2EOYA

Solution structure of the c2h2 type zinc finger (region 557-589) of human zinc finger protein 473
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGQKEKCFKCNKCEKTFSCSKYLTQHERIHTRGVKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 473
publication title Solution structure of the C2H2 type zinc finger (region 557-589) of human Zinc finger protein 473
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eoyA01
2EOMA 1MEYC 2EQ1A 2YTQA 4R2RA 1UBDC 3M99B 2DLKA 2YTGA 2EOOA 2YSPA 1DGCA 2JPAA 2NABA 2YTFA 2YTOA 2LCEA 1KJKA 2WBUA 1X6HA 2R1FA 2PRTA 1YSAC 2EPPA 1BBOA 2WBSA 2EMCA 3VHTB 2EMBA 2EMYA 2EPAA 2MKDA 1P47A 1BB8A 2EMAA 2JP9A 2EM5A 2EJ4A 4F6MA 2YRHA 3EPLA 1TN9A 1TF3A 1YUIA 1NCSA 2J7JA 2MKNA 1RMDA 2ENAA 2EMLA 2EMZA 2WBTA 4FK5C 4IS1C 2YTJA 1X6FA 2VRDA 4GZNC 1Z1BA 2GLIA 2EOEA 1UN6B 2YTNA 2EPUA 2WCC3 5KL7A 2CSHA 2EE8A 4R2SA 2EN6A 2EMIA 4F6NA 4R2QA 2A25A 3EPKA 1ZR9A 2D9HA 2YU8A 4R2DA 2ELYA 2EN7A 2EM7A 4IJDA 2ENHA 2EMXA 1A1HA 2YRMA 2CT1A 1A1LA 3MHSC 2EMWA 2MDGA 2EMKA 2EOYA 3UK3C 2EPCA 1JK1A 5KL6A 1AAYA 4WSGA 2EMFA 2EM2A 2EN3A 2EM9A 1A1KA 2EM4A 2DGCA 2YTDA 1YUJA 2ENCA 2EOSA 2YTIA 1WJPA 2EN2A 2EPRA 1ZU1A 1X5WA 2DMIA 2EL4A 2EOJA 2EOIA 4F2JC 1LLMC 4X9JA 1A1FA 2I13A 2E72A 2DLQA 2EN1A 2EORA 2DRPA 1X3CA 2EOHA 2YU5A 5KL2A 1A1JA 1TF6A 2YSOA 2EQ0A 5KL5A 2RSIA 1B69A 2EM8A 2EM3A 2EN4A 2LV2A 2LVHA 1A1GA 4R2EA 2M9AA 2YTEA 2EMGA 2YTPA 1X6EA 2EM6A 2ELZA 2EP3A 1F2IG 2EMHA 1A1IA 2ADRA 2EL5A 2EM0A 4R2AA 2YRKA 4R2PA 2EOZA 2EQ3A 2EOFA 2EOQA 2EL6A 2EN8A 1G2FC 2HGHA 2LT7A 4M9VC 2RPCA 1ZAAC 3EPHA 1JK2A 2GHFA 2CTDA 1G2DC 2EPZA 2EPXA 2BB8A 2EOXA 3MHHC 5KL4A 4R2CA 5KL3A 2LO3A 3EPJA
chains in the Genus database with same CATH superfamily
