2G7HA

Structure of an o6-methylguanine dna methyltransferase from methanococcus jannaschii (mj1529)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
167
structure length
167
Chain Sequence
MIIQIEEYFIGMIFKGNQLVRNTIPLRREEIFNFMDGEVVSNPEDEHLKVAEIILKLYFAEIDDKKVRELISYKLEVPEFTKKVLDIVKDIEFGKTLTYGDIAKKLNTSPRAVGMALKRNPLPLIIPCHRVVAKNSLGGYSYGLDKKKFILERERLNMVSFKFNKVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
publication title Structural studies of MJ1529, an O(6)-methylguanine-DNA methyltransferase
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 20
structure length 167
sequence length 167
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2006-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2g7hA02
3.30.160.460 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2g7hA01
2VN2A 3EQLF 3TOBA 5L3DA 2MA3A 2M5WA 2KIUA 2YX4A 2EFWA 3GFJA 3T8TA 4L9TA 1FYKA 3CO7C 5LHGA 4L18B 1JHHA 3WE3A 4KUMA 2DI3A 2L02A 3BJOA 2F2EA 3LA3A 4L0ZB 3DEUA 5DDGA 2DLLA 2G7HA 2BE5F 4KYWA 2E1CA 2G7UA 4CICA 4BYYA 2DTRA 2FMLA 2GIVA 2HYFA 4XRFA 2RGVA 3ROUA 4LG0A 4IRIA 2Q2EA 4JBAA 5K5OA 3ECOA 1B1BA 2FF4A 3CLOA 1H9GA 2XV4S 3GWZA 5HS8A 3D5LA 3ECHA 1HXDA 1AWCA 1P2FA 2JPBA 1TBXA 4R8HA 2QWWA 1IW7F 3BPXA 4CYDA 4D0PA 5CVJA 1FT9A 2PJPA 2A07F 1KQ9A 3KETA 5L3CA 2CW0F 1G6NA 4ZZLA 1XGNA 3KZYA 4MQ9F 4IPAA 4AVPA 1IRGA 3I58A 2PN6A 2Z5UA 4NHJA 4GO1A 4XBFA 3Q5FA 4GXOA 2P6SA 1TQIA 2D45A 5JFRA 2XGXA 1I6XA 5CVIA 1OKRA 4Q48A 1ZHFA 1FSEA 5BQTA 2DK8A 1ZG1A 3F3XA 1J2XA 2GA2A 4G8XA 2ZMEA 1T98A 2YR2A 4K2EA 2EFNA 5LRSA 1R1UA 2HDCA 2QQAA 1UHMA 1MJAA 3ZMSA 2H27A 1ZLKA 2X0LA 5AONA 3RJPA 1J5YA 5FO5A 3MZYA 1ZRFA 3PFIA 2OA4A 1ZRCA 1XSXA 1WKMA 4CGZA 1E2XA 3ULQB 2F5DA 3TDZC 4EV0A 3GZ6A 2FEZA 2YX7A 1S29A 1B6AA 2IP2A 1FC3A 4HF0A 2LSOA 4UHTA 3V7CA 1ZARA 4HZFA 3RPQA 4KDPA 4EJTA 3QU3A 1HSJA 2F5EA 2EWNA 2WV0A 2FNAA 2XIGA 2IPQX 4R1HA 2EFOA 3TQNA 4MNUA 3MFKA 4LJZF 4L9NA 4LFUA 3DKWA 1XSVA 1OMIA 1JE8A 5TRDA 4HX8A 3QOPA 3FHZA 1T38A 3VB2A 1XMKA 4OU0A 4Y13A 3WTTC 1O3TA 3CUQC 3J81K 1H0MA 1U5TA 1GXQA 1O3SA 2QZ8A 1IXSB 4MTEA 4CXFA 4XLPF 3HOTA 2CYYA 1G4DA 3KP5A 2Q8KA 3IWFA 2P6TA 1B9NA 2A68F 1DUXC 3E6MA 4ENKA 3CUOA 2YPRA 2NNYA 2K4JA 3J7AO 3HRMA 3IKVA 1KA8A 1FX7A 1J0RA 5DD8A 1BC7C 1KU7A 2OZUA 2RDPA 3C1DA 4CDGA 2HQNA 1U3EM 2PEXA 1STZA 2VODA 4B8XA 3KP2A 2YSRA 3ZPLA 4RGSA 5HLGA 1U2WA 1DPUA 5DCMB 2OQGA 1SFUA 2EJRA 4H0EA 1IN7A 4WXDA 5FLXZ 1RI7A 1W4MA 2DPUA 4ESBA 1BBYA 1DDNA 5IT9K 2Y75A 1PP8F 3ZMUA 2RKHA 2FBHA 2B0LA 1I5ZA 4A0XA 1C0WA 1G3TA 4HLXA 4KN7X 3C18A 1OYYA 4RGUA 2COMA 2XAFA 2V9VA 2RNJA 3L9FA 3M8FA 4I09A 2VOPA 1D8KA 3GFLA 1WWXA 1SD7A 2M30A 2UXNA 4M6YA 1BI1A 1OYIA 4Q47A 2FA5A 4BHCA 3M8EA 2PQ8A 5IT3A 2STTA 4NB5A 2DW4A 2RQPA 2ETHA 1UFMA 2O8XA 4P9FA 4BHPA 5JR3A 4WX9A 2M1BA 4M74A 2ZKZA 2C6YA 3TDUC 3Q9VA 1OYWA 1KU3A 1TQMA 3SZTA 1EH6A 4ZH4F 1O7LA 4EM2A 4EGZA 2HYGD 3HIFA 2GA1A 3ERED 3QRFF 1SMYF 2H09A 1YS6A 1XDUA 2A6EF 1O3QA 1K78B 1R7JA 4RGXA 2HFHA 3KP7A 1EH8A 4R79A 1OPCA 3WTUC 1YW7A 1XB4A 5H20A 2W57A 5D5XB 5D4RA 4ZYDA 5K5QA 3D0SA 3M1EA 5DUIA 2KIMA 5E8GA 1FBUA 5DEQA 4XSXF 5CLSA 4I01A 4M72A 4RAZA 1DPRA 2K02A 5J8FA 4CO8A 1MJ9A 1R22A 4MEXF 1I1SA 2ZJ2A 2F5FA 3I4PA 5H6RA 5FFXA 3WTYC 5HDNA 3FF5A 4EM0B 2H6CA 2NAZA 5BS6A 3T1BA 4G7HF 2DQLA 2HR3A 3REOA 2BEOA 1IN8A 3HRUA 3DV8A 3HHGA 4I98B 2ZFWA 3JW4A 1MDMB 5D6EA 4P96A 3L7WA 1EV7A 3WGHA 4YFXF 3R6SA 4YIFA 2JTVA 2JT1A 2ZNZA 2NNNA 3TKYA 1QZZA 2QYOA 4UUVA 1IN6A 3FMRA 1PP7U 2UWMA 3LWFA 4ZZDA 1R36A 3IHUA 1TLHB 3LA7A 2UZKA 5HS7A 5E17F 2O6GE 1W7PD 2JZYA 1V3FA 1R5GA 2VT3A 2Y48A 5D5UB 3FMQA 2FXAA 1FYMA 2V79A 1I1GA 2Z3YA 5DCMA 2ELHA 1BJAA 3RDIA 2W25A 5J6XA 3DPLC 3KFWX 5E1XA 2K7LA 2QQ9A 2P5LC 1CF7A 4FT8A 1HKTA 3NQOA 4EM1A 2P5VA 3K2ZA 4OIRF 2XROA 2XUBA 4IVNA 5LLQA 3BPVA 2KJBA 4ZYHA 1ZRDA 3IKTA 3I53A 1RZ4A 4L5JA 4N0BA 1PDNC 2ADUA 3NRVA 4I0BA 4YIIA 2JRTA 4RB2C 3HYIA 5LHHA 2X4HA 4AWXB 1IAWA 1F4KA 2ZCWA 4WXCA 2E7XA 4KT5C 2HQRA 3RYPA 3WU0A 1YS7A 3DF8A 3LAJA 3E5QA 4BQAA 3F72A 3SZPA 4HLYA 1LNWA 3W6KB 4MTDA 2KRFA 2RN7A 1QO0D 4N9HA 1HW2A 4WK8F 4FX4A 1ZG3A 2L54A 1USTA 4PGHA 4OIPF 2VONA 1T0FA 2HEOA 3L09A 1FNNA 3ZMTA 4KMFA 3TO6A 3SXYA 3AAFA 2D1HA 2J5OA 3RKWA 1YG2A 1LDJA 3I59A 1YFHA 1YQAA 1K78A 3P9CA 2NRAC 1MZBA 3ISPA 1KU9A 2RVCA 3R0AA 3FWEA 2ESHA 3HTUA 2DO7A 3IC7A 1T2KA 2ZNYA 