A;  4R2C A;  4R2Q A;  2EMA A;  2MKD A;  2RSI A;  3MHS C;  1Z1B A;  2DLQ A;  1MEY C;  1TF3 A;  2YTF A;  4F6M A;  2EM8 A;  2MKN A;  2EML A;  2EOM A;  5KL4 A;  1BB8 A;  4F6N A;  2R1F A;  2EOJ A;  2YTD A;  2JPA A;  1G2F C;  2EPZ A;  2EP3 A;  1BBO A;  2YTG A;  1LLM C;  2EOI A;  4WSG A;  2D9H A;  4FK5 C;  4X9J A;  2EMZ A;  2EOH A;  5KL7 A;  1AAY A;  1TF6 A;  2EM2 A;  2EN3 A;  2ELY A;  2PRT A;  5KL5 A;  2EPR A;  1ZR9 A;  2CT1 A;  2EM0 A;  2ENC A;  2LV2 A;  2EJ4 A;  2ENA A;  2EM9 A;  4IS1 C;  2YRM A;  1X5W A;  2EOE A;  2YTE A;  2EN6 A;  3UK3 C;  2ADR A;  2EPA A;  1ZU1 A;  1A1G A;  3EPJ A;  1F2I G;  2GLI A;  4M9V C;  1RMD A;  5KL2 A;  4F2J C;  4R2R A;  3M99 B;  2EPX A;  2CSH A;  2EL5 A;  2EN2 A;  2YTP A;  1A1K A;  2EQ1 A;  2A25 A;  2WCC 3;  2ENH A;  2EMH A;  2LO3 A;  2YU8 A;  3EPK A;  1NCS A;  2DMI A;  2EL6 A;  2EOZ A;  2EPC A;  2WBS A;  2CTD A;  2EM6 A;  2HGH A;  4IJD A;  2LVH A;  2VRD A;  2EMY A;  1A1L A;  2EN7 A;  2DLK A;  2EOF A;  2EM4 A;  2EMK A;  2ELZ A; 
#chains in the Genus database with same CATH topology
 2E72 A;  3VHT B;  5A6J A;  3T1Y E;  1B69 A;  2EMC A;  2J7J A;  2JOB A;  5CFF E;  2YTO A;  4BCA A;  2GHF A;  4YY3 E;  1ZAA C;  4MLQ A;  5AAS A;  3MHH C;  2R76 A;  2V87 A;  1HNX E;  4LU9 A;  2MDG A;  5AE1 A;  1PJT A;  2DRP A;  2N3G A;  4DR4 E;  2ODR C;  5KL3 A;  5FLX C;  2EOQ A;  3BF2 A;  2M4I A;  4M2Z A;  3TQM A;  2YTQ A;  2YTI A;  2EQ3 A;  1O0W A;  2HHH E;  4LTY A;  1WHQ A;  1P47 A;  1QU6 A;  3JU0 A;  2EE8 A;  3JAM C;  4NZV A;  1T4N A;  5IV8 B;  3DJW A;  1HNW E;  1X3C A;  2YTN A;  4JI1 E;  3L00 A;  4DR5 E;  3IWD A;  2LRS A;  2YSO A;  1T38 A;  3KZZ A;  4LFC E;  4ZYG A;  2EOY A;  5AC5 A;  2LMZ A;  1EH7 A;  1YUI A;  1JK1 A;  3HXL A;  2EPO A;  3VYY A;  1IBM E;  2L92 A;  2MKD A;  1TF3 A;  4WXC A;  1UHZ A;  4O43 A;  2KOU A;  1BB8 A;  4F6N A;  4JI4 E;  2EOJ A;  2EP3 A;  2NUG A;  2NUF A;  4NHR A;  2HJJ A;  2BBG A;  2EMZ A;  2EOH A;  1RC7 A;  5KL7 A;  1AAY A;  3LML A;  1IMU A;  2PRT A;  4B3M E;  1YYO A;  4P78 A;  1ZR9 A;  1PJS A;  1YYW A;  1XMO E;  2ENA A;  2LUP B;  4WX9 A;  1X5W A;  3C4B A;  