2EOYA

Solution structure of the c2h2 type zinc finger (region 557-589) of human zinc finger protein 473
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGQKEKCFKCNKCEKTFSCSKYLTQHERIHTRGVKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 473
publication title Solution structure of the C2H2 type zinc finger (region 557-589) of human Zinc finger protein 473
rcsb
source organism Homo sapiens
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eoyA01
2LCEA 1X6EA 1G2DC 2JP9A 1A1KA 2EPZA 4R2EA 2EPXA 1JK1A 4R2DA 2YTPA 2EOXA 2DMIA 2EOEA 2WBUA 2EMAA 1A1GA 2GLIA 2MKDA 1TN9A 1YSAC 2WCC3 4R2AA 2LT7A 4R2SA 2EQ3A 2EN6A 2PRTA 2VRDA 2EOQA 1F2IG 1UBDC 5KL3A 2EMZA 2M9AA 1TF6A 2EOOA 2LVHA 3VHTB 2EM8A 4GZNC 2EPRA 2DLQA 2CT1A 2ENCA 3EPKA 1Z1BA 2EE8A 2JPAA 1X5WA 2EL4A 3MHHC 2EORA 1B69A 2EMCA 2MKNA 2EM5A 2EL6A 2YTIA 2EM0A 2YTQA 2YTDA 1AAYA 2ADRA 5KL7A 2EN2A 2EOYA 1JK2A 2BB8A 2I13A 2EPAA 2EMBA 2EPCA 5KL4A 4IJDA 4WSGA 3EPLA 1MEYC 4R2RA 4F6NA 3M99B 2YTOA 2EOJA 2EJ4A 4R2CA 2EMWA 2EMKA 1A1IA 1TF3A 2EL5A 2WBTA 2YRKA 1DGCA 2ELZA 4F2JC 2EOIA 1LLMC 1ZAAC 4IS1C 1G2FC 2R1FA 1X6FA 2EPUA 2EMFA 5KL2A 1BB8A 2YRMA 4R2PA 2YTEA 1ZR9A 2EQ0A 2YU8A 2EOMA 2EN7A 2YRHA 4R2QA 1KJKA 2YTNA 4X9JA 2ENAA 2EMGA 2LO3A 2YU5A 1WJPA 2EN1A 1YUIA 2EPPA 1NCSA 2DRPA 2ENHA 2WBSA 2EM3A 2EM7A 1A1JA 2EMHA 2YTGA 2J7JA 1A1LA 1RMDA 3EPJA 2EOSA 1A1HA 2EMYA 2RSIA 1X3CA 5KL5A 2E72A 2YTJA 2CTDA 2CSHA 1ZU1A 3UK3C 4F6MA 2EM4A 2EMIA 2EN4A 3EPHA 1P47A 1UN6B 2GHFA 1YUJA 2EMXA 2HGHA 2NABA 2EOHA 2EP3A 2A25A 2YTFA 1BBOA 1A1FA 2D9HA 2EN3A 2DLKA 2EN8A 2DGCA 4FK5C 2YSOA 2EMLA 2RPCA 2YSPA 3MHSC 1X6HA 4M9VC 2EM9A 2EM6A 2EOZA 2EM2A 2MDGA 2LV2A 2ELYA 2EOFA 5KL6A 2EQ1A
chains in the Genus database with same CATH superfamily