2R3SA 4N9IA 2OD5A 2FE3A 1Z7UA 2J5PA 3BWGA 4LK1F 3ABUA 4O6JA 2R7DA 4JQFA 3KZZA 3CUQB 4FHTA 4LD5A 5EEGA 1IUYA 4LLLA 1ZGAA 3BROA 2QUFA 4ESJA 5H6QA 2HKOA 4LMYA 4AIJA 1YLFA 5A2QZ 1BOAA 2YU3A 1GVJA 1TW3A 2P8TA 2MLGA 4EMSA 3OV8A 1J7KA 2MLKA 4IXAA 5AIPA 2A6HF 4S05A 2A61A 4U88A 2DAOA 2OZ6A 2LKPA 1R00A 1DP7P 1BI3A 4YFKF 4G9YA 2ZBKA 3HRTA 1FSHA 1MDMA 4PGGA 4L9VA 1RIOH 1P92A 3ZN0A 3HUGA 2STWA 3T5XA 4U0VA 5D6FA 2V6CA 2O3FA 3F23A 2QQBA 4G6DA 5CYVA 3S2WA 4O3MA 2HZTA 1QGPA 1D5VA 4F7ZA 4EJOA 3I64A 4UVBA 3MAJA 3QP6A 4M9SA 3P9KA 3V7SA 4KIBA 4M73A 3QU6A 4IRHA 3WE2A 3F8NA 2Y0MA 4JK1X 3Q9SA 2PBIA 3VOEA 2IA2A 3G3ZA 2XAQA 3RPUA 4RGRA 1W5TA 1TNTA 4U7DA 2QBYB 3G73A 1ON2A 1OR7A 4HAMA 5LEJA 1MD0A 1R58A 1IXRC 2M87A 2LNBA 1O3RA 5F64A 4GYGA 4RAYA 2LDUA 5AIQA 5E1ZB 1F5TA 1KYZA 2KIFA 1BIBA 4BAYA 4MEYF 2P7VB 5FFZA 3V8LA 2FBIA 1GHCA 4A5NA 2PLYA 3LSTA 4L5IA 3HRSA 1BM9A 1W7PB 3U9GA 3LQQA 3J80Z 2PMUA 3MZHA 5BPIA 3GFIA 5FB2A 3JAMZ 2MC3A 2QENA 1WQ2A 3RYRA 2VBXA 4KICA 3HSRA 1UHWA 3HSFA 3CDHA 5L3EA 4IF4A 3GFMA 1CF7B 5D5VB 5HS9A 3F8BA 5D8KB 1LDKB 5ILUA 3QP5A 5BOXA 2H94A 3U1DA 4KA4A 2V1XA 4HW0A 3FM5A 1YIOA 4EJWA 4WF2A 2E7WA 4A6DA 4I7HA 4A5MA 1IRFA 3HOSA 2IW5A 1HW1A 2AS5F 5ICGA 3F6OA 5LGTA 3KP6A 1XCBA 5ED4A 2IRFG 1F9NA 2VC1A 3M7GA 4HA8A 3ABTA 3TO9A 1BI0A 4HV6A 4EGYA 3LQRA 1L0OC 3R61A 1IN4A 3CO6C 4G6QA 4ON0A 2BYVE 2VXZA 1T6SA 1G3SA 1AOYA 1YTYA 3CUQA 2EA2A 4LGWA 1XCVA 4FX0A 3BDDA 1REPC 4UNOA 4UXNA 4I2OA 3I59B 1HBXG 3RI4A 2WC2A 2HS5A 4GCVA 1LDDA 2FNPA 3JTGA 4HOBA 3O6BB 4M71A 3VFZA 3E6DA 3F8CA 3FXUA 4CZZA 2PI0A 3PQJA 2L3DA 3K69A 3OOPA 1A04A 1L3LA 1W5SA 1XDSA 2GXGA 1EH7A 2FSWA 3K9TA 3ZP5A 1FZPB 4ENNA 4P5OA 3B73A 3C3WA 1TW2A 1IF1A 4U7BA 1K79A 2K27A 4KNYA 3IL2A 1ZN2A 2KKOA 2L4MA 3KEQA 5HOOA 3WTVC 3R60A 1WRJA 3R4KA 1JHFA 4QWQA 3DXJF 2CG4A 4MGRA 5L3BA 1KQ8A 4BH9A 1D3YA 1SD4A 2O0YA 2HOEA 2IA1A 2EA4A 3WU1B 2Z33A 2GWRA 3FXQA 5DD4A 3WG9A 2EV0A 3QAHA 2CGPA 3F6VA 2IT0A 3KE2A 3GW2A 2QBYA 5EEHA 4CHUA 4DNCA 3PQKA 1MKMA 3JSOA 1XGMA 1LEBA 2D2WA 2M8EA 4UV8A 3J80K 3MCZA 2H6BA 5E20A 4LB6B 4IJAA 4UV9A 2V1DA 2BV6A 2VOOA 1X3UA 3F8MA 3JTHA 1GXPA 1Q1HA 5FLXK 3DP7A 2XRNA 2JSCA 3I5UA 3B02A 1Z6TA 1W7PA 1ODDA 1NHAA 5CVUA 2MD5A 3WTSC 1JGSA 1HKSA 2ISZA 1QPMA 2CFXA 3EYYA 2W85A 5ILSA 1XN7A 1TTYA 1YW9A 4G7OF 3WTWC 3KCCA 3E5UA 4BNCA 3IRRA 3M9AA 1KGSA 1YW8A 1RNLA 2HKXA 2CWEA 4HYEA 4DQ2A 4HBLA 3J81Z 3V8JA 5J8CA 4L0YB 5KK1A 1YYVA 1XMAA 1SMTA 3ZMDA 2DQRA 2LF8A 3WODF 2DBBA 4XLNF 2D1VA 3SHFA 2OAZA 1FY7A 4M9ZA 4ESFA 1RUNA 1SD6A 1LEAA 1J75A 3QPTA 2HTJA 2L01A 5HVQC 2IJLA 3MEXA 2OBPA 2P5KA 3FMSA 3O2PE 1Z1DA 5E1WA 4G94A 1WI9A 1K6OA 1B4AA 4HF2A 2QM3A 2VE8A 4OIOF 4M9XA 5FD5A 1FYLA 1BC8C 3R0JA 4IRGA 3CTAA 4KFCA 2HTSA 3ZMVA 1V4RA 4RS8A 5KVRA 1TQPA 2FMYA 1U5TC 4LB5A 1FP1D 2EB7A 1ZYRF 5LGNA 3E6BA 2FQ3A 3GVAA 3BJAA 3NEUA 4QLCU 4EJUA 5IT9Z 1FBQA 5HLIA 2VBYA 3K0LA 3H3ZA 5DV5A 5K5RA 3I71A 4P9UA 5E8IA 1HSTA 4NQWA 1VTNC 3H3UA 2CQKA 3QPHA 4GGGA 5LGUA 1IXCA 1R23A 1ONVA 5ICEA 4UVCA 3V4GA 1KYWA 1SFXA 2W84A 3F21A 4IHSA 5L3GA 2EK5A 2BGCA 3ZQ7A 2PMHA 1U6GA 3GUDA 2EV5A 2ISYA 1TNSA 2XVCA 6PAXA 3F22A 2CO5A 4U0WA 1S3JA 1IN5A 1MJBA 4LK0F 4A0ZA 1WSUA 2NS0A 1I27A 5HLHA 3RIRA 1KU2A 3VODA 4PDKA 2TDXA 5LRRA 4KN4X 4HF1A 4MQVA 1HKQA 1U8RA 3I0TA 4B09A 4Q4ZF 3P9IA 3HSEA 5D5WB 1R1VA 2BBYA 5CJ9A 2CSOA 3ZN1A 5E18F 3COAC 4IHTA 3ML6A 4P55A 2DK5A 3HHHA 5HDGA 4EJVA 3HTSB 3JSPA 1G3YA 1P4XA 4I0AA 4AD9A 1PUEE 5CVRA 3RKYA 3C7JA 5D4SA 5DCFA 1G3WA 4HX4A 3GYHX 2K4BA 4HV5A 1Y0UA 2PG4A 3GZ5A 5JHUA 3L00A 3GXOA 3V7RA 4RB3C 1D8JA 2XASA 2G9WA 2FRHA 4YFNF 3BP8A 4U0YA 4Q5SF 2GXBA 4BXUA 1BIAA 1S7AA 2DT5A 3T0YA 1B9MA 1KQ0A 2GAUA 3EETA 3TO7A 2M45A 3RKXA 1XGOA 2XAJA 3FM3A 2MH2A 2JPCA 4M6XA 2VT2A 2EFPA 2GZWA 4Y15A 2XAGA 1FP2A 3RTRA 2FBKA 2OQRA 3KEOA 2VBWA 4ENMA 4EVIA 3DPTA 2WTEA 1QQIA 1QNTA 2QLZA 2PFBA 5TJJA 2RV8A 5DUKA 4A6EA 5JVTA 2OU2A 1LVAA 1P4AA 3WGGA 1BN5A 3IWZA 2WWYA 2ACJA 2Z9OA 4A0YA 1E17A 3WTZA 3WGIA 3N4MA 3KP3A 4O5VA 3KLNA 4LLNA 3SQNA 4G7ZF 2ESNA 3MWMA 1BI2A 2F5CA 1YO5C 1Z91A 2VC0A 3BJ6A 2DPDA 1MGTA 1CGPA 5DYMA 5BPDA 2R7FA 3K1PA 5LEKA 5ERIA 4ASNA 2RC4A 3E5XA 1ZREA 5L3FA 3T8RA 3LAPA 1HW5A 5ILVA 1QBJA 2DFIA 2LF7A 3V8KA 1SAXA 4LG0B 2A69F 2AXLA 3I54A 1HQCA 3K1MA 3BOQA 3WTXC 4ETSA 2MH9A 1P4WA 2K86A 3DQVC 4OMZA 2O03A 2W24A 1FWZA 3N97A 4UVAA 3KLOA 4A2UA 