2EOYA

Solution structure of the c2h2 type zinc finger (region 557-589) of human zinc finger protein 473
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGQKEKCFKCNKCEKTFSCSKYLTQHERIHTRGVKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 557-589) of human Zinc finger protein 473
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 473
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eoyA01
2E72A 2EN7A 2EN1A 2WBUA 1YUJA 1YSAC 2MDGA 2CTDA 2EMWA 1A1JA 2LO3A 2EM5A 2YTDA 5KL7A 2EN3A 2YU8A 1MEYC 2EM3A 2EOIA 2EPPA 2I13A 1G2FC 1X5WA 2HGHA 2YTPA 3EPKA 2YRHA 4IJDA 1Z1BA 2YRKA 2EN6A 2DGCA 2EL6A 1TF6A 2YTOA 1ZU1A 1JK1A 1A1LA 2WBSA 4IS1C 4GZNC 2EMCA 2MKDA 2JP9A 3MHSC 2EMZA 1A1HA 2EM6A 2EM7A 2EN8A 2EM9A 2DRPA 4F6NA 1B69A 2EOXA 1DGCA 2NABA 1X6EA 2ADRA 2EM8A 3VHTB 1KJKA 1A1FA 2GLIA 2EPRA 2LV2A 2EOOA 2EPCA 2EM2A 2YSOA 2EPAA 2EPUA 5KL3A 1ZAAC 2EOFA 2EPZA 2EL5A 2EMFA 2M9AA 2EQ3A 2YTGA 1P47A 2EE8A 2EMXA 3M99B 4R2SA 4X9JA 1YUIA 2EN4A 5KL2A 2LVHA 2ENCA 2EOMA 2CSHA 3UK3C 2YTNA 1BBOA 1F2IG 1AAYA 1G2DC 2WCC3 1ZR9A 1RMDA 2ELYA 1X3CA 2PRTA 2EMAA 2VRDA 4FK5C 5KL5A 4R2EA 1JK2A 5KL4A 1TN9A 2YTIA 2MKNA 2EMYA 2YTQA 2ELZA 1WJPA 2BB8A 2EPXA 4R2AA 2A25A 2YTJA 1A1KA 1BB8A 2D9HA 2YTEA 3EPJA 2WBTA 3EPHA 2EMHA 2LT7A 1TF3A 2EQ0A 2YU5A 2EQ1A 2YTFA 2EOQA 3EPLA 2DLQA 2EM0A 4WSGA 1NCSA 2EN2A 2ENHA 2EMIA 4R2DA 4R2RA 2GHFA 2EOEA 4R2CA 2EOHA 2DLKA 2YSPA 2EMGA 2EOSA 2J7JA 2EM4A 2RSIA 2JPAA 4R2PA 2LCEA 1X6FA 1LLMC 1A1IA 2EOZA 2YRMA 2EORA 1UBDC 2EOYA 1X6HA 2EMBA 2EMKA 2ENAA 2EOJA 2EP3A 3MHHC 1UN6B 2RPCA 2EL4A 1A1GA 2R1FA 2EMLA 4F6MA 4M9VC 2DMIA 2CT1A 4F2JC 2EJ4A 5KL6A 4R2QA
chains in the Genus database with same CATH superfamily