1RQ0A 1X6EA 4O4KA 1HR0E 2EPZA 2G7HA 3HXLA 2EPXA 4LF6E 2YTPA 2DMIA 2EOEA 2EPKX 2F4VE 2EMAA 1A1GA 4WYQB 1PJSA 4TUIA 2HJJA 4BMJA 2B9DA 1QNTA 4LFAE 1XNQE 1YYOA 2VRDA 1UBDC 5KL3A 2L3JA 3LMLA 5TSEA 2V85A 4JI7E 1EH8A 1N32E 3EPKA 4DV3E 1GZ6A 2LTRA 3HPZA 2B7VA 3MHHC 1B69A 2EMCA 1YYWA 4P78A 2EM5A 1EH7A 4P7DA 5A6BD 2YTDA 2Q8UA 1PJTA 1JK2A 1XMQE 2K4VA 4BS9A 2EPCA 3J7AG 3VYYA 3EPLA 4F6NA 2EWLA 2YTOA 4KZSA 4OX9E 2F8BA 3EQ1A 4WSPA 3F6HA 1GTKA 4M30A 2ODRC 1ZBTA 5IT9C 1G2FC 1SR9A 2EPUA 2MDRA 2JXPA 4LF8E 2EPNA 4R2QA 1KJKA 2M7QA 2ENAA 4X66E 3J7Yp 4DV5E 3THNA 1YUIA 1T4NA 2DRPA 2ENHA 1X49A 4JI1E 4BC7A 4GEQB 1O0WA 2EM7A 2YWQA 2EMHA 4ZYGA 1A1JA 3KWRA 5CFFE 1A1HA 4B3TE 2RSIA 5DNYA 2E72A 1UILA 2YTJA 4MLQA 4WPYA 2CSHA 2EM4A 2LUQA 2M4IA 2EN4A 1WHNA 3H09A 1P47A 1WHQA 1YUJA 1UHZA 4LF7E 1T4OA 4Q28A 4DV6E 2LBSB 3RMPA 1BBOA 5AE1A 1IBKE 1IBLE 1A1FA 1J26A 3VYXA 4FK5C 3MHSC 1X6HA 4M9VC 2EM6A 2EOZA 2EM2A 3QG5C 2ELYA 4M2ZA 1G2DC 4DR4E 2NA2A 2GPIA 1N36E 3HTXA 4B3ME 1TN9A 5BR8E 4DUZE 2RS7A 2L6MA 2LT7A 1N34E 3J81C 2KOUA 4GKJE 2EOQA 2RQLA 2NUFA 1TF6A 1T39A 4WX9A 3KZZA 3VHTB 4B3SE 2EPRA 4I8OA 4R03A 4BCAA 1PDAA 2CT1A 2JPAA 1X5WA 4LTYA 4JV5E 2EL6A 5AC4A 2EM0A 2MC6A 2RTXA 2YTQA 5KL7A 4WXCA 2BB8A 2I13A 4JI4E 2K7IA 5KL4A 3BGHA 4IJDA 4ZYDA 4BC9A 4LFBE 1WRJA 3C6MA 2JY9A 4YY3E 4R2CA 4DKKA 1N33E 2EMWA 4LF4E 2EL5A 2R76A 3ADIA 4JI6E 2ELZA 5A6AA 4JI5E 2UXBE 4ZYHA 2R1FA 1X6FA 3C6KA 1L4SA 5KL2A 4R2PA 2YTEA 2YU8A 2EN7A 2YTNA 2LO3A 1T4LB 2VQFE 2EN1A 1HNXE 4DR2E 2LE2A 2H36X 2KONA 5A2QC 4DV0E 2YTGA 2J7JA 5IXMB 2ZM6E 3EPJA 4L8NA 2EOSA 3MSWA 1X3CA 2LUPB 2UUCE 4F6MA 4TUGA 3EPHA 2EMXA 2EOHA 1ZBQA 2A25A 2BBGA 2YPNA 2YTFA 3BBGA 3HQ1A 2N3HA 4RH8A 2D9HA 2EN8A 2DGCA 3T1HE 2ODRD 1AH5A 3ADLA 2MDGA 1DQ3A 3C4TA 3IWCA 2V83A 4AQYE 3ZOQB 1HNZE 4R2EA 1JK1A 2NUEA 1N3GA 2UUBE 2WBUA 2GLIA 2MKDA 1YSAC 3DJWA 2WCC3 2DIXA 4DR7E 1MGTA 2RS6A 3DF6A 2JVAA 2EQ3A 5AC5A 5IWAE 4R2SA 3AV0A 2UXDE 1F2IG 2EMZA 2M9AA 4DR1E 4X64E 4WFTA 3L00A 1Z1BA 1RC7A 4RHBB 2L33A 2LTSA 2LMZA 4OOGC 1X48A 1AAYA 2ADRA 1T38A 1BBGA 2L2MA 3BF2A 5A6KA 4WSGA 2UUAE 5FLXC 2FV4B 4R2RA 5T6JA 3M99B 2VQEE 2MC5A 2N8XA 1A1IA 4ZYEA 2JR1A 2YRKA 1FJGE 2FTXB 2DB2A 1LLMC 2NUGA 4DR3E 1ZAAC 4IS1C 4JI8E 5AASA 4LFCE 3THOB 2IHR1 5LMUE 2UU9E 