4ZYGA 1LQ1A 5HDKA 3GO5A 3H92A 1T39A 5A2QK 1ZAOA 2L4AA 5FD6A 3GF2A 1ZH5A 1FLIA 3FX3A 5F6FA 4AIKA 1ZLJA 4ENJA 2EV6A 2DU9A 3GEZA 1JXSA 1Z6RA 2XAHA 2ZO4A 3TOAA 1Z05A 1UB9A 5LHIA 4WWCA 4I02A 1O57A 4KIGA 3ZMZA 1LB2A 3FXRA 3E3VA 3EDPA 2XKOA 3U2RA 1U78A 5K1YA 5F1RA 2FOKA 3E6CC 4PCQA 1Z9CA 5ICCA 2VE9A 2GQQA 4OOIA 2ZXJA 4S04A 1XD7A 5FGMA 5ICFA 1QZYA 3SFZA 2IA0A 1SD5A 4HX7A 1ON1A 2QVOA 1K7AA 2E1NA 2ZMEB 4L9JA 2A5YB 4TV7A 1S8NA 1UCRA 3VEPA 1H9TA 1P6RA 3BY6A 4XSZF 3CJNA 4PZJA 4KMUX 4LLGF 4HQEA 4WCGA 1S7OA 2IVMA 2FU4A 4KIFA 4EQQA 2O61A 4GYIA 2UXXA 2XHKA 1F1ZA 1IZ1A 4E70A 4A12A 1S6LA 3E97A 3BZ6A 1LJ9A 1USSA 2Q0OA 1SFEA 2HWVA 4Z2YA 2XKPA 4HDUA 3P7NA 1J59A 2VBZA 4RB0A 4OINF 1J9IA 3L2CA 2HGCA 4Y17A 1XGSA 3EUHA 1ZG5A 2P7CB 5D8LB 4BHBA 2Z99A 1ZGJA 2MBFA 2V1UA 2KJCA 1FOKA 4MHGA 4HDVA 3IRQA 2P4WA 4YG2F 3KP4A 1FPQA 1R5HA 5JI6A 3JAMK 5CVVA 3GX4X 4AIHA 2NYXA 1XSDA 5BMZA 3LA2A 4HQMA 3TGNA 1O7FA 1FBSA 1ULYA 3ELKA 4ZYEA 4OMYA 3F8FA 3W6JB 4RB1A 2EFQA 3LFKA 3K1NA 3O3KA 4WXHA 3GLXA 5LBQA 3FZVA 1R1TA 1B59A 3DFGA 1U5TB 3MQ0A 3EYIA 4OIQF 1RUOA 2A3SA
chains in the Genus database with same CATH superfamily
2VN2A 3EQLF 1IBKE 1WJ5A 4DKKA 3HEFA 3TOBA 5L3DA 2MA3A 3VPRA 2M5WA 1ZBQA 2KIUA 3OYHA 1A1GA 2YX4A 2EFWA 4JI8E 1DGCA 2B3TB 2ELYA 3GFJA 2ZSHB 1WZ2A 4J19A 3T8TA 5FJ8J 4IO9F 4L9TA 4BJTA 1FYKA 3CO7C 1AH5A 1GUUA 2LRSA 2WAEA 5LHGA 4DV2E 4L18B 1JHHA 3WE3A 4KUMA 2ELJA 2DI3A 1HOMA 2L02A 3J7YJ 1P47A 1RKTA 4V2GA 3AL0B 2WAFA 3BJOA 2E36A 2F2EA 2R5ZA 2LFBA 2EPKX 3LA3A 4D1QA 1ETQA 3A03A 2AHQA 4XN0A 1K83J 1JGGA 4L0ZB 3OYCA 4AYBN 1G2DC 1XS9A 3DEUA 3ABLH 5DDGA 2EOFA 2JYAA 1TF3A 2DLLA 2G7HA 2M4IA 3I3LA 2E5LE 2E1OA 2M0CA 2BE5F 1A31A 4KYWA 2QF7A 2KOUA 2E1CA 2YTQA 4X8WA 5CKTA 1QVTA 1DQUA 1Z21A 2G7UA 3GTJJ 4CICA 4JI5E 4BYYA 3SDGA 2DTRA 2FMLA 2GIVA 2HYFA 1W1WE 4F93B 2EM3A 4XRFA 2WADA 2RGVA 4D7NA 3CC7I 4O43A 2E34A 3ROUA 2R7WA 1ZELA 1S9HA 2DFEA 5T6JA 3CMMA 4LG0A 2HYJA 3M8JA 2UV1A 1S72I 4IRIA 2Q2EA 4JBAA 5K5OA 3ECOA 2IXSA 2EMXA 2NVXJ 1B1BA 2FF4A 4DR3E 3CLOA 2VJ4A 3JRAA 1H9GA 3CQZJ 4C3JJ 4NUBA 3J81C 2XV4S 1B8IB 3GWZA 5KL7A 3G4SI 4AQYE 4RBOA 3K70C 3HKZA 1TC3C 5HS8A 3D5LA 3ECHA 4DIQA 1FOXA 1HXDA 1AWCA 1QA6A 4LF9E 2YSPA 1P2FA 2BXYA 2JPBA 2R92J 2K7IA 3C2HA 1FMVA 1TBXA 1VI0A 4MFEA 3H09A 4B3AA 4R8HA 1JKRC 2QWWA 4A3LJ 2CU7A 2HVRA 1IW7F 3BPXA 4CYDA 4A3KJ 2NVQJ 2B7VA 3KX2A 4D0PA 5CVJA 1LE8B 1FT9A 2PJPA 4RAFA 4EATA 2A07F 2MDRA 1KQ9A 3KETA 5L3CA 2CW0F 1X3CA 1HC8A 1G6NA 2IEKA 3G71I 2KP6A 4DUZE 4LU9A 1X6EA 3VYUB 1XGNA 4ZZLA 3H36A 3KZYA 2YRHA 2BHYA 1SC7A 2NABA 2NS7A 4BL0B 4MQ9F 4IPAA 1OR7C 2N3HA 5H2FC 3BG9A 4AVPA 1IRGA 3I58A 3G1MA 3AG1H 2PN6A 2Y0SN 2Z5UA 2MC6A 4NHJA 4GO1A 4XBFA 5JHFA 3Q5FA 4GXOA 2P6SA 4TUGA 2JA6J 1TQIA 5EG0A 2D45A 5KNLA 2V9KA 3CCEI 3S3MA 3IP4B 2LK2A 2EMHA 3CCVI 5JFRA 3MKYB 2XGXA 2NVYJ 1N36E 5FROA 1I6XA 9ANTA 1Z77A 5CVIA 1OKRA 2OV7A 4Q48A 1ZHFA 1FSEA 3KEYA 5BQTA 2DK8A 1ZG1A 3F3XA 1J2XA 3HQ1A 2GA2A 4G8XA 2ZMEA 4M6VA 1SFKA 1T98A 2YR2A 1I39A 4K2EA 2EFNA 2J7JA 4H4KC 3Q0VA 5LRSA 1R1UA 2HDCA 2IGNA 2QQAA 1IBLE 5B1AH 5IT9C 3WG7H 3LSKA 1UHMA 2BY2A 1MJAA 2LKSA 4Y3OA 3ZMSA 1DU0A 2H27A 2YTOA 2EN6A 2DOFA 2WV1A 4XM3A 3LSJA 1ZLKA 2X0LA 2VIXA 5AONA 3RJPA 5E3OA 2E2JJ 1X1AA 2EZKA 2M0MA 1J5YA 3PNYA 2P0WA 4F2JC 3ZQLA 5FO5A 3MZYA 3IV5A 1ZRFA 2WBSA 3PFIA 2OA4A 2M9AA 1ZRCA 4L5NC 2X1DA 1XSXA 2DODA 1WKMA 1I50J 3FXMA 2BVMA 3PIPF 5AE1A 1T4LB 2EILH 3D1NI 4CGZA 5EF6A 1E2XA 3ULQB 2F5DA 3TDZC 3JCUC 4EV0A 3GZ6A 2FEZA 3RKQA 2B9SA 5K7ZA 4UY8I 1U0JA 2YX7A 4L5EA 4BU2A 3JR9A 1S29A 1B6AA 1WJAA 5KL2A 2ZJRF 1JUSA 2L7KA 2EMIA 2IP2A 2IAIA 1FC3A 4HF0A 2LSOA 4UHTA 5BR8E 3V7CA 1MBKA 1PUFA 4HNVA 3A01A 1ZARA 3UKGA 2KHMA 2VB6A 4DV4E 4HZFA 2DA3A 4JX4A 4XL9A 2JUCA 2YWQA 2WCC3 3HOZJ 1MMDA 1X3ZB 3RPQA 4KDPA 4EJTA 3QU3A 3ZGKA 1W5CC 1HSJA 4UUSA 4IEJA 4V19K 2YTPA 2F5EA 2EWNA 3VHTB 1SR9A 3GTGJ 2WV0A 2FNAA 2XIGA 4BY1J 1PJQA 2IPQX 4R1HA 2EPCA 2EFOA 3TQNA 2V8QB 2Q8UA 4MNUA 2BXZA 3MFKA 4F52A 3H5NA 4LJZF 4L9NA 1YX5A 4LFUA 4IHWA 2LV2A 2R4GA 1MSEC 3DKWA 2H8RA 2VLAA 1ZGWA 3L1PA 2DIXA 1XSVA 1OMIA 1JE8A 5TRDA 4HX8A 4X65E 3JTZA 1FTTA 4I8OA 3QOPA 5E79C 3C2BA 3FHZA 3DEEA 1T38A 2EPNA 4OX9E 5LMUE 3VB2A 1XMKA 4OU0A 4KZSA 3ASOH 1W0TA 4Y13A 5A6JA 3WTTC 2EM6A 4FTHA 3DU6A 1O3TA 3CUQC 3SEZA 1T8IA 1UG2A 2LTRA 3KPHA 3RPUD 2KZGA 3ABKH 1D0ZA 