3ADGA 2DLKA 2NABA 2YTFA 3MSWA 2V89A 3KWRA 4DV2E 4BBYA 2R1FA 1YSAC 4JI4E 1IQSA 2EMBA 1P47A 2Q8UA 2UUBE 5LMNE 3IWCA 2EM5A 5LLQA 2VQEE 3C6KA 1XNQE 2RS7A 2YRHA 2YPNA 1TF3A 2J7JA 4DV4E 4Q35B 2L33A 2LTRA 2EMLA 4GEQB 1Z1BA 4DV6E 2LBSB 2CSHA 3HPZA 2F4VE 2EWLA 2EMIA 4KZSA 4R2QA 3T1HE 4YY3E 3C4BA 3EPKA 2EN7A 5ADZA 2YRMA 2CT1A 2EPLX 1UILA 1DQ3A 3UK3C 2EPCA 2JXPA 4F9BB 2YTDA 2L3JA 4R8OA 3OTOE 2ENCA 1WJPA 2EN2A 4LFAE 2EOIA 2EOJA 2L3CA 1N33E 1ZBTA 2V87A 2EN1A 1GTKA 4I8OA 1YZ9A 2LE2A 2FTXB 3IWDA 1SFEA 1A1JA 2EQ0A 4KWYA 1UHZA 2EM8A 2LV2A 2EN4A 1MGTA 5LL6R 4MLVA 4DV7E 2NA2A 2EMHA 4HEIA 1A1IA 4B3RE 3K6QA 2HJJA 2LTSA 4LU9A 4BC7A 2EZ6A 5BR8E 4R2AA 2K4VA 2YRKA 4NXNE 2IHR1 1GQEA 2EQ3A 4DKKA 1IBME 1L4SA 2KOUA 2ODRC 4LF4E 4R03A 3ZOQB 4JYAE 2RSMA 1G2DC 4ZYGA 2EPXA 1PKPA 2LMZA 3F6HA 3THOB 3MHHC 4R2CA 4NZVA 5KL3A 1EH8A 5A6BD 2EOMA 2EQ1A 4LF9E 2JOBA 3HXLA 4R2RA 1UBDC 4LFCE 2MC6A 2EOOA 2YSPA 2N3GA 1J5EE 2YTOA 4N4RB 2LCEA 2WBUA 1X6HA 3ADLA 4DV1E 3VK6A 2NUFA 2UXDE 1AH5A 2EMCA 3VHTB 1GZ6A 3HPSA 4DR2E 2EMAA 3VYXA 4F6MA 1HR0E 4LF7E 3EPLA 1TN9A 2ENAA 1RC7A 4TUIA 2L2KB 1KYQA 4WPYA 2B3TB 4FK5C 1T4NA 4IS1C 2H36X 1X6FA 2V83A 2YWQA 4L8NA 4GZNC 4B3ME 2EOEA 4X65E 4LTYA 4M0VA 5KL7A 2EE8A 5AASA 3ECRA 1T4OA 4O24A 1DI2A 3RMPA 3MHSC 5A2QC 2MDGA 4LF6E 3AV0A 2UXCE 1PJSA 4DV3E 2EM2A 2EN3A 2B9DA 2WZOA 1A1KA 1STUA 2EOSA 2FGGA 2YTIA 4DR6E 1T4LB 1ZU1A 2B7TA 2DMIA 5IXMB 3C4TA 2L2NA 1IBKE 4X9JA 1A1FA 2E72A 4O4KA 2EORA 1QNTA 4J8ZA 3VYYA 2YU5A 2JY9A 1YYKA 5KL2A 3JAMC 4P78A 1BBGA 1IBLE 1B69A 2LVHA 4Q28A 4JI6E 4TUGA 1YYWA 2M9AA 2EMGA 2L92A 4JI7E 2MDRA 4OOGC 2E5LE 3OMLA 4HTGA 2E1MA 1NEIA 2M7QA 1SR9A 2EPNA 4BHBA 4X8WA 2F8BA 5A6BA 3EPHA 2ZM6E 2CTDA 2JOXA 2EPZA 2DIXA 2LJHA 4NXME 2LUPB 4B3SE 3DJWA 3QG5C 2BBGA 5KL4A 4JI2E 2LO3A 3J7AG 2KONA 4LFBE 2YTGA 5AE2A 1DGCA 3THNA 2JPAA 1KJKA 4O43A 1PJQA 2UUAE 2EPPA 4AQYE 2WBSA 2EMYA 2EPKX 4K0KE 2MKDA 1YFHA 1BB8A 1I94E 4WSPA 3BGHA 5LMUE 5IT9C 1PJTA 5AE3A 2EJ4A 2JVAA 2JP9A 4OX9E 1XMOE 4DR3E 3FIGA 1IMUA 1NCSA 4DR5E 1FKAE 3AUZA 2L2MA 1X47A 4KHPE 1PDAA 2WBTA 3J7Yp 4F9AB 2YTJA 4JI5E 2UUCE 4DR4E 3ADJA 3BF2A 2R76A 1FJGE 2HHHE 1UN6B 2YTNA 2EPUA 1T39A 2NUEA 5A69A 2EN6A 5AC5A 2K7IA 4WYQB 2YU8A 2ELYA 4IJDA 1J26A 1A1HA 2I9IA 4X66E 2EMKA 4X64E 1JK1A 2RTXA 2EMFA 2LUQA 