1IBME 2YRMA 2YZTA 2EPMX 2EQ0A 5A69A 1XMOE 1IQSA 4X9JA 2JOXA 4R8OA 2YU5A 1WJPA 4LF9E 2EPPA 4L5NC 3OMLA 1SFEA 4NZVA 4DUYE 4LU9A 2WBSA 4NXME 3VK6A 4O24A 2VF1A 2EM3A 4LF5E 2N3GA 1A1LA 1RMDA 1XNRE 1STUA 5A6JA 2KHXA 5F3WA 3BIDA 4N4RB 3AUZA 4X8WA 4KWYA 3C4BA 2EPLX 1ZU1A 2FGGA 3UK3C 4DV4E 4DV1E 1J5EE 5LMNE 2HGHA 2JOBA 2EP3A 2L92A 2V89A 1QU6A 3LLHA 5ADZA 2RPCA 4F9CB 4NHRA 2YSPA 2EM9A 3F6GA 2EOFA 2EQ1A 2LCEA 3ADGA 2JP9A 1A1KA 2VE7C 4HTGA 3OTOE 2V86A 4R2DA 4JI3E 2EOXA 2JYAA 5AE2A 4DMIA 2DSYA 2L2NA 4R2AA 1EKZA 4MLVA 1X47A 4B3RE 2V88A 2EN6A 2PRTA 5LL6R 2EOOA 4X65E 3IWDA 2LVHA 2EM8A 4GZNC 2E5LE 2DLQA 2ENCA 1PKPA 1IMUA 1FKAE 1YYKA 2LJHA 2EE8A 2CPNA 2EL4A 4BHBA 1EH6A 2EORA 2MKNA 2YTIA 4Q35B 2EPOA 3J80C 2WZOA 4BBYA 2EN2A 3JTZA 4DR5E 2EOYA 2M1SA 5LLQA 2EZ6A 2EPAA 4O5GA 5A6BA 2EMBA 3JAMC 2DMYA 4F9AB 4J8ZA 1MEYC 1YPNA 5AE3A 2EOJA 3JU0A 1YFHA 2EJ4A 1HNWE 4K0KE 1I94E 4KHPE 2UXCE 1IQOA 2EMKA 1TF3A 2WBTA 4YHHE 3KZYA 1DGCA 2RSMA 2V8QB 3HPSA 4F2JC 2EOIA 4X62E 2B7TA 2LJUA 4DR6E 1YZ9A 1DI2A 2EMFA 2I9IA 2E1MA 4HEIA 1BB8A 2L3CA 3T1YE 1ZR9A 2HHHE 2EOMA 2YRHA 1GQEA 2EMGA 2HC5A 4BHCA 4GKKE 4DV2E 1NCSA 4JI2E 2V87A 2L2KB 1WXRA 2YT4A 3K6QA 5IV8B 2EMYA 3P1XA 5KL5A 2L8TA 2LRSA 4JYAE 4M0VA 1NEIA 3TQMA 2CTDA 3ECRA 1KYQA 2EMIA 4NXNE 4F9BB 1UN6B 2GHFA 3IWBA 4O43A 4WXDA 4DV7E 4JI0E 2B3TB 2NABA 2EN3A 2DLKA 1PJQA 2YSOA 2EMLA 3ADJA 2JWOA 2LV2A 3FIGA 5KL6A 4F54A
chains in the Genus database with same CATH topology
2LCEA 1X6EA 1G2DC 2JP9A 1A1KA 2EPZA 4R2EA 2EPXA 1JK1A 4R2DA 2YTPA 2EOXA 2DMIA 2EOEA 2WBUA 2EMAA 1A1GA 2GLIA 2MKDA 1TN9A 1YSAC 2WCC3 4R2AA 2LT7A 4R2SA 2EQ3A 2EN6A 2PRTA 2VRDA 2EOQA 1F2IG 1UBDC 5KL3A 2EMZA 2M9AA 1TF6A 2EOOA 2LVHA 3VHTB 2EM8A 4GZNC 2EPRA 2DLQA 2CT1A 2ENCA 3EPKA 1Z1BA 2EE8A 2JPAA 1X5WA 2EL4A 3MHHC 2EORA 1B69A 2EMCA 2MKNA 2EM5A 2EL6A 2YTIA 2EM0A 2YTQA 2YTDA 1AAYA 2ADRA 5KL7A 2EN2A 2EOYA 1JK2A 2BB8A 2I13A 2EPAA 2EMBA 2EPCA 5KL4A 4IJDA 4WSGA 3EPLA 1MEYC 4R2RA 4F6NA 3M99B 2YTOA 2EOJA 2EJ4A 4R2CA 2EMWA 