3J81K 3OIQA 2Y69H 3HPHA 1B72B 1H0MA 2KFDA 3IAS2 3Q3SA 1U5TA 1GXQA 4HNTA 2F4VE 1O3SA 3KIOA 2QZ8A 1IXSB 4MTEA 4CXFA 4XLPF 5KAIC 2XSDC 3HOTA 1FKAE 2GBYA 4OIQF 3BR1A 5E3NA 4DJAA 2DA1A 2CYYA 2L92A 1G4DA 3S17J 3KP5A 1YITI 4FE7A 3I55I 2Q8KA 3IWFA 2IGKA 2P6TA 2Y0SA 1JKOC 1B9NA 3DCFA 4BXXJ 3OYBA 2FJ1A 2VKEA 2A68F 3IH4A 4NDLA 5C3EJ 1DUXC 3GTPJ 4JI0E 1R71A 2E5ZA 3CESA 2QSGX 3E6MA 4ENKA 3CUOA 2R7QA 1UHSA 5EGOB 3OTOE 3M1CA 4HPQA 2YPRA 2NNYA 2K4JA 3J7AO 4R2QA 3HRMA 1P9QC 3AG2H 3CP2A 2FX0A 3IKVA 1KA8A 1FX7A 4GEQB 1J0RA 5DD8A 4B47A 1BC7C 3SEQA 1KU7A 2DMYA 3DF6A 2OZUA 2WBMA 2RDPA 3C1DA 4CDGA 4MIMA 2B7EA 2LP0A 3H5RA 2HQNA 2HXOA 3PSFA 1U3EM 2PEXA 1YHQI 1PYVA 1STZA 2VODA 4B4CA 4A3FJ 1JT6A 4B8XA 1GT0C 2JVAA 4QSHA 3HTXA 1UILA 3KP2A 3FKIJ 2YSRA 4DZPA 3ZPLA 4B3ME 4RGSA 4FETA 5HLGA 2V86A 1VQOI 2KIQA 4AVZA 3T1HE 1U2WA 1DPUA 5DCMB 2OQGA 1SFUA 5IOYA 1A1KA 2EJRA 4H0EA 1IN7A 4WXDA 4U87A 1GVDA 1RI7A 5FLXZ 1PDAA 3G6EI 1W4MA 2DPUA 4ESBA 1BBYA 1JJ6C 3NAUA 1DDNA 5IT9K 2Y75A 1X6HA 4JI4E 1WH7A 3AV0A 1PP8F 4JYAE 3ZMUA 2RKHA 2VJIA 2FBHA 2B0LA 3M07A 1I5ZA 4A0XA 4QTRA 3MKLA 3ZOBA 1C0WA 1G3TA 4HLXA 2DSYA 2JR1A 4IOCF 2YTDA 3BTIA 4CCNA 3BZKA 3EUKL 4KN7X 4JI2E 1LE8A 4JYKA 3BR0A 3C18A 1OYYA 4RGUA 2DB2A 2COMA 5KCMA 2XAFA 4BDYA 2V9VA 4Y33A 2R7VA 2RNJA 4F9CB 3RQ4A 3L9FA 5AE3A 3M8FA 4M3BA 3DBLB 4I09A 4WYQB 2TCTA 2DA2A 1DI2A 1G2FC 2VOPA 1D8KA 2YZTA 1YRNB 3GFLA 1WWXA 2Q2EB 3E0JB 1F2IG 1SD7A 2DT7B 2JQ7A 2M30A 4NC6A 2UXNA 3T1YE 4M6YA 4ZYAA 2YTGA 3L2VA 1EKEA 4NHRA 2DYRH 1D0YA 3UR3C 4C2TA 3G1LA 2KRHA 2HVSA 1BI1A 2UUCE 1OYIA 2GHFA 4Q47A 2FA5A 4BHCA 3M8EA 2PQ8A 2CTDA 1D1AA 4ZTFA 5IT3A 2STTA 4NB5A 2DW4A 3HOWJ 4LOCA 2RQPA 1OLTA 2ETHA 1UFMA 2RQQA 2R7SA 2CH0A 2O8XA 4R8OA 4P9FA 4BHPA 5JR3A 4WX9A 2M1BA 1XMQE 4M74A 2ZKZA 2C6YA 5F0HA 2YTNA 3TDUC 3Q9VA 1V5GA 2H8WA 1OYWA 4NC8A 1KU3A 1TQMA 3SZTA 3W2VA 2EMWA 1X1CA 2V9PA 1EH6A 4CCMA 3OS2A 4A3BJ 2RSIA 5K7FA 4ZH4F 1O7LA 2I8DA 1ZBTA 3IH3A 1A6QA 4EM2A 1ZR2A 5EJCA 2OCCH 2LOOA 2Y31A 2QKMB 3B6AA 2HYGD 4EGZA 3HIFA 2GA1A 3ERED 3K4BA 3RZOJ 3TEDA 3BR2A 1NG7A 2CMPA 3QRFF 3W2AA 1SMYF 1ACIA 2H09A 1RC7A 1YS6A 1XDUA 4DR1E 4YY3E 3GBGA 3L2UA 2V85A 2A6EF 4JI6E 1O3QA 1K78B 2EMAA 1R7JA 4WPYA 1HA8A 2MKNA 3B6CA 2ZJQF 5JLWA 4RGXA 3ZRGA 3HPGA 2HFHA 2LBSB 2W82A 3KP7A 1EH8A 3LL7A 3ZQGA 4J8ZA 4R79A 1OPCA 2K40A 3WTUC 1YW7A 1XB4A 5H20A 3VDXA 2W57A 5AC4A 3CJQB 3CF2A 2CPNA 3LLHA 2ODRC 4II3A 1Q1VA 3GTOJ 5D5XB 4CCOA 5D4RA 3OS1A 4ZYDA 4B3RE 5K5QA 2HDDA 3D0SA 3PFYA 3LSGA 3M1EA 4A3IJ 5DUIA 2KIMA 3FDYA 1DP3A 3S3NA 5B1BH 3CCUI 4KHPE 4XRMA 1ORKA 2LY2A 5E8GA 1U9NA 4AUXA 3HKZN 5M5WJ 1FBUA 5DEQA 4ZDOA 3ASNH 4XSXF 4BCAA 3HM5A 5CLSA 2QCOA 4I01A 1X58A 3GTMJ 4M72A 4RAZA 2MGQA 3U1KA 5KL6A 2F4IA 1DPRA 2K02A 5FRNA 5J8FA 1RMDA 3OIOA 4CO8A 1MJ9A 1R22A 2VL8A 4BQQA 4MEXF 2MC5A 1SAUA 1I1SA 2ZJ2A 3SYTA 2DFFA 2F5FA 3SZGA 4GDFA 4WFTA 1I3AA 1STUA 1RETA 3I4PA 5H6RA 2OPTA 5FFXA 1GQEA 3WTYC 5HDNA 3FF5A 2EOZA 4EM0B 4HTGA 2H6CA 2NAZA 5BS6A 1MNDA 3T1BA 4G7HF 3GTKJ 2DOAA 4E6KG 2VJJA 3CZ6A 2D5VA 4N4NB 2DQLA 2HR3A 2EN1A 3CP8A 1BBOA 3MSWA 1NTCA 3REOA 2BEOA 1IN8A 3W2WA 1YJWI 2DMUA 3HRUA 1D1CA 2NVTJ 2LJUA 2V88A 2ZJPF 5IYBJ 4BQOA 2VXDA 3LSIA 2Q1ZB 3OL3A 3DV8A 3HHGA 2Y9ZA 3HJEA 2EOJA 4I98B 2IS2A 2ZFWA 4R2CA 3VSLA 1RQ0A 3JW4A 1MDMB 3ZQIA 1Y6IA 5D6EA 4P96A 3L7WA 2PMZA 1B72A 2HOSA 4KITB 1EV7A 4JX6A 3HUGB 4XQFA 1YUJA 3WGHA 1WGXA 2OUMA 1HNZE 1HCRA 4YFXF 2EMGA 2LR8A 1NK3P 4J00A 3ZOQB 2AO9A 3R6SA 2UU9E 4W97A 4YIFA 2JTVA 2IS4A 2JT1A 2MFZA 4DUYE 2ZNZA 3MKWB 2NNNA 2DLQA 2M7QA 2JOXA 2CQNA 3TKYA 3OL4A 1QZZA 2QYOA 4UUVA 4IQ4A 3F9KA 4D7MA 4P78A 1IN6A 3FMRA 1PP7U 2W4SA 4DR4E 1BB8A 1V55H 2UWMA 3LWFA 5IV8B 4ZZDA 5EGOA 1R36A 2RAEA 1YIJI 3IHUA 2LMZA 1TLHB 3CC4I 3LA7A 3DTKA 3MN2A 3V42A 2UZKA 5HS7A 1TWHJ 2HOAA 2QGUA 4A93J 5E17F 3C4BA 2EOHA 3CMYA 5J4YA 2O6GE 2V83A 2L2MA 5LMNE 1XNRE 1W7PD 2JZYA 1V3FA 1UBDC 3H1CA 4KISA 1JT0A 2KT0A 1R5GA 4LTYA 1N77A 4HSRA 2CQXA 2VT3A 2Y48A 5K7HA 5D5UB 3FMQA 2XF5A 2FXAA 1FYMA 2V79A 1I1GA 3GLLA 1E0EA 3QYFA 2DA4A 4F9AB 2Z3YA 5DCMA 1ZAAC 3BG6A 1IBME 1AA7A 3HDDA 4OWRB 2FQ4A 2ELHA 1BJAA 3RDIA 2W25A 5J6XA 1U9OA 1N32E 1N25A 3DPLC 3KFWX 4OAZA 3CF5F 2HGHA 2RQLA 1UJ8A 1QU6A 5E1XA 2UUZA 4Q35B 2DYSH 2K7LA 2QQ9A 3IH2A 1OCTC 2KMUA 4A3EJ 2P5LC 2DA6A 3ZQCA 3ERMA 5F0FA 3OYEA 4FT8A 4ZJZA 1CF7A 2TRTA 1HKTA 