3C4T A;  2V88 A;  1HR0 E;  3FIG A;  4M9V C;  2UXD E;  2NUE A;  5KL2 A;  5TSE A;  3M99 B;  3BID A;  4B3S E;  4BC9 A;  1HNZ E;  1GQE A;  2YTP A;  3J81 C;  1A1K A;  4LF6 E;  4RHB B;  3HPZ A;  2B9D A;  2LO3 A;  4M0V A;  2H36 X;  4KWY A;  2EPC A;  2RS7 A;  1EKZ A;  2EMY A;  5A6K A;  4DV6 E;  3J7Y p;  2DB2 A;  2L3C A;  2ELZ A;  4WSP A;  4GKJ E;  2EM5 A;  2EMF A;  4RH8 A;  2EMI A;  2EMG A;  2YU5 A;  2GPI A;  2EMB A;  2IHR 1;  4DV4 E;  4J8Z A;  2LTS A;  1KJK A;  1DGC A;  1EH8 A;  2YT4 A;  3AUZ A;  4JI0 E;  1UN6 B;  5A6B D;  2UXC E;  1EH6 A;  4LF5 E;  4KZS A;  4BHC A;  2LJH A;  1DQ3 A;  3T1H E;  2WBU A;  3HQ1 A;  2V85 A;  4GEQ B;  2LE2 A;  2L33 A;  4NXN E;  2FTX B;  2M1S A;  1N32 E;  4R2D A;  3IWB A;  3QG5 C;  4BHB A;  3EPL A;  4DR7 E;  2EOR A;  2DGC A;  3C6K A;  3RMP A;  1X49 A;  2RPC A;  4R2S A;  2I9I A;  1JK2 A;  2B3T B;  4O4K A;  5A6A A;  4R2P A;  2L2K B;  2EOO A;  2ODR D;  2L3J A;  4AQY E;  4B3T E;  2N3H A;  1X6E A;  1X6F A;  2EWL A;  5F3W A;  2RQL A;  2YPN A;  4O24 A;  4L8N A;  1MEY C;  2EPK X;  4JI5 E;  2F8B A;  4TUI A;  5BR8 E;  4K0K E;  4P7D A;  4N4R B;  4DR2 E;  2YTD A;  2ZM6 E;  4WPY A;  4BC7 A;  4WSG A;  3KZY A;  1N34 E;  5IT9 C;  1XNR E;  2KHX A;  2DMY A;  2ENC A;  1T4O A;  5DNY A;  2LV2 A;  2FV4 B;  4JI2 E;  4IS1 C;  2FGG A;  3ZOQ B;  2EOE A;  2YTE A;  4JI3 E;  1UIL A;  3UK3 C;  2CPN A;  2ADR A;  3ECR A;  1ZU1 A;  5AC4 A;  1F2I G;  1AH5 A;  1RMD A;  4R2R A;  5AE2 A;  3K6Q A;  1RQ0 A;  2CSH A;  2EL5 A;  2EN2 A;  3BBG A;  5T6J A;  3H09 A;  3J80 C;  2WCC 3;  2LUQ A;  2DMI A;  2EOZ A;  2L2N A;  2EM6 A;  4OOG C;  2HGH A;  2LVH A;  2L6M A;  2EN7 A;  2UU9 E;  2E1M A;  2JYA A;  3HTX A;  5LMU E;  3AV0 A;  3F6G A;  2LBS B;  4LF8 E;  1PJQ A;  2EM3 A;  2JVA A;  2L8T A;  2YZT A;  2EN4 A;  4DR1 E;  4JV5 E;  4DV3 E;  1GTK A;  1MGT A;  1XNQ E;  2JXP A;  4HEI A;  3HPS A;  1J5E E;  4ZYH A;  2MC6 A;  2K7I A;  2EMW A;  2LCE A;  2YRH A;  3VYX A;  2EOS A;  1FJG E;  1STU A;  2EPU A;  1A1F A;  2JP9 A;  2EPP A;  2EPL X;  1G2D C;  2BB8 A;  1YSA C;  2NAB A;  3OML A;  2EM7 A;  4LFB E;  5KL6 A;  2YTJ A;  3OTO