2EMKA 1A1IA 1TF3A 2EL5A 2WBTA 2YRKA 1DGCA 2ELZA 4F2JC 2EOIA 1LLMC 1ZAAC 4IS1C 1G2FC 2R1FA 1X6FA 2EPUA 2EMFA 5KL2A 1BB8A 2YRMA 4R2PA 2YTEA 1ZR9A 2EQ0A 2YU8A 2EOMA 2EN7A 2YRHA 4R2QA 1KJKA 2YTNA 4X9JA 2ENAA 2EMGA 2LO3A 2YU5A 1WJPA 2EN1A 1YUIA 2EPPA 1NCSA 2DRPA 2ENHA 2WBSA 2EM3A 2EM7A 1A1JA 2EMHA 2YTGA 2J7JA 1A1LA 1RMDA 3EPJA 2EOSA 1A1HA 2EMYA 2RSIA 1X3CA 5KL5A 2E72A 2YTJA 2CTDA 2CSHA 1ZU1A 3UK3C 4F6MA 2EM4A 2EMIA 2EN4A 3EPHA 1P47A 1UN6B 2GHFA 1YUJA 2EMXA 2HGHA 2NABA 2EOHA 2EP3A 2A25A 2YTFA 1BBOA 1A1FA 2D9HA 2EN3A 2DLKA 2EN8A 2DGCA 4FK5C 2YSOA 2EMLA 2RPCA 2YSPA 3MHSC 1X6HA 4M9VC 2EM9A 2EM6A 2EOZA 2EM2A 2MDGA 2LV2A 2ELYA 2EOFA 5KL6A 2EQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LCE A;  1X6E A;  1G2D C;  2JP9 A;  1A1K A;  2EPZ A;  4R2E A;  2EPX A;  1JK1 A;  4R2D A;  2YTP A;  2EOX A;  2DMI A;  2EOE A;  2WBU A;  2EMA A;  1A1G A;  2GLI A;  2MKD A;  1TN9 A;  1YSA C;  2WCC 3;  4R2A A;  2LT7 A;  4R2S A;  2EQ3 A;  2EN6 A;  2PRT A;  2VRD A;  2EOQ A;  1F2I G;  1UBD C;  5KL3 A;  2EMZ A;  2M9A A;  1TF6 A;  2EOO A;  2LVH A;  3VHT B;  2EM8 A;  4GZN C;  2EPR A;  2DLQ A;  2CT1 A;  2ENC A;  3EPK A;  1Z1B A;  2EE8 A;  2JPA A;  1X5W A;  2EL4 A;  3MHH C;  2EOR A;  1B69 A;  2EMC A;  2MKN A;  2EM5 A;  2EL6 A;  2YTI A;  2EM0 A;  2YTQ A;  2YTD A;  1AAY A;  2ADR A;  5KL7 A;  2EN2 A;  2EOY A;  1JK2 A;  2BB8 A;  2I13 A;  2EPA A;  2EMB A;  2EPC A;  5KL4 A;  4IJD A;  4WSG A;  3EPL A;  1MEY C;  4R2R A;  4F6N A;  3M99 B;  2YTO A;  2EOJ A;  2EJ4 A;  4R2C A;  2EMW A;  2EMK A;  1A1I A;  1TF3 A;  2EL5 A;  2WBT A;  2YRK A;  1DGC A;  2ELZ A;  4F2J C;  2EOI A;  1LLM C;  1ZAA C;  4IS1 C;  1G2F C;  2R1F A;  1X6F A;  2EPU A;  2EMF A;  5KL2 A;  1BB8 A;  2YRM A;  4R2P A;  2YTE A;  1ZR9 A;  2EQ0 A;  2YU8 A;  2EOM A;  2EN7 A;  2YRH A;  4R2Q A;  1KJK A;  2YTN A;  4X9J A;  2ENA A;  2EMG A;  2LO3 A;  2YU5 A;  1WJP A;  2EN1 A;  1YUI A;  2EPP A;  1NCS A;  2DRP A;  2ENH A;  2WBS A;  2EM3 A;  2EM7 A;  1A1J A;  2EMH A;  2YTG