3NQOA 4EM1A 2UXBE 2P5VA 3K2ZA 4OIRF 4CZCA 3RCOA 3EPJA 2EZHA 2XROA 3JRGA 2XUBA 4IVNA 5LLQA 1AKHB 3BPVA 2KJBA 4ZYHA 1ZRDA 4YEJA 1N33E 4HEIA 4E7KA 3CC2I 3IKTA 2LMDA 3THNA 3I53A 2ZXWH 1RZ4A 2ODRD 4L5JA 4N0BA 1PDNC 3TL4X 2ADUA 3NRVA 4I0BA 4YIIA 2JRTA 3MKZA 2M34A 2H1LA 3PNVA 3HYIA 5LHHA 4RB2C 3BZCA 2FTXB 1VNDA 3X2QH 2NA2A 4BKXA 2VUMJ 2JWTA 1YRNA 4K0KE 2X4HA 2NUFA 4AWXB 1IAWA 1F4KA 2EMKA 1FJGE 1P7JA 2ZCWA 4Q28A 3CD6I 3FXKA 4BE2A 3LSPA 3JRHA 4WXCA 2E7XA 2LKXA 4KT5C 2HQRA 2CW7A 3RYPA 3WU0A 3H9QA 1YS7A 1GLNA 3BLYA 3DF8A 4I76A 3LAJA 3E5QA 3BTCA 1HNWE 2UXCE 4R2RA 2V89A 4BQAA 3F72A 3SZPA 4HLYA 1SVOA 1LNWA 3W6KB 3Q0WA 4PUSA 4MTDA 2LLKA 4X9JA 2KRFA 2RN7A 3EPHA 1DQ3A 4X1EA 4BXFA 1QO0D 5DS9A 3A4CA 3K4CA 4N9HA 4FE4A 2MSYA 4WK8F 3RQIA 4FX4A 1HW2A 1ZG3A 4RDUA 2L54A 1USTA 3BG7A 3CCYA 4LF5E 4PGHA 4OIPF 1BJZA 2VONA 3ZR8X 1T0FA 3KYCB 4Y4RA 2YU9J 5FRMA 3HPZA 4BBYA 2HEOA 3L09A 1FNNA 3CDIA 3ZMTA 5HLTA 4KMFA 2CRGA 1WJEA 2L8TA 2YRMA 3MHSC 2WZOA 3CDLA 3MD2A 1J26A 2EMZA 4DYCA 2CUJA 3TO6A 3JREA 5IOZA 3SXYA 1VQKI 3AAFA 2D1HA 2DMTA 2XGCA 1WJDA 2J5OA 4E4HA 1DGRM 2DMQA 4XNFA 1XTAA 3RKWA 2EPXA 2HVQA 4ZDLA 1YG2A 5LL6R 1X2NA 1BA5A 4OAYA 1LDJA 5E3MA 3I59A 1YFHA 1YQAA 2V87A 1K78A 4M30A 2CQ7A 3CJTB 3ESWB 3P9CA 4YIRX 2QKLB 4PJNA 1I3QJ 5J40A 2DFHA 2NRAC 1MZBA 3ISPA 1KU9A 1CQTA 2RVCA 3BCAA 3EPZA 2LC2A 3FWEA 2ESHA 3H0GJ 3R0AA 2EM9A 2ENHA 3HTUA 2CW8A 2DO7A 4QPQA 2K85A 2LO3A 1SVLA 4DV1E 3IC7A 2EMCA 1T2KA 2KDOA 3DJWA 2ZNYA 2R3SA 3BCBA 2RSMA 1X3WB 3WHBA 1T4NA 4DR5E 2DGCA 2HOTA 2L7ZA 4N9IA 2LVSA 1ETXA 2OD5A 2FE3A 1Z7UA 2J5PA 2EN8A 3BWGA 4LK1F 3ABUA 2XPUA 4O6JA 4RMNA 2R7DA 5DTDA 4JQFA 4BC7A 1FIPA 3KZZA 2Y30A 3CUQB 3BR6A 4FHTA 2CQQA 4LD5A 4XR6A 5EEGA 3S32A 1IUYA 4LLLA 1ZGAA 3SFIA 3BROA 2EPUA 5AE2A 2PJRB 1WPKA 2QUFA 4P1WA 2LTSA 1VZ0A 2VKVA 3LSMA 4ESJA 4BACA 5H6QA 1A6IA 2HKOA 4DBRA 4BBSJ 4X6AJ 4LMYA 4AIJA 1YLFA 3HOUJ 5A2QZ 1BOAA 2UUAE 2YU3A 2X6XA 1GVJA 1TW3A 2VPLA 2P8TA 1KONA 2MLGA 1FJLA 1SVMA 4CUGA 2OCEA 2PX9A 3HGGA 3S1RJ 3S16J 4EMSA 3OV8A 1B69A 2L9RA 1LUJB 4CSWA 2K9QA 4JX5A 3QWLA 2HNHA 4KWYA 2E5NA 4FISA 1J7KA 2MLKA 4IXAA 2UUBE 2JA2A 1Y39A 5AIPA 5FKMA 2A6HF 2EQRA 2A61A 2L2OA 4S05A 5AASA 2E2HJ 5HNHA 4FK5C 4U88A 2DAOA 2OZ6A 4PJJA 2AXTC 2LKPA 1R00A 1JKQC 1BW5A 1BR2A 2X1EA 1DP7P 1BI3A 2JP9A 4DGWB 4G9YA 4YFKF 2ZBKA 3HRTA 1FSHA 2EQ3A 2JVHA 1LFUP 1N75A 5B3SH 1MDMA 4F91B 4PGGA 1QBJA 2LREA 4L9VA 1SFOJ 1GV2A 3DTEA 1RIOH 5A6KA 1KYQA 1P92A 3ZN0A 3HUGA 1G8XA 2L7FP 3FK7A 2STWA 5IY5H 2JA7J 3T5XA 3BR3A 4U0VA 5D6FA 5J1RA 1V5EA 2NUGA 1D5YA 1QVUA 2JRMA 2V6CA 1BR4A 1XC5A 2O3FA 4TUIA 4PFPA 3F23A 3BTLA 2QQBA 2Y2ZA 4G6DA 5KAFC 2YTEA 2L33A 2N8GA 5CYVA 1K6YA 3S2WA 2HC5A 2M7AA 3K70D 4O3MA 2HZTA 3ADGA 5KHDA 3EPKA 2EN7A 4C2MJ 4F9BB 1QGPA 2B63J 4BY7J 1D5VA 4F7ZA 1JK2A 3Q0UA 4EJOA 1LPQA 1VQ5I 3G2BA 3I64A 2L2KB 1A1LA 4UVBA 1GDTA 2RPCA 2EQ1A 1ETKA 3MAJA 5J47A 3QP6A 4M9SA 2O9LA 2RS7A 4AC0A 3P9KA 3V7SA 4KIBA 4M73A 3J7AY 1ZR4A 2LCEA 2V6EA 4NBQA 3QU6A 4IRHA 3WE2A 3F8NA 2Y0MA 4JK1X 3GCMA 3Q9SA 2PBIA 3JRCA 2LUPB 3VOEA 4IKFA 2IA2A 5IPAA 1GTKA 3DPUA 3VWBA 2R7XA 3G3ZA 2XAQA 3RPUA 4ABZA 4RGRA 4PFOA 3A1YA 2VPRA 1W5TA 1TNTA 4U7DA 2QBYB 1ENHA 3G73A 1ON2A 1OR7A 4HAMA 1JI8A 3KYDB 5LEJA 3U21A 1MD0A 1R58A 2ID3A 3VYTB 1IXRC 4ZTJA 2I5UA 4DZJA 2M87A 3BG3A 3AG4H 3ZQFA 4IZZA 2EM8A 2LNBA 1O3RA 3PL8A 4PK4A 1SEUA 5F64A 5IP7J 4GYGA 2JJ7A 4RAYA 2MG4A 4XRSA 2LDUA 5IYDJ 1KJKA 2EIJH 5AIQA 5E1ZB 1F5TA 1WJCA 3GTQJ 1KYZA 2KIFA 4O24A 1UZCA 4DV7E 1BIBA 1OISA 4BAYA 2BVLA 4DW6A 3CLQA 1PVEA 2L9SA 4MEYF 3TP0A 2JPAA 4DYQA 2YU5A 1X4PA 2P7VB 3ONQA 4D5CA 1HNXE 5KL4A 5FFZA 5B5EC 4M3EA 4GRIA 3V8LA 1AKHA 2Z16A 2OF7A 4WSGA 4LF7E 1EA3A 1OFCX 4M3DA 2KONA 2FBIA 4KT6A 1GHCA 4R2DA 4A5NA 2PLYA 2RREA 3LSTA 4L5IA 3HRSA 2KZVA 1BM9A 1LLMC 1W7PB 3U9GA 3LQQA 3J80Z 5GAGJ 2PMUA 3MZHA 1OCZH 2DA5A 5BPIA 3GFIA 3S14J 5FB2A 4GKKE 5F3WA 3JAMZ 2MC3A 2QENA 2E1MC 2JWOA 4R2AA 1MBEA 2R7OA 1N3GA 4F6MA 1WQ2A 3RYRA 1Z0XA 2JA8J 2VBXA 1MBHA 4KICA 1YE9A 3HSRA 4ZDPA 3WU2C 1UHWA 3HSFA 2MDGA 1XNQE 3LOCA 3CDHA 2ICWG 5L3EA 2M7BA 3OYAA 2EM0A 4IF4A 4DV5E 2H1KA 2B7TA 1MBGA 1TN9A 1X49A 2K4VA 3GFMA 1CF7B 2BY0A 2CUFA 2EN3A 5D5VB 5HS9A 2DMNA 3F8BA 5D8KB 1LDKB 5ILUA 3QP5A 5BOXA 4X66E 1IDYA 2H94A 2PMZN 4HNUA 3U1DA 4KA4A 2V1XA 4HW0A 3CCLI 4JI7E 2EMFA 2FV4B 1VQ9I 4NXNE 2X6OA 4DYRA 