3HPZA 2WBUA 1YUJA 1J5EE 4JI6E 2EMWA 2LO3A 2EM5A 1YPNA 4X65E 4LFCE 2UU9E 4DV1E 2IHR1 2K4VA 1DQ3A 2JVAA 1PJSA 1PJQA 1G2FC 4DV6E 4NXME 1FKAE 2YTPA 4P7DA 4BHBA 3EPKA 2YRHA 2NUGA 3ZOQB 2B9DA 2EPMX 4BHCA 2EN6A 2JOBA 1N3GA 1WXRA 2F4VE 4ZYDA 5F3WA 4IS1C 2UUCE 5A6AA 3ADJA 1A1HA 2DRPA 2EPNA 4F6NA 1HNXE 1DGCA 4M2ZA 2VF1A 2EM8A 3VHTB 2RS7A 1A1FA 2EPRA 1YYKA 2EPCA 3K6QA 4X62E 1EKZA 2EPAA 4O43A 4KHPE 5AE2A 1ZBQA 5A6KA 4GKJE 2MC5A 4DUZE 1YUIA 3F6GA 5KL2A 3HQ1A 2RTXA 3L00A 1WHNA 4BC9A 5FLXC 2EWLA 2PRTA 2VRDA 4FK5C 4R2EA 2B3TB 3MSWA 2M1SA 2YTQA 2VQFE 2RQLA 3F6HA 4BMJA 1IMUA 4WYQB 2EMHA 2LT7A 1N32E 1XMQE 2NUEA 4O4KA 2EQ1A 2BBGA 3LMLA 3HTXA 2EOQA 2HC5A 3EPLA 2DLQA 1BBGA 2FTXB 1XNRE 3P1XA 2RSIA 2J7JA 1SFEA 2JPAA 2HJJA 2LCEA 3DF6A 4GKKE 1LLMC 4JI5E 2EORA 1UBDC 2EOYA 1X6HA 1UILA 4WFTA 2ENAA 3AV0A 4JI8E 3OMLA 2B7VA 4M0VA 3RMPA 4LF8E 1YZ9A 4F6MA 4F9BB 3H09A 4M9VC 1EH6A 1IQSA 5A6BD 4B3ME 4F2JC 1XMOE 1PKPA 2E72A 5LL6R 2EN1A 2LRSA 2E5LE 1YSAC 2CTDA 2V88A 2UUBE 4DR6E 5AE3A 5KL7A 2EN3A 2YU8A 1N36E 1PDAA 1UHZA 4TUIA 2I13A 1YFHA 2JWOA 1GQEA 2YWQA 1STUA 4R8OA 2EPLX 4DUYE 2LJHA 4B3TE 1X5WA 2HGHA 2JYAA 4O24A 4X66E 1FJGE 3ADLA 3JTZA 4JI1E 1Z1BA 2FV4B 4X64E 2ODRD 1IBKE 2YTOA 4K0KE 4ZYEA 5AE1A 1A1LA 1J26A 4GZNC 1X48A 4DR3E 2EMZA 2EN8A 4O5GA 4HTGA 2B7TA 2EOXA 2KONA 1X6EA 3THOB 4YHHE 4WSPA 2EM2A 4DV3E 2R76A 2YSOA 4RHBB 2G7HA 5KL3A 2EOFA 5AC4A 2EPZA 2EL5A 1P47A 1X49A 2EMXA 4R2SA 1XNQE 4X9JA 5LLQA 2L6MA 3TQMA 1N33E 2ENCA 3UK3C 2CSHA 4LTYA 1L4SA 2F8BA 3C6MA 1G2DC 1ZR9A 2RS6A 1RMDA 4NZVA 2YPNA 2EMAA 3FIGA 4YY3E 2DSYA 2ELZA 2BB8A 4GEQB 1A1KA 2WZOA 4LU9A 3EPJA 3J7Yp 4I8OA 3KWRA 4P78A 2M7QA 5AC5A 3IWBA 3BBGA 3DJWA 4DR2E 4AQYE 2L2MA 2EM0A 4WSGA 2LBSB 2UXBE 2L2KB 2L3JA 2EMIA 4WXCA 1MGTA 1X47A 2EOEA 5A6BA 2EMGA 2JR1A 3HXLA 4R2PA 4L8NA 2LUQA 1N34E 2YZTA 2EMBA 3IWCA 1WRJA 5T6JA 2EP3A 3MHHC 1UN6B 4LF5E 2R1FA 2LE2A 2EMLA 2L92A 3LLHA 2V85A 2YT4A 2JXPA 2KHXA 4BC7A 4DR5E 4JI4E 2V87A 1A1JA 1T4LB 2YTDA 1PJTA 4J8ZA 4RH8A 5ADZA 4Q35B 2EM3A 4NHRA 3KZZA 3HPSA 4L5NC 2KOUA 4WXDA 4F9AB 2DB2A 2N3GA 3VK6A 2EPKX 4DV0E 3C6KA 2LTRA 1T38A 4ZYHA 2DIXA 1IBLE 2EMCA 2JP9A 2Q8UA 4N4RB 4Q28A 1EH8A 1KJKA 1HNWE 2EOOA 2DMYA 2N8XA 4MLVA 2EZ6A 1NEIA 1YYWA 2LUPB 2VQEE 2E1MA 2EMFA 2YTGA 3AUZA 2EE8A 3M99B 1I94E 4MLQA 3T1HE 2LTSA 