A;  2J7J A;  1A1L A;  1RMD A;  3EPJ A;  2EOS A;  1A1H A;  2EMY A;  2RSI A;  1X3C A;  5KL5 A;  2E72 A;  2YTJ A;  2CTD A;  2CSH A;  1ZU1 A;  3UK3 C;  4F6M A;  2EM4 A;  2EMI A;  2EN4 A;  3EPH A;  1P47 A;  1UN6 B;  2GHF A;  1YUJ A;  2EMX A;  2HGH A;  2NAB A;  2EOH A;  2EP3 A;  2A25 A;  2YTF A;  1BBO A;  1A1F A;  2D9H A;  2EN3 A;  2DLK A;  2EN8 A;  2DGC A;  4FK5 C;  2YSO A;  2EML A;  2RPC A;  2YSP A;  3MHS C;  1X6H A;  4M9V C;  2EM9 A;  2EM6 A;  2EOZ A;  2EM2 A;  2MDG A;  2LV2 A;  2ELY A;  2EOF A;  5KL6 A;  2EQ1 A; 
#chains in the Genus database with same CATH topology
 1RQ0 A;  1X6E A;  4O4K A;  1HR0 E;  2EPZ A;  2G7H A;  3HXL A;  2EPX A;  4LF6 E;  2YTP A;  2DMI A;  2EOE A;  2EPK X;  2F4V E;  2EMA A;  1A1G A;  4WYQ B;  1PJS A;  4TUI A;  2HJJ A;  4BMJ A;  2B9D A;  1QNT A;  4LFA E;  1XNQ E;  1YYO A;  2VRD A;  1UBD C;  5KL3 A;  2L3J A;  3LML A;  5TSE A;  2V85 A;  4JI7 E;  1EH8 A;  1N32 E;  3EPK A;  4DV3 E;  1GZ6 A;  2LTR A;  3HPZ A;  2B7V A;  3MHH C;  1B69 A;  2EMC A;  1YYW A;  4P78 A;  2EM5 A;  1EH7 A;  4P7D A;  5A6B D;  2YTD A;  2Q8U A;  1PJT A;  1JK2 A;  1XMQ E;  2K4V A;  4BS9 A;  2EPC A;  3J7A G;  3VYY A;  3EPL A;  4F6N A;  2EWL A;  2YTO A;  4KZS A;  4OX9 E;  2F8B A;  3EQ1 A;  4WSP A;  3F6H A;  1GTK A;  4M30 A;  2ODR C;  1ZBT A;  5IT9 C;  1G2F C;  1SR9 A;  2EPU A;  2MDR A;  2JXP A;  4LF8 E;  2EPN A;  4R2Q A;  1KJK A;  2M7Q A;  2ENA A;  4X66 E;  3J7Y p;  4DV5 E;  3THN A;  1YUI A;  1T4N A;  2DRP A;  2ENH A;  1X49 A;  4JI1 E;  4BC7 A;  4GEQ B;  1O0W A;  2EM7 A;  2YWQ A;  2EMH A;  4ZYG A;  1A1J A;  3KWR A;  5CFF E;  1A1H A;  4B3T E;  2RSI A;  5DNY A;  2E72 A;  1UIL A;  2YTJ A;  4MLQ A;  4WPY A;  2CSH A;  2EM4 A;  2LUQ A;  2M4I A;  2EN4 A;  1WHN A;  3H09 A;  1P47 A;  1WHQ A;  1YUJ A;  1UHZ A;  4LF7 E;  1T4O A;  4Q28 A;  4DV6 E;  2LBS B;  3RMP A;  1BBO A;  5AE1 A;  1IBK E;  1IBL E;  1A1F A;  1J26 A;  3VYX A;  4FK5 C;  3MHS C;  1X6H A;  4M9V C;  2EM6 A;  2EOZ A;  2EM2 A;  3QG5 C;  2ELY