4MO7A 3EUHC 2DMIA 3PIOF 3J80C 3FM5A 1AAYA 4GKJE 4LFBE 1YIOA 4EJWA 4CYCB 1BW6A 4WF2A 1WHQA 1E3HA 1H88C 1VQ8I 3GTLJ 3M3YJ 2ZSIB 2E7WA 2NVUB 4A6DA 4I7HA 4A5MA 3OYJA 4IHYA 1IRFA 4XRSG 4B3XA 5FLXC 3HOSA 2IW5A 3H35A 1HW1A 1LVKA 5A6BD 2F6CA 2AS5F 2EE8A 5ICGA 3F6OA 5LGTA 3CJRB 3KP6A 1XCBA 3OOUA 5ED4A 4I99C 2IRFG 1QRYA 1F9NA 4XLFA 2EQ0A 1A1FA 2W48A 3HXLA 1MW7A 2Z1DA 2VC1A 3M7GA 5C4XJ 1VQPI 4HA8A 3ABTA 1VQ7I 3PO2J 3TO9A 1BI0A 4HV6A 2BY1A 4BUPA 4EGYA 2ENCA 1V54H 3LQRA 1A1HA 1L0OC 2L5QA 4CCJA 4A3JJ 3LSRA 5DNYA 1MMAA 3S8PA 1R4NB 2VKDA 3R61A 4DMIA 1IN4A 1HR0E 3LFUA 5FKLA 3TW6A 4A3CJ 1IRZA 1I94E 4QPOA 3CO6C 4G6QA 2XSJC 4XORA 4ON0A 1K4SA 1J5EE 2IS6A 3H5AA 5ADZA 2BYVE 2EPFA 2VXZA 5A69A 4B48A 1T6SA 1G3SA 2MD0A 3FK6A 1AOYA 1YTYA 3CUQA 2EH3A 2EA2A 2EPAA 4LGWA 1XCVA 4FX0A 3ECRA 3JU0A 4DR7E 3DKYA 3BDDA 1REPC 2PJRA 4HEA2 4UNOA 2WY7Q 2DXIA 2H36X 4C30A 4UXNA 4I2OA 4XOPA 3F6GA 2Y9YA 3I59B 1XMOE 5IWAE 1HBXG 3K4LA 3RI4A 2WC2A 4PJMA 2CT1A 2HS5A 1AHDP 1BL0A 4GCVA 1LDDA 2FNPA 4XKCA 4F3QA 3JTGA 2NOGA 1RRJA 4IX7A 2BHZA 4HOBA 3DTIA 3O6BB 4NQWB 4M71A 1QU3A 2D9HA 2M1SA 3MHHC 3VFZA 2VQHA 3E6DA 3F8CA 3K4MA 4LF8E 3FXUA 2XGEA 4CZZA 2LY9A 4G12A 2PI0A 1ERDA 2FGGA 4RH8A 5J4VA 1JUPA 3PQJA 2L3DA 3OYNA 1DU6A 3K69A 3OOPA 2GM4A 2N8XA 1A04A 1L3LA 2ELKA 1A1JA 1W5SA 1XDSA 3THOB 3S2HJ 2EZ6A 2GXGA 1Z67A 2YTJA 1EH7A 4B43A 2FSWA 3K9TA 2BB8A 4RAGA 2CSHA 3ZP5A 5GPCA 4ENNA 1FZPB 2IHR1 4P5OA 2EL4A 4XMYA 3OY9A 3B73A 1ZK8A 3C3WA 1TW2A 1X6FA 3HL2A 2B9DA 2MYSA 4BQNA 2CV1A 2NUEA 1MH3A 1IF1A 1MMGA 4EEFG 4NXME 1VFCA 5F0CA 4U7BA 1NK2P 2LBFB 3LNQA 1K79A 2K27A 2XF7A 4KNYA 4DV3E 3IL2A 3K2AA 1R4MB 1ZN2A 1Y8QB 2KKOA 2L4MA 4RLFA 1IQOA 3KEQA 2YS9A 5HOOA 3R60A 1WRJA 5J1UA 3WTVC 2CV0A 3R4KA 4DV6E 2L9VA 1JHFA 3AUZA 2K5CA 4QWQA 1QPIA 3DXJF 2CG4A 2O7OA 1R49A 2A25A 3PSIA 3HG9A 4MGRA 2LD5A 2WY8Q 5L3BA 1KQ8A 2OTJI 4BH9A 3JRIA 2CUZA 2EL6A 2EM2A 1D3YA 1SD4A 3ZQQA 2IGOA 2O0YA 3F0CA 2HOEA 2IA1A 4XOTA 2HPIA 2EA4A 3WU1B 2Z33A 4E7LA 2GWRA 3FXQA 2R1FA 2ELZA 5DD4A 4C3HJ 3WG9A 2EV0A 1Z1BA 3QAHA 2CGPA 1QZEA 1YOVB 5CQEA 3F6VA 2CV2A 1IO2A 4LFCE 1YYOA 1X47A 2L6MA 2IT0A 1Y1WJ 4UB6C 1IG7A 1O0WA 1IC8A 1X2MA 2F48A 3KE2A 3JRDA 2WBTA 3GW2A 4A3MJ 2QBYA 3OS0A 1I6HJ 2WAQA 5FLMJ 4W1UA 1T08B 5EEHA 4CHUA 4DNCA 1NEIA 1Y0NA 2I9IA 2GOXB 1MKMA 2CJJA 3MMYB 3PQKA 3JSOA 2O5RA 1XGMA 2GLOA 1MIJA 1LEBA 4AIDA 2HQAA 3I4NJ 1Y8RB 2IBDA 4NZVA 4AU7A 3HB9A 5HNFA 2D2WA 2M8EA 4UV8A 3S1MJ 1YYKA 4LF6E 2CS3A 3J80K 2BY3A 4LG3A 3MCZA 2H6BA 3DBRB 2XB0X 3OSFA 2O8KA 5E20A 2BW3B 2X6YA 1HLVA 2EM7A 2K9NA 2EPOA 4LB6B 2YSOA 2A05A 2WB1A 2F4OB 4R03A 2ZMEC 2M4KA 4IJAA 4UV9A 2K3PA 2V1DA 2BV6A 1T33A 3JRBA 4FASD 2VOOA 1X3UA 1N34E 4MFDA 3F8MA 4IL6C 1VQLI 2EOOA 3JTHA 4PJLA 4BE1A 1GXPA 1Q1HA 5FLXK 1E3PA 3DP7A 2L3JA 3HPSA 5GADJ 2XRNA 2JSCA 3K10A 1JJ8C 2YT4A 3I5UA 1LKXA 3HGYA 3HBLA 4E7HA 4X64E 5KL5A 3B02A 1OQYA 2DDBA 1Z6TA 1W7PA 1ODDA 2EZLA 1NHAA 3QQAA 5CVUA 2MD5A 3WTSC 1JGSA 5FLVA 1HKSA 2ISZA 1QPMA 1YZ9A 1EF4A 2CFXA 1TWFJ 2W85A 3EYYA 2R76A 5ILSA 4MLOA 1XN7A 1TTYA 1YW9A 3A0BC 3A2KA 3BC8A 4G7OF 5JVGF 3WTWC 2QSFX 3KCCA 1TWAJ 2XDVA 3E5UA 3IAM2 1X1BA 4M3FA 4BNCA 1Z3YA 2ECCA 2I10A 3IRRA 1X5WA 1BR1A 2AQEA 1L4SA 3M9AA 3PUBA 4A3GJ 2LE2A 5C4JJ 1KGSA 4IOAF 2JOBA 4JOMA 1YW8A 3I56I 1RNLA 2HKXA 2CWEA 2HU9A 4HYEA 1IJWC 2LY1A 4DQ2A 4HBLA 2VQCA 2AQFA 2GXAA 3J81Z 1JK1A 5C44J 3H0DA 3V8JA 1WI3A 5J8CA 4L0YB 5EZHA 5KK1A 1YYVA 3QG5C 1U8BA 2HHHE 1XMAA 1SMTA 5GP9A 3ZMDA 3H9GA 3S15J 2DQRA 3OYIA 2XRLA 2LF8A 2DBBA 4RM2A 4XLNF 3WODF 1NG6A 4CYCA 3S1QJ 2D1VA 3SHFA 2OAZA 1O4XA 1FY7A 4BEHB 1QHGA 1TWCJ 3CMEI 4C3IJ 4E7ZA 1IUFA 4IS1C 2UXDE 4M9ZA 4ESFA 1A1IA 1RUNA 1SD6A 3O8GA 1LEAA 1JUMA 3OYGA 1J75A 4V2FA 4LIUA 4F55A 3QPTA 2Z2SB 2HTJA 2L01A 5HVQC 2A6TA 1FOWA 2IJLA 1SANA 2OJED 4XLHA 1ETVA 3MEXA 1M1EB 2OBPA 2P5KA 3FMSA 1S7EA 3O2PE 1Z1DA 1MSFC 5E1WA 4G94A 2NS8A 1IQSA 4B44A 3MVPA 1XG1A 3SDBA 2EOEA 1WI9A 1K6OA 1B4AA 4II2A 2QM3A 4HF2A 3LMMA 1YSAC 5FKNA 1G59A 3L2WA 2WBUA 4DV0E 4JP0A 2VE8A 4OIOF 4M9XA 5FD5A 1FYLA 1BC8C 3EQ1A 3R0JA 1HDDC 2R5YB 3VYYA 3OYFA 3E7LA 4IRGA 1ZR9A 3A02A 3CTAA 4KFCA 1VQ4I 2HTSA 3ZMVA 1V4RA 4RS8A 5KVRA 4FCYA 4JI3E 1VQNI 1TQPA 2FMYA 3TMOA 3NWTA 2EOIA 1U5TC 4X0GA 4LB5A 2EN2A 1FP1D 2EB7A 1ZYRF 2BOLA 5LGNA 3E6BA 2HJJA 5AC5A 2FQ3A 1RESA 3GVAA 2EPPA 1UMQA 2XF6A 3BJAA 4PSXA 