4M30A 4JI8E 3HQ1A 2I13A 2DLQA 3J81C 1X3CA 2EOHA 4BHCA 5A6JA 1YPNA 4WFTA 4DV5E 5KL5A 4WXDA 2MC5A 2EM3A 4R2EA 3P1XA 2YTEA 5DNYA 4ZYDA 2GPIA 2CPNA 2EM6A 2VQFE 2ELZA 4LF8E 2EP3A 2B7VA 4NHRA 4P7DA 1F2IG 3H09A 4LF5E 2ADRA 2EL5A 2V86A 4F54A 4R2PA 1X49A 2EOFA 4JV5E 2EL6A 1HNXE 2VE7C 5CFFE 2DSYA 2HGHA 4DR7E 4M9VC 2KHXA 3ADIA 3EQ1A 1ZAAC 5A6AA 2GHFA 4BS9A 2BB8A 2EOXA 2LJUA 3C6MA 1EH7A 4X62E 5F3WA 2L6MA 3T1YE 4JI0E 3EPJA 1MEYC 3HTXA 2YTQA 5T6JA 4WXCA 1WXRA 1IQOA 3F6GA 3JU0A 3M99B 2G7HA 1O0WA 4M2ZA 4ZYEA 2NUGA 2V8QB 1N34E 2PRTA 4BC9A 1HNZE 1BBOA 4B3TE 2EPAA 1N3GA 4YHHE 5AE1A 4DUYE 4JI1E 4JI3E 1YUIA 2RS6A 3KZYA 2MKNA 1RMDA 5FLXC 1XMQE 4DV0E 4O5GA 2EMZA 4L5NC 1RQ0A 2DB2A 4DR1E 2HC5A 2EPMX 1XNRE 2GLIA 2VRDA 4GKJE 2WCC3 1QU6A 2M1SA 4R2SA 2UXBE 4F6NA 2A25A 1ZR9A 2D9HA 4R2DA 2EM7A 2ENHA 2N3HA 2EMXA 5AC4A 4F9CB 1A1LA 2EMWA 2EOYA 5IWAE 2ODRD 5KL6A 1YYOA 3JTZA 3L00A 3BBGA 2EM9A 2FV4B 4WSGA 1AAYA 4DUZE 2EM4A 2DGCA 1YUJA 3BIDA 2YT4A 1EKZA 2EPRA 2EL4A 1X5WA 4BMJA 4RHBB 1LLMC 4DMIA 1EH6A 4RH8A 2DRPA 2EPOA 1ZBQA 3IWBA 3KZZA 3LLHA 5IV8B 1TF6A 2JYAA 2M4IA 2N8XA 2RSIA 2YSOA 4MLQA 3J80C 1WHQA 1A1GA 1T38A 2DMYA 2YTPA 1X6EA 2LRSA 2RQLA 5A6KA 2VF1A 1WRJA 2V85A 5TSEA 1HNWE 3DF6A 2L8TA 2EM0A 1WHNA 2EOZA 2EOQA 3LMLA 2EN8A 1G2FC 2JWOA 2LT7A 4GKKE 4WX9A 1X48A 2RPCA 1JK2A 2UU9E 4BCAA 1N32E 4ZYHA 2YZTA 2JR1A 1N36E 3TQMA 2V88A 4F2JC
chains in the Genus database with same CATH topology
2EOMA 1MEYC 2EQ1A 2YTQA 4R2RA 1UBDC 3M99B 2DLKA 2YTGA 2EOOA 2YSPA 1DGCA 2JPAA 2NABA 2YTFA 2YTOA 2LCEA 1KJKA 2WBUA 1X6HA 2R1FA 2PRTA 1YSAC 2EPPA 1BBOA 2WBSA 2EMCA 3VHTB 2EMBA 2EMYA 2EPAA 2MKDA 1P47A 1BB8A 2EMAA 2JP9A 2EM5A 2EJ4A 4F6MA 2YRHA 3EPLA 1TN9A 1TF3A 1YUIA 1NCSA 2J7JA 2MKNA 1RMDA 2ENAA 2EMLA 2EMZA 2WBTA 4FK5C 4IS1C 2YTJA 1X6FA 2VRDA 4GZNC 1Z1BA 2GLIA 2EOEA 1UN6B 2YTNA 2EPUA 2WCC3 5KL7A 2CSHA 2EE8A 4R2SA 2EN6A 2EMIA 4F6NA 4R2QA 2A25A 3EPKA 1ZR9A 2D9HA 2YU8A 4R2DA 2ELYA 2EN7A 2EM7A 4IJDA 2ENHA 2EMXA 1A1HA 2YRMA 2CT1A 1A1LA 3MHSC 