A;  4M2Z A;  1G2D C;  4DR4 E;  2NA2 A;  2GPI A;  1N36 E;  3HTX A;  4B3M E;  1TN9 A;  5BR8 E;  4DUZ E;  2RS7 A;  2L6M A;  2LT7 A;  1N34 E;  3J81 C;  2KOU A;  4GKJ E;  2EOQ A;  2RQL A;  2NUF A;  1TF6 A;  1T39 A;  4WX9 A;  3KZZ A;  3VHT B;  4B3S E;  2EPR A;  4I8O A;  4R03 A;  4BCA A;  1PDA A;  2CT1 A;  2JPA A;  1X5W A;  4LTY A;  4JV5 E;  2EL6 A;  5AC4 A;  2EM0 A;  2MC6 A;  2RTX A;  2YTQ A;  5KL7 A;  4WXC A;  2BB8 A;  2I13 A;  4JI4 E;  2K7I A;  5KL4 A;  3BGH A;  4IJD A;  4ZYD A;  4BC9 A;  4LFB E;  1WRJ A;  3C6M A;  2JY9 A;  4YY3 E;  4R2C A;  4DKK A;  1N33 E;  2EMW A;  4LF4 E;  2EL5 A;  2R76 A;  3ADI A;  4JI6 E;  2ELZ A;  5A6A A;  4JI5 E;  2UXB E;  4ZYH A;  2R1F A;  1X6F A;  3C6K A;  1L4S A;  5KL2 A;  4R2P A;  2YTE A;  2YU8 A;  2EN7 A;  2YTN A;  2LO3 A;  1T4L B;  2VQF E;  2EN1 A;  1HNX E;  4DR2 E;  2LE2 A;  2H36 X;  2KON A;  5A2Q C;  4DV0 E;  2YTG A;  2J7J A;  5IXM B;  2ZM6 E;  3EPJ A;  4L8N A;  2EOS A;  3MSW A;  1X3C A;  2LUP B;  2UUC E;  4F6M A;  4TUG A;  3EPH A;  2EMX A;  2EOH A;  1ZBQ A;  2A25 A;  2BBG A;  2YPN A;  2YTF A;  3BBG A;  3HQ1 A;  2N3H A;  4RH8 A;  2D9H A;  2EN8 A;  2DGC A;  3T1H E;  2ODR D;  1AH5 A;  3ADL A;  2MDG A;  1DQ3 A;  3C4T A;  3IWC A;  2V83 A;  4AQY E;  3ZOQ B;  1HNZ E;  4R2E A;  1JK1 A;  2NUE A;  1N3G A;  2UUB E;  2WBU A;  2GLI A;  2MKD A;  1YSA C;  3DJW A;  2WCC 3;  2DIX A;  4DR7 E;  1MGT A;  2RS6 A;  3DF6 A;  2JVA A;  2EQ3 A;  5AC5 A;  5IWA E;  4R2S A;  3AV0 A;  2UXD E;  1F2I G;  2EMZ A;  2M9A A;  4DR1 E;  4X64 E;  4WFT A;  3L00 A;  1Z1B A;  1RC7 A;  4RHB B;  2L33 A;  2LTS A;  2LMZ A;  4OOG C;  1X48 A;  1AAY A;  2ADR A;  1T38 A;  1BBG A;  2L2M A;  3BF2 A;  5A6K A;  4WSG A;  2UUA E;  5FLX C;  2FV4 B;  4R2R A;  5T6J A;  3M99 B;  2VQE E;  2MC5 A;  2N8X A;  1A1I A;  4ZYE A;  2JR1 A;  2YRK A;  1FJG E;  2FTX B;  2DB2 A;  1LLM C;  2NUG A;  4DR3 E;  1ZAA C;  4IS1 C;  4JI8 E;  5AAS A;  4LFC E;  3THO B;  2IHR 1;  5LMU E;  2UU9 E;  1IBM E;  2YRM A;  2YZT A;  2EPM