3NEUA 3UK3C 1AU7A 4QLCU 5F1JA 2R0QC 3IWBA 2R7RA 4EJUA 2KLOA 1ITYA 1PJSA 2M2EA 3FHNA 5IT9Z 3NARA 3PUFA 1TF6A 1FBQA 2JUGA 3K4NA 1POGA 3OR1C 3AG3H 4UUTA 2DRPA 2EM4A 4XLEA 2VBYA 2DOEA 3H3ZA 3K0LA 5HLIA 5DV5A 3FIGA 2EN4A 1FOYA 1IV6A 5K5RA 3I71A 3ZCOA 4P9UA 3FBNB 1KZHA 1HSTA 5E8IA 1YJNI 3I4MJ 5DM6F 4NQWA 5LD2C 3AL0C 2HZDA 1ETOA 2EOQA 3HOVJ 1VTNC 3H3UA 2CQKA 2XAUA 4Y7NJ 3QPHA 4GGGA 3PO3J 2F8BA 1HDPA 1OCRH 1FIAA 3C4TA 3K6GA 2N3GA 5LGUA 1IXCA 1R23A 2XC7A 2LYCA 1ONVA 4QIWN 5ICEA 1WH5A 4UVCA 3V4GA 1X4OA 1KYWA 1SFXA 1D1BA 1D0XA 3TBIA 2EPMX 1Z7LA 2YTFA 2W84A 5A6AA 3F21A 4IHSA 5L3GA 2EK5A 2BGCA 2LVHA 3ZQ7A 2CUEA 2PMHA 1W36C 1U6GA 4X62E 2P81A 3E1SA 3GUDA 2EOMA 2XPWA 1GV5A 3OR2C 2EV5A 2XPVA 2QQ8A 2ISYA 1TNSA 3PJRA 2XVCA 6PAXA 3F22A 1WJFA 5CPRB 2YRKA 2CO5A 1RR8C 4U0WA 1S3JA 1IN5A 4F54A 1Z3XA 1MJBA 4LK0F 4A0ZA 1WSUA 2NS0A 1I27A 3FXOA 5HLHA 3CCSI 3FXJA 2LBFA 2ZC2A 5B66C 3RIRA 2VQFE 1KU2A 3VODA 4PDKA 1NCSA 2F4MB 2TDXA 5LRRA 2ENAA 3VSKA 1TL8A 3UNGC 2M8GX 2L3CA 3D5SC 4OOGC 4R2PA 1QHHD 2M4GA 4KN4X 4HF1A 3K6QA 3L2QA 3PNTA 4HG2A 4MQVA 3VYSB 4D9JA 1V5FA 1HKQA 4XIDA 1U8RA 3HOXJ 3I0TA 1OCPA 4B09A 4Q4ZF 3EUAA 1BOBA 1F36A 3P9IA 5F27A 5EYRA 4P7DA 4LFAE 3HSEA 5D5WB 2ADRA 4ITVA 1ZQ3P 1P7IA 1R1VA 2LRDA 3ABMH 1MBFA 2BBYA 1MH4A 4XKWA 1GZ6A 5CJ9A 2M3AA 3J7Yp 4CH7A 2CSOA 2VQGA 3ZN1A 5E18F 3COAC 4MLVA 3KYLA 4IHTA 2JA5J 3ML6A 1VQMI 2DJNA 1RC9A 4P55A 3J7ZI 2DK5A 3HHHA 4E7IA 5HDGA 4EJVA 3HTSB 3JSPA 5A2QC 1T56A 1G3YA 4O5GA 4AYBA 2ME0A 1XPXA 1P4XA 4XKBA 1YPNA 4I0AA 4AD9A 3ADLA 1PUEE 5CVRA 3O8HA 2A5WA 2ZM6E 3RKYA 2V4JC 2MW8A 2E1MB 2E35A 3C7JA 2YTIA 5D4SA 2GPIA 3TQMA 5DCFA 3HC7A 4XN3A 1G3WA 4RA2A 4HX4A 3GYHX 2K4BA 1TZLA 4HV5A 3KZIC 2R7ZJ 4XKVA 2VQEE 3BQZA 2BW3A 5FKOA 1Y0UA 3S3OA 2PG4A 1ZU1A 3L2RA 2DDAA 4LIVA 4S0HB 3GZ5A 4Z6YA 5JHUA 3L00A 3GXOA 3V7RA 3FXLA 5EEAA 4RB3C 5M3FJ 1D8JA 2IS1A 2XASA 2K3FA 2DMPA 2G9WA 4LITA 3LSHA 2ZFUA 2IGMA 2FRHA 2KPMA 1F43A 4YFNF 2CFOA 1MMSA 2HDWA 2RNGA 3BP8A 4U0YA 2L0KA 2BZTA 3OYKA 3CCRI 4Q5SF 5IP9J 3K4KA 5EZGA 4GFBA 3QPLA 2GXBA 3BQYA 4BXUA 1X1DA 1BIAA 1S7AA 2DT5A 3T0YA 1B9MA 1KQ0A 2FUG2 2EMYA 1PJRA 2VE7C 2GAUA 1TWGJ 3EETA 3QYBA 3RMPA 2JSPA 2EIKH 3TO7A 4BE0A 4IJDA 4IQJA 2M45A 3BIDA 1PJTA 4E7SA 3RKXA 2E60A 3OSGA 2EOYA 3F6HA 1XGOA 4R2EA 2LUQA 2XAJA 3CCQI 3FM3A 1S5LC 2MH2A 5M5XJ 5IXMB 2W00A 2JPCA 2R93J 2ID6A 3QODA 2VT2A 4M6XA 4IHVA 2EFPA 1MMNA 2GZWA 3VYXA 4Y15A 2XAGA 3OIPA 4B1RA 1FP2A 3LMLA 3FKJA 3JRFA 3RTRA 2FBKA 2K9LA 4A69C 2OQRA 2KQRA 3DLAA 4G6TB 2E71A 3KEOA 3W3CA 2VBWA 4BJ5C 1UELB 4GZNC 3ZXSA 2EL5A 1A5JA 3M99B 4ENMA 4O4KA 4F92B 4EVIA 2EBIA 3DPTA 3HZJA 5DM7F 2WTEA 1E3OC 1UAAA 2ME6A 1QQIA 3N05A 4UB8C 2JXPA 1QNTA 2QLZA 4XK4A 2PFBA 5TJJA 3OYDA 2RV8A 2EP3A 2HXIA 3BR5A 3OWTA 4WSPA 4JV5E 3BT9A 5DUKA 3VK6A 4XLCA 4A6EA 2KDZA 1Y1VJ 5JVTA 4BEHA 2OU2A 1UG0A 1W36D 3BBGA 3WHCA 1LVAA 1P4AA 3WGGA 4DOZA 2PRTA 2K9MA 3D5RC 1W0UA 1PKPA 1BN5A 4BJ6C 4E7JA 1EJ9A 2GOMA 3IWZA 4BS9A 2WWYA 2ACJA 3DU5A 2Z9OA 4M3GA 4A0YA 1E17A 3WTZA 4AM3A 5GAHJ 3WGIA 3N4MA 2XB5A 3KP3A 4O5VA 3CCMI 3KLNA 1A35A 4BMJA 5TISC 4LLNA 2X51A 3SQNA 1X19A 4G7ZF 4B3SE 1N78A 5FKKA 2LG4A 2ESNA 4N4OB 1ZTRA 2VJ5A 2KISA 2ZXHA 3MWMA 3S93A 1B8IA 1BI2A 2F5CA 1YO5C 2V26A 1K4TA 1Z91A 2V7FA 2VC0A 1G2HA 3BJ6A 2R5ZB 2I13A 4B3TE 2R5YA 2DPDA 1TT0A 1WJPA 1MGTA 1CGPA 4ANJA 2EPRA 1IMUA 1R9TJ 5DYMA 2E2IJ 2WAQN 5BPDA 3JAMC 2R7FA 3QPSA 1YI2I 3K1PA 5ERIA 5LEKA 4ASNA 2RC4A 3E5XA 3C6MA 1ZREA 3IWCA 2QSHX 5L3FA 3T8RA 3ZQHA 1DGWY 5EDNA 1VQ6I 3LAPA 3CCJI 3W6VA 2COBA 2KL4A 4M0VA 1HW5A 2K9SA 2WB1N 5ILVA 3RZDJ 1IGNA 2DFIA 2LF7A 1APLC 4YELA 3V8KA 1SAXA 2LT7A 3AFHA 4J01A 3MZ8A 4LG0B 3EPLA 2A69F 2AXLA 3I54A 1UHZA 5A6BA 2MABA 1HQCA 3K1MA 2EPLX 2G0EA 1RKWA 3BOQA 3WTXC 5M3MJ 4ETSA 1YX3A 2MH9A 1P4WA 2K86A 2DJIA 5GTHC 3DQVC 4Y52J 4OMZA 2O03A 2EPZA 2W24A 4NNJA 1FWZA 3N97A 3KWRA 1YUIA 2QA4I 3S2DJ 4R2SA 4UVAA 3KLOA 4A2UA 4ZYGA 1LQ1A 5HDKA 5E3LA 1RPWA 3C6KA 2OTLI 3OYMA 3GO5A 2MKDA 3M4OJ 3BG5A 3H92A 1T39A 3GMEA 5A2QK 1IV8A 1ZAOA 1MNMC 3RSNA 2L4AA 5FD6A 3BTJA 1BBGA 2HI3A 3GF2A 4BGDA 5IP6A 1ZH5A 3A0HC 1FLIA 3FX3A 4IHXA 5F6FA 3C2GA 4ZC3A 4AIKA 2DLKA 1OCOH 1ZLJA 4ENJA 2EV6A 2DU9A 4XLAA 2EZIA 3GEZA 1JXSA 1Z6RA 5JLXA 1YYWA 2XAHA 3DBHB 3K4JA 4HSTA 2ZO4A 3TOAA 4XICA 1Z05A 2GIZA 1UB9A 3H9JA 5F04A 1TP4A 5LHIA 2DN0A 4WWCA 4N4RB 4KJZA 