2EMWA 2MDGA 2EMKA 2EOYA 3UK3C 2EPCA 1JK1A 5KL6A 1AAYA 4WSGA 2EMFA 2EM2A 2EN3A 2EM9A 1A1KA 2EM4A 2DGCA 2YTDA 1YUJA 2ENCA 2EOSA 2YTIA 1WJPA 2EN2A 2EPRA 1ZU1A 1X5WA 2DMIA 2EL4A 2EOJA 2EOIA 4F2JC 1LLMC 4X9JA 1A1FA 2I13A 2E72A 2DLQA 2EN1A 2EORA 2DRPA 1X3CA 2EOHA 2YU5A 5KL2A 1A1JA 1TF6A 2YSOA 2EQ0A 5KL5A 2RSIA 1B69A 2EM8A 2EM3A 2EN4A 2LV2A 2LVHA 1A1GA 4R2EA 2M9AA 2YTEA 2EMGA 2YTPA 1X6EA 2EM6A 2ELZA 2EP3A 1F2IG 2EMHA 1A1IA 2ADRA 2EL5A 2EM0A 4R2AA 2YRKA 4R2PA 2EOZA 2EQ3A 2EOFA 2EOQA 2EL6A 2EN8A 1G2FC 2HGHA 2LT7A 4M9VC 2RPCA 1ZAAC 3EPHA 1JK2A 2GHFA 2CTDA 1G2DC 2EPZA 2EPXA 2BB8A 2EOXA 3MHHC 5KL4A 4R2CA 5KL3A 2LO3A 3EPJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOM A;  1MEY C;  2EQ1 A;  2YTQ A;  4R2R A;  1UBD C;  3M99 B;  2DLK A;  2YTG A;  2EOO A;  2YSP A;  1DGC A;  2JPA A;  2NAB A;  2YTF A;  2YTO A;  2LCE A;  1KJK A;  2WBU A;  1X6H A;  2R1F A;  2PRT A;  1YSA C;  2EPP A;  1BBO A;  2WBS A;  2EMC A;  3VHT B;  2EMB A;  2EMY A;  2EPA A;  2MKD A;  1P47 A;  1BB8 A;  2EMA A;  2JP9 A;  2EM5 A;  2EJ4 A;  4F6M A;  2YRH A;  3EPL A;  1TN9 A;  1TF3 A;  1YUI A;  1NCS A;  2J7J A;  2MKN A;  1RMD A;  2ENA A;  2EML A;  2EMZ A;  2WBT A;  4FK5 C;  4IS1 C;  2YTJ A;  1X6F A;  2VRD A;  4GZN C;  1Z1B A;  2GLI A;  2EOE A;  1UN6 B;  2YTN A;  2EPU A;  2WCC 3;  5KL7 A;  2CSH A;  2EE8 A;  4R2S A;  2EN6 A;  2EMI A;  4F6N A;  4R2Q A;  2A25 A;  3EPK A;  1ZR9 A;  2D9H A;  2YU8 A;  4R2D A;  2ELY A;  2EN7 A;  2EM7 A;  4IJD A;  2ENH A;  2EMX A;  1A1H A;  2YRM A;  2CT1 A;  1A1L A;  3MHS C;  2EMW A;  2MDG A;  2EMK A;  2EOY A;  3UK3 C;  2EPC A;  1JK1 A;  5KL6 A;  1AAY A;  4WSG A;  2EMF A;  2EM2 A;  2EN3 A;  2EM9 A;  1A1K A;  2EM4 A;  2DGC A;  2YTD A;  1YUJ A;  2ENC A;  2EOS A;  2YTI A;  1WJP A;  2EN2 A;  2EPR A;  1ZU1 A;  1X5W A;  2DMI A;  2EL4 A;  2EOJ A;  2EOI A;  4F2J C;  1LLM C;  4X9J A;  1A1F A;  2I13 A;  2E72 A;  2DLQ A;  2EN1 A;  2EOR A;  2DRP A;  1X3C A;  2EOH A;  2YU5 A;  5KL2 A;  1A1J A;  1TF6 A;  2YSO