E;  2V86 A;  4R2A A;  4R2E A;  5A6B A;  1T39 A;  4X8W A;  2JOX A;  1YFH A;  4JYA E;  4F9C B;  2YTF A;  4F6M A;  2UUB E;  4DUZ E;  2EML A;  2R1F A;  2JPA A;  1G2F C;  4DV1 E;  2L2M A;  4R03 A;  2YTG A;  4DV5 E;  2DIX A;  2V83 A;  5LL6 R;  2D9H A;  4BMJ A;  5ADZ A;  1KYQ A;  4X66 E;  2JR1 A;  2LTR A;  1SR9 A;  4LFA E;  1IQO A;  4F9A B;  3DF6 A;  4NXM E;  5LLQ A;  5LMN E;  5KL5 A;  2YWQ A;  2CT1 A;  2EM0 A;  3ADL A;  4LF9 E;  2EJ4 A;  4KHP E;  2EM9 A;  2YRM A;  1NEI A;  3F6H A;  2EN6 A;  4BS9 A;  2EPA A;  1IBL E;  1A1G A;  2GLI A;  3EQ1 A;  2M7Q A;  3KWR A;  4ZYD A;  4Q35 B;  4DMI A;  4LF7 E;  2EQ1 A;  2ENH A;  1WHN A;  2YU8 A;  2UUC E;  4B3R E;  1NCS A;  2WBS A;  2EL6 A;  4YHH E;  2KON A;  2CTD A;  4IJD A;  2HC5 A;  1A1L A;  2EOF A;  1BBG A;  2MDR A;  2EL4 A;  4F54 A;  4Q28 A;  4X62 E;  4MLV A;  2JY9 A;  2M9A A;  1QNT A;  1A1H A;  4GKK E;  1YUJ A;  1WRJ A;  4I8O A;  2N8X A;  1A1J A;  5IWA E;  3ADJ A;  1J26 A;  3EPH A;  2VE7 C;  4X65 E;  3THO B;  4DV2 E;  2EMX A;  2EN1 A;  1N36 E;  1ZBT A;  2LJU A;  2YRK A;  4O5G A;  2I13 A;  1ZBQ A;  4WYQ B;  2EMK A;  2EOX A;  2EN8 A;  1X48 A;  2EZ6 A;  1A1I A;  1L4S A;  5IXM B;  1UBD C;  4F9B B;  1WJP A;  4DR3 E;  2EQ0 A;  1SFE A;  4OX9 E;  2YSP A;  2RSM A;  2EPM X;  2B7V A;  2V8Q B;  1X6H A;  2LT7 A;  1YZ9 A;  5AE3 A;  2JWO A;  3LLH A;  4GZN C;  2VF1 A;  2RS6 A;  3THN A;  4M30 A;  3ADG A;  2WBT A;  1TN9 A;  2MC5 A;  4R2C A;  4R2Q A;  2EMA A;  2VQF E;  3MHS C;  2RSI A;  1Z1B A;  2DLQ A;  2Q8U A;  4X64 E;  2EM8 A;  2MKN A;  5A2Q C;  1YYK A;  4HTG A;  4R8O A;  2EOM A;  5KL4 A;  1PDA A;  3BGH A;  3ADI A;  1IQS A;  1GZ6 A;  3JTZ A;  2EPN A;  1I94 E;  2EPZ A;  4DV0 E;  1BBO A;  4JI8 E;  1LLM C;  2RTX A;  2EOI A;  2G7H A;  4FK5 C;  4X9J A;  4L5N C;  1XMQ E;  2DSY A;  1TF6 A;  4WFT A;  2EM2 A;  2WZO A;  1X47 A;  2EN3 A;  2ELY A;  3J7A G;  4DR6 E;  2NA2 A;  4WXD A;  4JI6 E;  2EPR A;  2V89 A;  1N3G A;  4LF4 E;  3P1X A;  2F4V E;  3IWC A;  2UXB E;  1N33 E;  1DI2 A;  1T4L B;  3EPJ A;  2UUA E;  4DV7 E;  3VK6 A;  4TUG A;  4F2J C;  4DKK A;  2E5L E;  2EPX A;  4BBY A;  3C6M A;  1IBK E;  2A25 A;  2EMH A;  4ZYE A;  3EPK A;  2B7T A;  4JI7 E;  5A69 A;  2VQE E;  1FKA E;  2VRD A;  1WXR A;  2DLK A;  2EM4 A;  3MSW A;  4DUY E;  2K4V A;  1PKP A;  1YPN A; 