4B3SE 2LVHA 2EOMA 4ZYGA 1RC7A 3C4BA 5BR8E 4KZSA 5A2QC 5KL4A 1TN9A 5IV8B 2YTIA 4DR1E 5CFFE 1AH5A 2A25A 2FGGA 2YTJA 1BB8A 4BS9A 2YTEA 3BGHA 1TF3A 4LF4E 2EQ0A 2YU5A 1T39A 2L2NA 2I9IA 3VYXA 1KYQA 1NCSA 3IWDA 2ENHA 3QG5C 2NUFA 4R2RA 1HR0E 2MDRA 2GHFA 2L33A 4R2CA 2EOSA 3J81C 2L8TA 1ZBTA 4R03A 1X6FA 4B3RE 2UXDE 2V86A 4WX9A 4BBYA 4LF7E 5AASA 4BCAA 5DNYA 2EL4A 1A1GA 2DMIA 2UXCE 5IT9C 1IBME 4DV2E 2EN7A 4DV7E 1GZ6A 2MDGA 2VE7C 2N3HA 3JU0A 1MEYC 2EPPA 2EOIA 2V89A 3ADGA 3OTOE 2MC6A 2K7IA 5LMNE 4KWYA 4DMIA 1IQOA 2H36X 2EPOA 4IJDA 1O0WA 2YRKA 1DI2A 4M30A 2DGCA 2EL6A 1TF6A 1YYOA 1GTKA 1ZU1A 1JK1A 2WBSA 4DV4E 5IWAE 2MKDA 3MHSC 3C4TA 2EM6A 2EM7A 2EM9A 4TUGA 1B69A 2ODRC 2NABA 2ADRA 4WPYA 2GLIA 2NA2A 2LV2A 5A69A 4JV5E 4JI3E 2V8QB 2EPUA 1ZAAC 4NXNE 2GPIA 3ECRA 4X8WA 4JI2E 2M9AA 2EQ3A 4DR7E 2LMZA 4DR4E 2EN4A 3KZYA 2CPNA 3BF2A 2JOXA 2YTNA 1BBOA 1F2IG 1AAYA 2WCC3 4LF6E 3EQ1A 2ELYA 1X3CA 5KL5A 1JK2A 1RQ0A 3BIDA 1QU6A 4F54A 5IXMB 2MKNA 2EMYA 1T4NA 2EPXA 1WJPA 3VYYA 4R2AA 2HHHE 4OX9E 1HNZE 2D9HA 2WBTA 4F9CB 3EPHA 4LFBE 5LMUE 1EH7A 1QNTA 4DKKA 4JYAE 2JY9A 3THNA 2YTFA 2ZM6E 2V83A 3ADIA 2EN2A 1SR9A 4DV5E 4JI0E 4R2DA 2L3CA 2EOHA 2DLKA 2YSPA 4LFAE 2EM4A 1T4OA 3J7AG 1A1IA 2EOZA 2YRMA 3JAMC 2LJUA 2EMKA 2EOJA 1WHQA 3J80C 4HEIA 2UUAE 4LF9E 4JI7E 2RPCA 3T1YE 4R2QA 2CT1A 2RSMA 5TSEA 2M4IA 2EJ4A 5A6JA 5KL6A 4OOGC
chains in the Genus database with same CATH topology
2E72A 2EN7A 2EN1A 2WBUA 1YUJA 1YSAC 2MDGA 2CTDA 2EMWA 1A1JA 2LO3A 2EM5A 2YTDA 5KL7A 2EN3A 2YU8A 1MEYC 2EM3A 2EOIA 2EPPA 2I13A 1G2FC 1X5WA 2HGHA 2YTPA 3EPKA 2YRHA 4IJDA 1Z1BA 2YRKA 2EN6A 2DGCA 2EL6A 1TF6A 2YTOA 1ZU1A 1JK1A 1A1LA 2WBSA 4IS1C 4GZNC 2EMCA 2MKDA 2JP9A 3MHSC 2EMZA 1A1HA 2EM6A 2EM7A 2EN8A 2EM9A 2DRPA 4F6NA 1B69A 2EOXA 1DGCA 2NABA 1X6EA 2ADRA 2EM8A 3VHTB 1KJKA 1A1FA 2GLIA 2EPRA 2LV2A 2EOOA 2EPCA 2EM2A 2YSOA 2EPAA 2EPUA 5KL3A 1ZAAC 2EOFA 2EPZA 2EL5A 2EMFA 2M9AA 2EQ3A 2YTGA 1P47A 2EE8A 2EMXA 3M99B 4R2SA 4X9JA 1YUIA 2EN4A 5KL2A 2LVHA 2ENCA 