A;  2EQ0 A;  5KL5 A;  2RSI A;  1B69 A;  2EM8 A;  2EM3 A;  2EN4 A;  2LV2 A;  2LVH A;  1A1G A;  4R2E A;  2M9A A;  2YTE A;  2EMG A;  2YTP A;  1X6E A;  2EM6 A;  2ELZ A;  2EP3 A;  1F2I G;  2EMH A;  1A1I A;  2ADR A;  2EL5 A;  2EM0 A;  4R2A A;  2YRK A;  4R2P A;  2EOZ A;  2EQ3 A;  2EOF A;  2EOQ A;  2EL6 A;  2EN8 A;  1G2F C;  2HGH A;  2LT7 A;  4M9V C;  2RPC A;  1ZAA C;  3EPH A;  1JK2 A;  2GHF A;  2CTD A;  1G2D C;  2EPZ A;  2EPX A;  2BB8 A;  2EOX A;  3MHH C;  5KL4 A;  4R2C A;  5KL3 A;  2LO3 A;  3EPJ A; 
#chains in the Genus database with same CATH topology
 3ADG A;  2DLK A;  2NAB A;  2YTF A;  3MSW A;  2V89 A;  3KWR A;  4DV2 E;  4BBY A;  2R1F A;  1YSA C;  4JI4 E;  1IQS A;  2EMB A;  1P47 A;  2Q8U A;  2UUB E;  5LMN E;  3IWC A;  2EM5 A;  5LLQ A;  2VQE E;  3C6K A;  1XNQ E;  2RS7 A;  2YRH A;  2YPN A;  1TF3 A;  2J7J A;  4DV4 E;  4Q35 B;  2L33 A;  2LTR A;  2EML A;  4GEQ B;  1Z1B A;  4DV6 E;  2LBS B;  2CSH A;  3HPZ A;  2F4V E;  2EWL A;  2EMI A;  4KZS A;  4R2Q A;  3T1H E;  4YY3 E;  3C4B A;  3EPK A;  2EN7 A;  5ADZ A;  2YRM A;  2CT1 A;  2EPL X;  1UIL A;  1DQ3 A;  3UK3 C;  2EPC A;  2JXP A;  4F9B B;  2YTD A;  2L3J A;  4R8O A;  3OTO E;  2ENC A;  1WJP A;  2EN2 A;  4LFA E;  2EOI A;  2EOJ A;  2L3C A;  1N33 E;  1ZBT A;  2V87 A;  2EN1 A;  1GTK A;  4I8O A;  1YZ9 A;  2LE2 A;  2FTX B;  3IWD A;  1SFE A;  1A1J A;  2EQ0 A;  4KWY A;  1UHZ A;  2EM8 A;  2LV2 A;  2EN4 A;  1MGT A;  5LL6 R;  4MLV A;  4DV7 E;  2NA2 A;  2EMH A;  4HEI A;  1A1I A;  4B3R E;  3K6Q A;  2HJJ A;  2LTS A;  4LU9 A;  4BC7 A;  2EZ6 A;  5BR8 E;  4R2A A;  2K4V A;  2YRK A;  4NXN E;  2IHR 1;  1GQE A;  2EQ3 A;  4DKK A;  1IBM E;  1L4S A;  2KOU A;  2ODR C;  4LF4 E;  4R03 A;  3ZOQ B;  4JYA E;  2RSM A;  1G2D C;  4ZYG A;  2EPX A;  1PKP A;  2LMZ A;  3F6H A;  3THO B;  3MHH C;  4R2C A;  4NZV A;  5KL3 A;  1EH8 A;  5A6B D;  2EOM A;  2EQ1 A;  4LF9 E;  2JOB A;  3HXL A;  4R2R A;  1UBD C;  4LFC E;  2MC6 A;  2EOO A;  2YSP A;  2N3G A;  1J5E E;  2YTO A;  4N4R B;  