X;  2EQ0 A;  5A69 A;  1XMO E;  1IQS A;  4X9J A;  2JOX A;  4R8O A;  2YU5 A;  1WJP A;  4LF9 E;  2EPP A;  4L5N C;  3OML A;  1SFE A;  4NZV A;  4DUY E;  4LU9 A;  2WBS A;  4NXM E;  3VK6 A;  4O24 A;  2VF1 A;  2EM3 A;  4LF5 E;  2N3G A;  1A1L A;  1RMD A;  1XNR E;  1STU A;  5A6J A;  2KHX A;  5F3W A;  3BID A;  4N4R B;  3AUZ A;  4X8W A;  4KWY A;  3C4B A;  2EPL X;  1ZU1 A;  2FGG A;  3UK3 C;  4DV4 E;  4DV1 E;  1J5E E;  5LMN E;  2HGH A;  2JOB A;  2EP3 A;  2L92 A;  2V89 A;  1QU6 A;  3LLH A;  5ADZ A;  2RPC A;  4F9C B;  4NHR A;  2YSP A;  2EM9 A;  3F6G A;  2EOF A;  2EQ1 A;  2LCE A;  3ADG A;  2JP9 A;  1A1K A;  2VE7 C;  4HTG A;  3OTO E;  2V86 A;  4R2D A;  4JI3 E;  2EOX A;  2JYA A;  5AE2 A;  4DMI A;  2DSY A;  2L2N A;  4R2A A;  1EKZ A;  4MLV A;  1X47 A;  4B3R E;  2V88 A;  2EN6 A;  2PRT A;  5LL6 R;  2EOO A;  4X65 E;  3IWD A;  2LVH A;  2EM8 A;  4GZN C;  2E5L E;  2DLQ A;  2ENC A;  1PKP A;  1IMU A;  1FKA E;  1YYK A;  2LJH A;  2EE8 A;  2CPN A;  2EL4 A;  4BHB A;  1EH6 A;  2EOR A;  2MKN A;  2YTI A;  4Q35 B;  2EPO A;  3J80 C;  2WZO A;  4BBY A;  2EN2 A;  3JTZ A;  4DR5 E;  2EOY A;  2M1S A;  5LLQ A;  2EZ6 A;  2EPA A;  4O5G A;  5A6B A;  2EMB A;  3JAM C;  2DMY A;  4F9A B;  4J8Z A;  1MEY C;  1YPN A;  5AE3 A;  2EOJ A;  3JU0 A;  1YFH A;  2EJ4 A;  1HNW E;  4K0K E;  1I94 E;  4KHP E;  2UXC E;  1IQO A;  2EMK A;  1TF3 A;  2WBT A;  4YHH E;  3KZY A;  1DGC A;  2RSM A;  2V8Q B;  3HPS A;  4F2J C;  2EOI A;  4X62 E;  2B7T A;  2LJU A;  4DR6 E;  1YZ9 A;  1DI2 A;  2EMF A;  2I9I A;  2E1M A;  4HEI A;  1BB8 A;  2L3C A;  3T1Y E;  1ZR9 A;  2HHH E;  2EOM A;  2YRH A;  1GQE A;  2EMG A;  2HC5 A;  4BHC A;  4GKK E;  4DV2 E;  1NCS A;  4JI2 E;  2V87 A;  2L2K B;  1WXR A;  2YT4 A;  3K6Q A;  5IV8 B;  2EMY A;  3P1X A;  5KL5 A;  2L8T A;  2LRS A;  4JYA E;  4M0V A;  1NEI A;  3TQM A;  2CTD A;  3ECR A;  1KYQ A;  2EMI A;  4NXN E;  4F9B B;  1UN6 B;  2GHF A;  3IWB A;  4O43 A;  4WXD A;  4DV7 E;  4JI0 E;  2B3T B;  2NAB A;  2EN3 A;  2DLK A;  1PJQ A;  2YSO A;  2EML A;  3ADJ A;  2JWO A;  2LV2 A;  3FIG A;  5KL6 A;  4F54 A; 