2EOMA 2CSHA 3UK3C 2YTNA 1BBOA 1F2IG 1AAYA 1G2DC 2WCC3 1ZR9A 1RMDA 2ELYA 1X3CA 2PRTA 2EMAA 2VRDA 4FK5C 5KL5A 4R2EA 1JK2A 5KL4A 1TN9A 2YTIA 2MKNA 2EMYA 2YTQA 2ELZA 1WJPA 2BB8A 2EPXA 4R2AA 2A25A 2YTJA 1A1KA 1BB8A 2D9HA 2YTEA 3EPJA 2WBTA 3EPHA 2EMHA 2LT7A 1TF3A 2EQ0A 2YU5A 2EQ1A 2YTFA 2EOQA 3EPLA 2DLQA 2EM0A 4WSGA 1NCSA 2EN2A 2ENHA 2EMIA 4R2DA 4R2RA 2GHFA 2EOEA 4R2CA 2EOHA 2DLKA 2YSPA 2EMGA 2EOSA 2J7JA 2EM4A 2RSIA 2JPAA 4R2PA 2LCEA 1X6FA 1LLMC 1A1IA 2EOZA 2YRMA 2EORA 1UBDC 2EOYA 1X6HA 2EMBA 2EMKA 2ENAA 2EOJA 2EP3A 3MHHC 1UN6B 2RPCA 2EL4A 1A1GA 2R1FA 2EMLA 4F6MA 4M9VC 2DMIA 2CT1A 4F2JC 2EJ4A 5KL6A 4R2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E72 A;  2EN7 A;  2EN1 A;  2WBU A;  1YUJ A;  1YSA C;  2MDG A;  2CTD A;  2EMW A;  1A1J A;  2LO3 A;  2EM5 A;  2YTD A;  5KL7 A;  2EN3 A;  2YU8 A;  1MEY C;  2EM3 A;  2EOI A;  2EPP A;  2I13 A;  1G2F C;  1X5W A;  2HGH A;  2YTP A;  3EPK A;  2YRH A;  4IJD A;  1Z1B A;  2YRK A;  2EN6 A;  2DGC A;  2EL6 A;  1TF6 A;  2YTO A;  1ZU1 A;  1JK1 A;  1A1L A;  2WBS A;  4IS1 C;  4GZN C;  2EMC A;  2MKD A;  2JP9 A;  3MHS C;  2EMZ A;  1A1H A;  2EM6 A;  2EM7 A;  2EN8 A;  2EM9 A;  2DRP A;  4F6N A;  1B69 A;  2EOX A;  1DGC A;  2NAB A;  1X6E A;  2ADR A;  2EM8 A;  3VHT B;  1KJK A;  1A1F A;  2GLI A;  2EPR A;  2LV2 A;  2EOO A;  2EPC A;  2EM2 A;  2YSO A;  2EPA A;  2EPU A;  5KL3 A;  1ZAA C;  2EOF A;  2EPZ A;  2EL5 A;  2EMF A;  2M9A A;  2EQ3 A;  2YTG A;  1P47 A;  2EE8 A;  2EMX A;  3M99 B;  4R2S A;  4X9J A;  1YUI A;  2EN4 A;  5KL2 A;  2LVH A;  2ENC A;  2EOM A;  2CSH A;  3UK3 C;  2YTN A;  1BBO A;  1F2I G;  1AAY A;  1G2D C;  2WCC 3;  1ZR9 A;  1RMD A;  2ELY A;  1X3C A;  2PRT A;  2EMA A;  2VRD A;  4FK5 C;  5KL5 A;  4R2E A;  1JK2 A;  5KL4 A;  1TN9 A;  2YTI A;  2MKN A;  2EMY A;  2YTQ A;  2ELZ A;  1WJP A;  2BB8 A;  2EPX A;  4R2A A;  2A25 A;  2YTJ A;  1A1K A;  1BB8 A;  2D9H A;  2YTE A;  3EPJ A;  2WBT A;  3EPH A;  2EMH A;  2LT7 A;  1TF3 A;  2EQ0 A;  2YU5 A;  2EQ1 A;  2YTF