2LCE A;  2WBU A;  1X6H A;  3ADL A;  4DV1 E;  3VK6 A;  2NUF A;  2UXD E;  1AH5 A;  2EMC A;  3VHT B;  1GZ6 A;  3HPS A;  4DR2 E;  2EMA A;  3VYX A;  4F6M A;  1HR0 E;  4LF7 E;  3EPL A;  1TN9 A;  2ENA A;  1RC7 A;  4TUI A;  2L2K B;  1KYQ A;  4WPY A;  2B3T B;  4FK5 C;  1T4N A;  4IS1 C;  2H36 X;  1X6F A;  2V83 A;  2YWQ A;  4L8N A;  4GZN C;  4B3M E;  2EOE A;  4X65 E;  4LTY A;  4M0V A;  5KL7 A;  2EE8 A;  5AAS A;  3ECR A;  1T4O A;  4O24 A;  1DI2 A;  3RMP A;  3MHS C;  5A2Q C;  2MDG A;  4LF6 E;  3AV0 A;  2UXC E;  1PJS A;  4DV3 E;  2EM2 A;  2EN3 A;  2B9D A;  2WZO A;  1A1K A;  1STU A;  2EOS A;  2FGG A;  2YTI A;  4DR6 E;  1T4L B;  1ZU1 A;  2B7T A;  2DMI A;  5IXM B;  3C4T A;  2L2N A;  1IBK E;  4X9J A;  1A1F A;  2E72 A;  4O4K A;  2EOR A;  1QNT A;  4J8Z A;  3VYY A;  2YU5 A;  2JY9 A;  1YYK A;  5KL2 A;  3JAM C;  4P78 A;  1BBG A;  1IBL E;  1B69 A;  2LVH A;  4Q28 A;  4JI6 E;  4TUG A;  1YYW A;  2M9A A;  2EMG A;  2L92 A;  4JI7 E;  2MDR A;  4OOG C;  2E5L E;  3OML A;  4HTG A;  2E1M A;  1NEI A;  2M7Q A;  1SR9 A;  2EPN A;  4BHB A;  4X8W A;  2F8B A;  5A6B A;  3EPH A;  2ZM6 E;  2CTD A;  2JOX A;  2EPZ A;  2DIX A;  2LJH A;  4NXM E;  2LUP B;  4B3S E;  3DJW A;  3QG5 C;  2BBG A;  5KL4 A;  4JI2 E;  2LO3 A;  3J7A G;  2KON A;  4LFB E;  2YTG A;  5AE2 A;  1DGC A;  3THN A;  2JPA A;  1KJK A;  4O43 A;  1PJQ A;  2UUA E;  2EPP A;  4AQY E;  2WBS A;  2EMY A;  2EPK X;  4K0K E;  2MKD A;  1YFH A;  1BB8 A;  1I94 E;  4WSP A;  3BGH A;  5LMU E;  5IT9 C;  1PJT A;  5AE3 A;  2EJ4 A;  2JVA A;  2JP9 A;  4OX9 E;  1XMO E;  4DR3 E;  3FIG A;  1IMU A;  1NCS A;  4DR5 E;  1FKA E;  3AUZ A;  2L2M A;  1X47 A;  4KHP E;  1PDA A;  2WBT A;  3J7Y p;  4F9A B;  2YTJ A;  4JI5 E;  2UUC E;  4DR4 E;  3ADJ A;  3BF2 A;  2R76 A;  1FJG E;  2HHH E;  1UN6 B;  2YTN A;  2EPU A;  1T39 A;  2NUE A;  5A69 A;  2EN6 A;  5AC5 A;  2K7I A;  4WYQ B;  2YU8 A;  2ELY A;  4IJD A;  1J26 A;  1A1H A;  2I9I A;  4X66 E;  2EMK A;  4X64 E;  1JK1 A;  2RTX A;  2EMF A;  2LUQ A;  4M30 