#chains in the Genus database with same CATH homology
 2E72 A;  2EM5 A;  2EMF A;  2EL4 A;  3VHT B;  2EMI A;  2EMG A;  2YU5 A;  2EMB A;  1B69 A;  2EMC A;  2J7J A;  2M9A A;  1KJK A;  1A1H A;  1DGC A;  2EM3 A;  1YUJ A;  2YTO A;  1UN6 B;  2EN4 A;  2GHF A;  1A1J A;  1ZAA C;  3MHH C;  3EPH A;  2MDG A;  2DRP A;  2WBU A;  2EMX A;  5KL3 A;  2EN1 A;  2EOQ A;  2YTQ A;  2YTI A;  2YRK A;  2I13 A;  4R2D A;  2EQ3 A;  1P47 A;  2EOX A;  2EE8 A;  2EN8 A;  3EPL A;  1A1I A;  2EMW A;  2LCE A;  2YRH A;  2EOR A;  2DGC A;  2EOS A;  1UBD C;  1X3C A;  2YTN A;  1WJP A;  2EPU A;  1A1F A;  2EQ0 A;  2YSP A;  2RPC A;  2EPP A;  1X6H A;  2YSO A;  4R2S A;  2LT7 A;  1JK2 A;  2JP9 A;  1G2D C;  2EOY A;  2BB8 A;  4GZN C;  4R2P A;  1YSA C;  2NAB A;  2EOO A;  2EM7 A;  1YUI A;  1JK1 A;  5KL6 A;  2WBT A;  1TN9 A;  2YTJ A;  1X6E A;  1X6F A;  4R2A A;  4R2E A;  4R2C A;  4R2Q A;  2EMA A;  2MKD A;  2RSI A;  3MHS C;  1Z1B A;  2DLQ A;  1MEY C;  1TF3 A;  2YTF A;  4F6M A;  2EM8 A;  2MKN A;  2EML A;  2EOM A;  5KL4 A;  1BB8 A;  4F6N A;  2R1F A;  2EOJ A;  2YTD A;  2JPA A;  1G2F C;  2EPZ A;  2EP3 A;  1BBO A;  2YTG A;  1LLM C;  2EOI A;  4WSG A;  2D9H A;  4FK5 C;  4X9J A;  2EMZ A;  2EOH A;  5KL7 A;  1AAY A;  1TF6 A;  2EM2 A;  2EN3 A;  2ELY A;  2PRT A;  5KL5 A;  2EPR A;  1ZR9 A;  2CT1 A;  2EM0 A;  2ENC A;  2LV2 A;  2EJ4 A;  2ENA A;  2EM9 A;  4IS1 C;  2YRM A;  1X5W A;  2EOE A;  2YTE A;  2EN6 A;  3UK3 C;  2ADR A;  2EPA A;  1ZU1 A;  1A1G A;  3EPJ A;  1F2I G;  2GLI A;  4M9V C;  1RMD A;  5KL2 A;  4F2J C;  4R2R A;  3M99 B;  2EPX A;  2CSH A;  2EL5 A;  2EN2 A;  2YTP A;  1A1K A;  2EQ1 A;  2A25 A;  2WCC 3;  2ENH A;  2EMH A;  2LO3 A;  2YU8 A;  3EPK A;  1NCS A;  2DMI A;  2EL6 A;  2EOZ A;  2EPC A;  2WBS A;  2CTD A;  2EM6 A;  2HGH A;  4IJD A;  2LVH A;  2VRD A;  2EMY A;  1A1L A;  2EN7 A;  2DLK A;  2EOF A;  2EM4 A;  2EMK A;  2ELZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...