A;  2EOQ A;  3EPL A;  2DLQ A;  2EM0 A;  4WSG A;  1NCS A;  2EN2 A;  2ENH A;  2EMI A;  4R2D A;  4R2R A;  2GHF A;  2EOE A;  4R2C A;  2EOH A;  2DLK A;  2YSP A;  2EMG A;  2EOS A;  2J7J A;  2EM4 A;  2RSI A;  2JPA A;  4R2P A;  2LCE A;  1X6F A;  1LLM C;  1A1I A;  2EOZ A;  2YRM A;  2EOR A;  1UBD C;  2EOY A;  1X6H A;  2EMB A;  2EMK A;  2ENA A;  2EOJ A;  2EP3 A;  3MHH C;  1UN6 B;  2RPC A;  2EL4 A;  1A1G A;  2R1F A;  2EML A;  4F6M A;  4M9V C;  2DMI A;  2CT1 A;  4F2J C;  2EJ4 A;  5KL6 A;  4R2Q A; 
#chains in the Genus database with same CATH topology
 3HPZ A;  2WBU A;  1YUJ A;  1J5E E;  4JI6 E;  2EMW A;  2LO3 A;  2EM5 A;  1YPN A;  4X65 E;  4LFC E;  2UU9 E;  4DV1 E;  2IHR 1;  2K4V A;  1DQ3 A;  2JVA A;  1PJS A;  1PJQ A;  1G2F C;  4DV6 E;  4NXM E;  1FKA E;  2YTP A;  4P7D A;  4BHB A;  3EPK A;  2YRH A;  2NUG A;  3ZOQ B;  2B9D A;  2EPM X;  4BHC A;  2EN6 A;  2JOB A;  1N3G A;  1WXR A;  2F4V E;  4ZYD A;  5F3W A;  4IS1 C;  2UUC E;  5A6A A;  3ADJ A;  1A1H A;  2DRP A;  2EPN A;  4F6N A;  1HNX E;  1DGC A;  4M2Z A;  2VF1 A;  2EM8 A;  3VHT B;  2RS7 A;  1A1F A;  2EPR A;  1YYK A;  2EPC A;  3K6Q A;  4X62 E;  1EKZ A;  2EPA A;  4O43 A;  4KHP E;  5AE2 A;  1ZBQ A;  5A6K A;  4GKJ E;  2MC5 A;  4DUZ E;  1YUI A;  3F6G A;  5KL2 A;  3HQ1 A;  2RTX A;  3L00 A;  1WHN A;  4BC9 A;  5FLX C;  2EWL A;  2PRT A;  2VRD A;  4FK5 C;  4R2E A;  2B3T B;  3MSW A;  2M1S A;  2YTQ A;  2VQF E;  2RQL A;  3F6H A;  4BMJ A;  1IMU A;  4WYQ B;  2EMH A;  2LT7 A;  1N32 E;  1XMQ E;  2NUE A;  4O4K A;  2EQ1 A;  2BBG A;  3LML A;  3HTX A;  2EOQ A;  2HC5 A;  3EPL A;  2DLQ A;  1BBG A;  2FTX B;  1XNR E;  3P1X A;  2RSI A;  2J7J A;  1SFE A;  2JPA A;  2HJJ A;  2LCE A;  3DF6 A;  4GKK E;  1LLM C;  4JI5 E;  2EOR A;  1UBD C;  2EOY A;  1X6H A;  1UIL A;  4WFT A;  2ENA A;  3AV0 A;  4JI8 E;  3OML A;  2B7V A;  4M0V A;  3RMP A;  4LF8 E;  1YZ9 A;  4F6M A;  4F9B B;  3H09 A;  4M9V C;  1EH6 A;  1IQS A;  5A6B D;  4B3M E;  4F2J C;  1XMO E;  1PKP A;  2E72 A;  5LL6 