A;  4JI8 E;  3HQ1 A;  2I13 A;  2DLQ A;  3J81 C;  1X3C A;  2EOH A;  4BHC A;  5A6J A;  1YPN A;  4WFT A;  4DV5 E;  5KL5 A;  4WXD A;  2MC5 A;  2EM3 A;  4R2E A;  3P1X A;  2YTE A;  5DNY A;  4ZYD A;  2GPI A;  2CPN A;  2EM6 A;  2VQF E;  2ELZ A;  4LF8 E;  2EP3 A;  2B7V A;  4NHR A;  4P7D A;  1F2I G;  3H09 A;  4LF5 E;  2ADR A;  2EL5 A;  2V86 A;  4F54 A;  4R2P A;  1X49 A;  2EOF A;  4JV5 E;  2EL6 A;  1HNX E;  2VE7 C;  5CFF E;  2DSY A;  2HGH A;  4DR7 E;  4M9V C;  2KHX A;  3ADI A;  3EQ1 A;  1ZAA C;  5A6A A;  2GHF A;  4BS9 A;  2BB8 A;  2EOX A;  2LJU A;  3C6M A;  1EH7 A;  4X62 E;  5F3W A;  2L6M A;  3T1Y E;  4JI0 E;  3EPJ A;  1MEY C;  3HTX A;  2YTQ A;  5T6J A;  4WXC A;  1WXR A;  1IQO A;  3F6G A;  3JU0 A;  3M99 B;  2G7H A;  1O0W A;  4M2Z A;  4ZYE A;  2NUG A;  2V8Q B;  1N34 E;  2PRT A;  4BC9 A;  1HNZ E;  1BBO A;  4B3T E;  2EPA A;  1N3G A;  4YHH E;  5AE1 A;  4DUY E;  4JI1 E;  4JI3 E;  1YUI A;  2RS6 A;  3KZY A;  2MKN A;  1RMD A;  5FLX C;  1XMQ E;  4DV0 E;  4O5G A;  2EMZ A;  4L5N C;  1RQ0 A;  2DB2 A;  4DR1 E;  2HC5 A;  2EPM X;  1XNR E;  2GLI A;  2VRD A;  4GKJ E;  2WCC 3;  1QU6 A;  2M1S A;  4R2S A;  2UXB E;  4F6N A;  2A25 A;  1ZR9 A;  2D9H A;  4R2D A;  2EM7 A;  2ENH A;  2N3H A;  2EMX A;  5AC4 A;  4F9C B;  1A1L A;  2EMW A;  2EOY A;  5IWA E;  2ODR D;  5KL6 A;  1YYO A;  3JTZ A;  3L00 A;  3BBG A;  2EM9 A;  2FV4 B;  4WSG A;  1AAY A;  4DUZ E;  2EM4 A;  2DGC A;  1YUJ A;  3BID A;  2YT4 A;  1EKZ A;  2EPR A;  2EL4 A;  1X5W A;  4BMJ A;  4RHB B;  1LLM C;  4DMI A;  1EH6 A;  4RH8 A;  2DRP A;  2EPO A;  1ZBQ A;  3IWB A;  3KZZ A;  3LLH A;  5IV8 B;  1TF6 A;  2JYA A;  2M4I A;  2N8X A;  2RSI A;  2YSO A;  4MLQ A;  3J80 C;  1WHQ A;  1A1G A;  1T38 A;  2DMY A;  2YTP A;  1X6E A;  2LRS A;  2RQL A;  5A6K A;  2VF1 A;  1WRJ A;  2V85 A;  5TSE A;  1HNW E;  3DF6 A;  2L8T A;  2EM0 A;  1WHN A;  2EOZ A;  2EOQ A;  3LML A;  2EN8 A;  1G2F C;  2JWO A;  2LT7 A;  4GKK E;  4WX9 A;  1X48 A;  2RPC A;  1JK2 A;  2UU9 E;  4BCA A;  1N32 E;  4ZYH A;  2YZT A;  2JR1 A;  1N36 E;  3TQM A;  2V88 A;  4F2J C; 