#chains in the Genus database with same CATH homology
 2LCE A;  1X6E A;  1G2D C;  2JP9 A;  1A1K A;  2EPZ A;  4R2E A;  2EPX A;  1JK1 A;  4R2D A;  2YTP A;  2EOX A;  2DMI A;  2EOE A;  2WBU A;  2EMA A;  1A1G A;  2GLI A;  2MKD A;  1TN9 A;  1YSA C;  2WCC 3;  4R2A A;  2LT7 A;  4R2S A;  2EQ3 A;  2EN6 A;  2PRT A;  2VRD A;  2EOQ A;  1F2I G;  1UBD C;  5KL3 A;  2EMZ A;  2M9A A;  1TF6 A;  2EOO A;  2LVH A;  3VHT B;  2EM8 A;  4GZN C;  2EPR A;  2DLQ A;  2CT1 A;  2ENC A;  3EPK A;  1Z1B A;  2EE8 A;  2JPA A;  1X5W A;  2EL4 A;  3MHH C;  2EOR A;  1B69 A;  2EMC A;  2MKN A;  2EM5 A;  2EL6 A;  2YTI A;  2EM0 A;  2YTQ A;  2YTD A;  1AAY A;  2ADR A;  5KL7 A;  2EN2 A;  2EOY A;  1JK2 A;  2BB8 A;  2I13 A;  2EPA A;  2EMB A;  2EPC A;  5KL4 A;  4IJD A;  4WSG A;  3EPL A;  1MEY C;  4R2R A;  4F6N A;  3M99 B;  2YTO A;  2EOJ A;  2EJ4 A;  4R2C A;  2EMW A;  2EMK A;  1A1I A;  1TF3 A;  2EL5 A;  2WBT A;  2YRK A;  1DGC A;  2ELZ A;  4F2J C;  2EOI A;  1LLM C;  1ZAA C;  4IS1 C;  1G2F C;  2R1F A;  1X6F A;  2EPU A;  2EMF A;  5KL2 A;  1BB8 A;  2YRM A;  4R2P A;  2YTE A;  1ZR9 A;  2EQ0 A;  2YU8 A;  2EOM A;  2EN7 A;  2YRH A;  4R2Q A;  1KJK A;  2YTN A;  4X9J A;  2ENA A;  2EMG A;  2LO3 A;  2YU5 A;  1WJP A;  2EN1 A;  1YUI A;  2EPP A;  1NCS A;  2DRP A;  2ENH A;  2WBS A;  2EM3 A;  2EM7 A;  1A1J A;  2EMH A;  2YTG A;  2J7J A;  1A1L A;  1RMD A;  3EPJ A;  2EOS A;  1A1H A;  2EMY A;  2RSI A;  1X3C A;  5KL5 A;  2E72 A;  2YTJ A;  2CTD A;  2CSH A;  1ZU1 A;  3UK3 C;  4F6M A;  2EM4 A;  2EMI A;  2EN4 A;  3EPH A;  1P47 A;  1UN6 B;  2GHF A;  1YUJ A;  2EMX A;  2HGH A;  2NAB A;  2EOH A;  2EP3 A;  2A25 A;  2YTF A;  1BBO A;  1A1F A;  2D9H A;  2EN3 A;  2DLK A;  2EN8 A;  2DGC A;  4FK5 C;  2YSO A;  2EML A;  2RPC A;  2YSP A;  3MHS C;  1X6H A;  4M9V C;  2EM9 A;  2EM6 A;  2EOZ A;  2EM2 A;  2MDG A;  2LV2 A;  2ELY A;  2EOF A;  5KL6 A;  2EQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...