R;  2EN1 A;  2LRS A;  2E5L E;  1YSA C;  2CTD A;  2V88 A;  2UUB E;  4DR6 E;  5AE3 A;  5KL7 A;  2EN3 A;  2YU8 A;  1N36 E;  1PDA A;  1UHZ A;  4TUI A;  2I13 A;  1YFH A;  2JWO A;  1GQE A;  2YWQ A;  1STU A;  4R8O A;  2EPL X;  4DUY E;  2LJH A;  4B3T E;  1X5W A;  2HGH A;  2JYA A;  4O24 A;  4X66 E;  1FJG E;  3ADL A;  3JTZ A;  4JI1 E;  1Z1B A;  2FV4 B;  4X64 E;  2ODR D;  1IBK E;  2YTO A;  4K0K E;  4ZYE A;  5AE1 A;  1A1L A;  1J26 A;  4GZN C;  1X48 A;  4DR3 E;  2EMZ A;  2EN8 A;  4O5G A;  4HTG A;  2B7T A;  2EOX A;  2KON A;  1X6E A;  3THO B;  4YHH E;  4WSP A;  2EM2 A;  4DV3 E;  2R76 A;  2YSO A;  4RHB B;  2G7H A;  5KL3 A;  2EOF A;  5AC4 A;  2EPZ A;  2EL5 A;  1P47 A;  1X49 A;  2EMX A;  4R2S A;  1XNQ E;  4X9J A;  5LLQ A;  2L6M A;  3TQM A;  1N33 E;  2ENC A;  3UK3 C;  2CSH A;  4LTY A;  1L4S A;  2F8B A;  3C6M A;  1G2D C;  1ZR9 A;  2RS6 A;  1RMD A;  4NZV A;  2YPN A;  2EMA A;  3FIG A;  4YY3 E;  2DSY A;  2ELZ A;  2BB8 A;  4GEQ B;  1A1K A;  2WZO A;  4LU9 A;  3EPJ A;  3J7Y p;  4I8O A;  3KWR A;  4P78 A;  2M7Q A;  5AC5 A;  3IWB A;  3BBG A;  3DJW A;  4DR2 E;  4AQY E;  2L2M A;  2EM0 A;  4WSG A;  2LBS B;  2UXB E;  2L2K B;  2L3J A;  2EMI A;  4WXC A;  1MGT A;  1X47 A;  2EOE A;  5A6B A;  2EMG A;  2JR1 A;  3HXL A;  4R2P A;  4L8N A;  2LUQ A;  1N34 E;  2YZT A;  2EMB A;  3IWC A;  1WRJ A;  5T6J A;  2EP3 A;  3MHH C;  1UN6 B;  4LF5 E;  2R1F A;  2LE2 A;  2EML A;  2L92 A;  3LLH A;  2V85 A;  2YT4 A;  2JXP A;  2KHX A;  4BC7 A;  4DR5 E;  4JI4 E;  2V87 A;  1A1J A;  1T4L B;  2YTD A;  1PJT A;  4J8Z A;  4RH8 A;  5ADZ A;  4Q35 B;  2EM3 A;  4NHR A;  3KZZ A;  3HPS A;  4L5N C;  2KOU A;  4WXD A;  4F9A B;  2DB2 A;  2N3G A;  3VK6 A;  2EPK X;  4DV0 E;  3C6K A;  2LTR A;  1T38 A;  4ZYH A;  2DIX A;  1IBL E;  2EMC A;  2JP9 A;  2Q8U A;  4N4R B;  4Q28 A;  1EH8 A;  1KJK A;  1HNW E;  2EOO A;  2DMY A;  2N8X A;  4MLV A;  2EZ6 A;  1NEI A;  1YYW A;  2LUP B;  2VQE E;  2E1M A;  2EMF A;  2YTG A;  3AUZ A;  2EE8 A;  3M99 B;  1I94 E;  4MLQ A;  