#chains in the Genus database with same CATH homology
 2EOM A;  1MEY C;  2EQ1 A;  2YTQ A;  4R2R A;  1UBD C;  3M99 B;  2DLK A;  2YTG A;  2EOO A;  2YSP A;  1DGC A;  2JPA A;  2NAB A;  2YTF A;  2YTO A;  2LCE A;  1KJK A;  2WBU A;  1X6H A;  2R1F A;  2PRT A;  1YSA C;  2EPP A;  1BBO A;  2WBS A;  2EMC A;  3VHT B;  2EMB A;  2EMY A;  2EPA A;  2MKD A;  1P47 A;  1BB8 A;  2EMA A;  2JP9 A;  2EM5 A;  2EJ4 A;  4F6M A;  2YRH A;  3EPL A;  1TN9 A;  1TF3 A;  1YUI A;  1NCS A;  2J7J A;  2MKN A;  1RMD A;  2ENA A;  2EML A;  2EMZ A;  2WBT A;  4FK5 C;  4IS1 C;  2YTJ A;  1X6F A;  2VRD A;  4GZN C;  1Z1B A;  2GLI A;  2EOE A;  1UN6 B;  2YTN A;  2EPU A;  2WCC 3;  5KL7 A;  2CSH A;  2EE8 A;  4R2S A;  2EN6 A;  2EMI A;  4F6N A;  4R2Q A;  2A25 A;  3EPK A;  1ZR9 A;  2D9H A;  2YU8 A;  4R2D A;  2ELY A;  2EN7 A;  2EM7 A;  4IJD A;  2ENH A;  2EMX A;  1A1H A;  2YRM A;  2CT1 A;  1A1L A;  3MHS C;  2EMW A;  2MDG A;  2EMK A;  2EOY A;  3UK3 C;  2EPC A;  1JK1 A;  5KL6 A;  1AAY A;  4WSG A;  2EMF A;  2EM2 A;  2EN3 A;  2EM9 A;  1A1K A;  2EM4 A;  2DGC A;  2YTD A;  1YUJ A;  2ENC A;  2EOS A;  2YTI A;  1WJP A;  2EN2 A;  2EPR A;  1ZU1 A;  1X5W A;  2DMI A;  2EL4 A;  2EOJ A;  2EOI A;  4F2J C;  1LLM C;  4X9J A;  1A1F A;  2I13 A;  2E72 A;  2DLQ A;  2EN1 A;  2EOR A;  2DRP A;  1X3C A;  2EOH A;  2YU5 A;  5KL2 A;  1A1J A;  1TF6 A;  2YSO A;  2EQ0 A;  5KL5 A;  2RSI A;  1B69 A;  2EM8 A;  2EM3 A;  2EN4 A;  2LV2 A;  2LVH A;  1A1G A;  4R2E A;  2M9A A;  2YTE A;  2EMG A;  2YTP A;  1X6E A;  2EM6 A;  2ELZ A;  2EP3 A;  1F2I G;  2EMH A;  1A1I A;  2ADR A;  2EL5 A;  2EM0 A;  4R2A A;  2YRK A;  4R2P A;  2EOZ A;  2EQ3 A;  2EOF A;  2EOQ A;  2EL6 A;  2EN8 A;  1G2F C;  2HGH A;  2LT7 A;  4M9V C;  2RPC A;  1ZAA C;  3EPH A;  1JK2 A;  2GHF A;  2CTD A;  1G2D C;  2EPZ A;  2EPX A;  2BB8 A;  2EOX A;  3MHH C;  5KL4 A;  4R2C A;  5KL3 A;  2LO3 A;  3EPJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...