3T1H E;  2LTS A;  4B3S E;  2LVH A;  2EOM A;  4ZYG A;  1RC7 A;  3C4B A;  5BR8 E;  4KZS A;  5A2Q C;  5KL4 A;  1TN9 A;  5IV8 B;  2YTI A;  4DR1 E;  5CFF E;  1AH5 A;  2A25 A;  2FGG A;  2YTJ A;  1BB8 A;  4BS9 A;  2YTE A;  3BGH A;  1TF3 A;  4LF4 E;  2EQ0 A;  2YU5 A;  1T39 A;  2L2N A;  2I9I A;  3VYX A;  1KYQ A;  1NCS A;  3IWD A;  2ENH A;  3QG5 C;  2NUF A;  4R2R A;  1HR0 E;  2MDR A;  2GHF A;  2L33 A;  4R2C A;  2EOS A;  3J81 C;  2L8T A;  1ZBT A;  4R03 A;  1X6F A;  4B3R E;  2UXD E;  2V86 A;  4WX9 A;  4BBY A;  4LF7 E;  5AAS A;  4BCA A;  5DNY A;  2EL4 A;  1A1G A;  2DMI A;  2UXC E;  5IT9 C;  1IBM E;  4DV2 E;  2EN7 A;  4DV7 E;  1GZ6 A;  2MDG A;  2VE7 C;  2N3H A;  3JU0 A;  1MEY C;  2EPP A;  2EOI A;  2V89 A;  3ADG A;  3OTO E;  2MC6 A;  2K7I A;  5LMN E;  4KWY A;  4DMI A;  1IQO A;  2H36 X;  2EPO A;  4IJD A;  1O0W A;  2YRK A;  1DI2 A;  4M30 A;  2DGC A;  2EL6 A;  1TF6 A;  1YYO A;  1GTK A;  1ZU1 A;  1JK1 A;  2WBS A;  4DV4 E;  5IWA E;  2MKD A;  3MHS C;  3C4T A;  2EM6 A;  2EM7 A;  2EM9 A;  4TUG A;  1B69 A;  2ODR C;  2NAB A;  2ADR A;  4WPY A;  2GLI A;  2NA2 A;  2LV2 A;  5A69 A;  4JV5 E;  4JI3 E;  2V8Q B;  2EPU A;  1ZAA C;  4NXN E;  2GPI A;  3ECR A;  4X8W A;  4JI2 E;  2M9A A;  2EQ3 A;  4DR7 E;  2LMZ A;  4DR4 E;  2EN4 A;  3KZY A;  2CPN A;  3BF2 A;  2JOX A;  2YTN A;  1BBO A;  1F2I G;  1AAY A;  2WCC 3;  4LF6 E;  3EQ1 A;  2ELY A;  1X3C A;  5KL5 A;  1JK2 A;  1RQ0 A;  3BID A;  1QU6 A;  4F54 A;  5IXM B;  2MKN A;  2EMY A;  1T4N A;  2EPX A;  1WJP A;  3VYY A;  4R2A A;  2HHH E;  4OX9 E;  1HNZ E;  2D9H A;  2WBT A;  4F9C B;  3EPH A;  4LFB E;  5LMU E;  1EH7 A;  1QNT A;  4DKK A;  4JYA E;  2JY9 A;  3THN A;  2YTF A;  2ZM6 E;  2V83 A;  3ADI A;  2EN2 A;  1SR9 A;  4DV5 E;  4JI0 E;  4R2D A;  2L3C A;  2EOH A;  2DLK A;  2YSP A;  4LFA E;  2EM4 A;  1T4O A;  3J7A G;  1A1I A;  2EOZ A;  2YRM A;  3JAM C;  2LJU A;  2EMK A;  2EOJ A;  1WHQ A;  3J80 C;  4HEI A;  2UUA E;  4LF9 E;  4JI7 E;  2RPC A;  3T1Y E;  4R2Q A;  2CT1 A;  2RSM A;  5TSE A;  2M4I A;  2EJ4 A;  5A6J A;  5KL6 A;  4OOG C; 
#chains in the Genus database with same CATH homology
 2E72 A;  2EN7 A;  2EN1 A;  2WBU A;  1YUJ A;  1YSA C;  2MDG A;  2CTD A;  2EMW A;  1A1J A;  2LO3 A;  2EM5 A;  2YTD A;  5KL7 A;  2EN3 A;  2YU8 A;  1MEY C;  2EM3 A;  2EOI A;  2EPP A;  2I13 A;  1G2F C;  1X5W A;  2HGH A;  2YTP A;  3EPK A;  2YRH A;  4IJD A;  1Z1B A;  2YRK A;  2EN6 A;  2DGC A;  2EL6 A;  1TF6 A;  2YTO A;  1ZU1 A;  1JK1 A;  1A1L A;  2WBS A;  4IS1 C;  4GZN C;  2EMC A;  2MKD A;  2JP9 A;  3MHS C;  2EMZ A;  1A1H A;  2EM6 A;  2EM7 A;  2EN8 A;  2EM9 A;  2DRP A;  4F6N A;  1B69 A;  2EOX A;  1DGC A;  2NAB A;  1X6E A;  2ADR A;  2EM8 A;  3VHT B;  1KJK A;  1A1F A;  2GLI A;  2EPR A;  2LV2 A;  2EOO A;  2EPC A;  2EM2 A;  2YSO A;  2EPA A;  2EPU A;  5KL3 A;  1ZAA C;  2EOF A;  2EPZ A;  2EL5 A;  2EMF A;  2M9A A;  2EQ3 A;  2YTG A;  1P47 A;  2EE8 A;  2EMX A;  3M99 B;  4R2S A;  4X9J A;  1YUI A;  2EN4 A;  5KL2 A;  2LVH A;  2ENC A;  2EOM A;  2CSH A;  3UK3 C;  2YTN A;  1BBO A;  1F2I G;  1AAY A;  1G2D C;  2WCC 3;  1ZR9 A;  1RMD A;  2ELY A;  1X3C A;  2PRT A;  2EMA A;  2VRD A;  4FK5 C;  5KL5 A;  4R2E A;  1JK2 A;  5KL4 A;  1TN9 A;  2YTI A;  2MKN A;  2EMY A;  2YTQ A;  2ELZ A;  1WJP A;  2BB8 A;  2EPX A;  4R2A A;  2A25 A;  2YTJ A;  1A1K A;  1BB8 A;  2D9H A;  2YTE A;  3EPJ A;  2WBT A;  3EPH A;  2EMH A;  2LT7 A;  1TF3 A;  2EQ0 A;  2YU5 A;  2EQ1 A;  2YTF A;  2EOQ A;  3EPL A;  2DLQ A;  2EM0 A;  4WSG A;  1NCS A;  2EN2 A;  2ENH A;  2EMI A;  4R2D A;  4R2R A;  2GHF A;  2EOE A;  4R2C A;  2EOH A;  2DLK A;  2YSP A;  2EMG A;  2EOS A;  2J7J A;  2EM4 A;  2RSI A;  2JPA A;  4R2P A;  2LCE A;  1X6F A;  1LLM C;  1A1I A;  2EOZ A;  2YRM A;  2EOR A;  1UBD C;  2EOY A;  1X6H A;  2EMB A;  2EMK A;  2ENA A;  2EOJ A;  2EP3 A;  3MHH C;  1UN6 B;  2RPC A;  2EL4 A;  1A1G A;  2R1F A;  2EML A;  4F6M A;  4M9V C;  2DMI A;  2CT1 A;  4F2J C;  2EJ4 A;  5KL6 A;  4R2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...