5HODA 2HPMA 3P1XA 2M9HA 1O57A 1WFXA 4I02A 4KIGA 3ZMZA 1LB2A 1X1PA 3DEWA 3FXRA 3E3VA 3PM1A 2ECBA 1JTXA 5EG0B 1ZKGA 3EDPA 2X9DA 4PJ0C 2EWLA 2KRCA 4FQGA 2XKOA 3U2RA 1U78A 5GTIC 5F08A 5K1YA 5F1RA 2FOKA 3FBIB 5GAEJ 3E6CC 4BC9A 1WHNA 4PCQA 1RR7A 1Z9CA 5ICCA 1FEXA 2VE9A 2BBGA 4RHBB 2GQQA 4OOIA 4CA0A 1OJLA 1OCCH 2ZXJA 2L7MP 1WVRA 4S04A 1XD7A 5FGMA 2FOWA 5ICFA 1QZYA 3SFZA 2IA0A 5BNGA 1SD5A 4HX7A 1JTYA 1ON1A 2LJHA 2QVOA 2NXNB 1K7AA 2W1OA 2E1NA 2ZMEB 4L9JA 2R7UA 4CCLA 2A5YB 5J1YA 4TV7A 1MEYC 4BBRJ 1S8NA 2VI6A 2YPNA 1UCRA 3VEPA 1H9TA 1P6RA 5KL3A 2L9NA 3BY6A 4XSZF 3CJNA 3CMAI 1IDZA 5TGTA 1R5ID 3FISA 4PZJA 3TW7A 2RS6A 1IRXA 1ETYA 4DR6E 4KMUX 3S1NJ 4I6ZA 2DTZA 4C9YA 4DR2E 1R6RA 3K7AJ 2VQLA 1X48A 2VASA 4RLQA 1VF9A 4LLGF 4HQEA 4WCGA 1UN6B 1Y56A 1WJBA 1S7OA 2IVMA 2FU4A 2JVGA 2WA0A 2VKHA 2QEXI 4KIFA 4EQQA 5CQGA 2O61A 4GYIA 1WXRA 2X48A 2JMWA 3P5JA 3AKZA 2UXXA 4BDZA 5TSEA 2YU8A 2E1MA 4C2UA 2EOXA 2XHKA 1H8AC 2KHXA 1XX5A 3GZNB 4D5FA 1WCMJ 4MLQA 1F1ZA 3OMLA 1IZ1A 2RTXA 3FIWA 2XGDA 4E70A 3J7AG 2JN6A 4A12A 2DCEA 2FD5A 2EIMH 1S6LA 3E97A 3BZ6A 3OMYA 1LJ9A 5GPAA 1USSA 3IUOA 2F5VA 1ETWA 2Q0OA 1SFEA 2HWVA 4A3DJ 4Z2YA 2XKPA 4HDUA 2HQ5A 1PUFB 4JI1E 3P7NA 1J59A 2VBZA 4RB0A 4PSWA 3A01B 3BGHA 3ADJA 1T95A 1T0FC 3TP3A 4OINF 3ADIA 1TT5B 1JKPC 4HRIA 5J3LA 1MNEA 1J9IA 2E72A 2YUSA 4RM3A 3L2CA 2HGCA 4Y17A 4NC7A 4UUSB 1XGSA 3EUHA 2EJ4A 2EMBA 3HOYJ 1ZG5A 4L8NA 2DT6A 2P7CB 5D8LB 4BHBA 4CCKA 1H89C 4M2ZA 1A36A 2EM5A 2R7TA 2Z99A 1LFBA 1ZGJA 2MBFA 3SJMA 4YHHE 4LF4E 2V1UA 2KJCA 1FOKA 4YRVA 4MHGA 4HDVA 2X1CA 3IRQA 2OC6A 2P4WA 3QYEA 2DA7A 4YG2F 3KP4A 1FPQA 1R5HA 3G1OA 3QOEA 2NOJB 4F6NA 5JI6A 2LTPA 3NWSA 3JAMK 5CVVA 3DWLE 2X6WA 3BF2A 2MC4A 4XONA 1NH3A 3GX4X 2EMLA 3I9V2 1HF0A 2JY9A 4AIHA 2NYXA 3DLLF 2EOSA 2EINH 3IWDA 1XSDA 2GLIA 5BMZA 1T4OA 1J09A 5IYCJ 2EORA 2V1NA 1K61A 3DKXA 3LA2A 4HQMA 3TGNA 1O7FA 4DBQA 5CFFE 3VYRB 1FBSA 1ULYA 2X85A 3ELKA 4ZYEA 4OMYA 2W7NA 5M5YJ 3F8FA 1FTZA 3W6JB 4RB1A 2EFQA 2E19A 2VRDA 1EKZA 3LFKA 1YJ9I 3K1NA 3O3KA 3H3VK 4WXHA 3GLXA 5LBQA 2LH9A 3FZVA 1FMWA 3OYLA 1WHUA 1R1TA 1B59A 5LFAA 3DFGA 1U5TB 2VF1A 2JK3A 1XMXA 3MQ0A 3EYIA 4M9VC 1MBJA 2ZB9A 2ZXIA 1LFPA 1RUOA 2L2NA 2A3SA
chains in the Genus database with same CATH topology
2VN2A 3EQLF 1IBKE 4DKKA 3TOBA 5L3DA 2MA3A 1ZBQA 2M5WA 2KIUA 2YX4A 2EFWA 4JI8E 2B3TB 3GFJA 3T8TA 4L9TA 1FYKA 3CO7C 2LRSA 5LHGA 4DV2E 4L18B 1JHHA 3WE3A 4KUMA 2DI3A 2L02A 3BJOA 2F2EA 3LA3A 4L0ZB 3DEUA 5DDGA 2DLLA 2G7HA 2M4IA 2E5LE 2BE5F 4KYWA 2KOUA 4X8WA 2E1CA 2G7UA 4CICA 4JI5E 4BYYA 2DTRA 2FMLA 2GIVA 2HYFA 4XRFA 2RGVA 3ROUA 5T6JA 4LG0A 4IRIA 2Q2EA 4JBAA 5K5OA 3ECOA 1B1BA 2FF4A 4DR3E 3CLOA 1H9GA 3J81C 2XV4S 3GWZA 4AQYE 5HS8A 3D5LA 3ECHA 1HXDA 1AWCA 4LF9E 1P2FA 2JPBA 1TBXA 3H09A 4R8HA 2QWWA 1IW7F 3BPXA 4CYDA 2B7VA 4D0PA 5CVJA 1FT9A 2PJPA 2A07F 2MDRA 1KQ9A 3KETA 5L3CA 2CW0F 1G6NA 4DUZE 4LU9A 4ZZLA 1XGNA 3KZYA 4MQ9F 4IPAA 2N3HA 4AVPA 1IRGA 3I58A 2PN6A 2Z5UA 2MC6A 4NHJA 4GO1A 4XBFA 3Q5FA 4GXOA 2P6SA 4TUGA 1TQIA 2D45A 5JFRA 2XGXA 1N36E 1I6XA 5CVIA 1OKRA 4Q48A 1ZHFA 1FSEA 5BQTA 2DK8A 1ZG1A 3F3XA 1J2XA 3HQ1A 2GA2A 4G8XA 2ZMEA 1T98A 2YR2A 4K2EA 2EFNA 5LRSA 1R1UA 2HDCA 2QQAA 1IBLE 5IT9C 1UHMA 1MJAA 3ZMSA 2H27A 1ZLKA 2X0LA 5AONA 3RJPA 1J5YA 5FO5A 3MZYA 1ZRFA 3PFIA 2OA4A 1ZRCA 4L5NC 1XSXA 1WKMA 5AE1A 1T4LB 4CGZA 1E2XA 3ULQB 2F5DA 3TDZC 4EV0A 3GZ6A 2FEZA 2YX7A 1S29A 1B6AA 2IP2A 1FC3A 4HF0A 2LSOA 4UHTA 5BR8E 3V7CA 1ZARA 4DV4E 4HZFA 3RPQA 4KDPA 4EJTA 3QU3A 1HSJA 2F5EA 2EWNA 1SR9A 2WV0A 2FNAA 2XIGA 2IPQX 4R1HA 2EFOA 3TQNA 2V8QB 4MNUA 3MFKA 4LJZF 4L9NA 4LFUA 3DKWA 2DIXA 1XSVA 1OMIA 1JE8A 5TRDA 4HX8A 4X65E 3JTZA 4I8OA 3QOPA 3FHZA 1T38A 4OX9E 5LMUE 3VB2A 1XMKA 4OU0A 4KZSA 4Y13A 3WTTC 1O3TA 3CUQC 2LTRA 3J81K 1H0MA 1U5TA 1GXQA 2F4VE 1O3SA 2QZ8A 1IXSB 4MTEA 4CXFA 4XLPF 3HOTA 1FKAE 2CYYA 2L92A 1G4DA 3KP5A 2Q8KA 3IWFA 2P6TA 1B9NA 2A68F 1DUXC 4JI0E 3E6MA 4ENKA 3CUOA 3OTOE 2YPRA 2NNYA 2K4JA 3J7AO 3HRMA 3IKVA 1KA8A 1FX7A 4GEQB 1J0RA 5DD8A 1BC7C 1KU7A 2DMYA 3DF6A 2OZUA 2RDPA 3C1DA 4CDGA 2HQNA 1U3EM 2PEXA 1STZA 2VODA 2JVAA 4B8XA 3HTXA 1UILA 3KP2A 2YSRA 3ZPLA 4B3ME 4RGSA 5HLGA 2V86A 3T1HE 1U2WA 1DPUA 5DCMB 2OQGA 1SFUA 2EJRA 4H0EA 1IN7A 4WXDA 5FLXZ 1RI7A 1W4MA 2DPUA 4ESBA 1BBYA 1DDNA 5IT9K 2Y75A 4JI4E 3AV0A 1PP8F 4JYAE 3ZMUA 2RKHA 2FBHA 2B0LA 1I5ZA 4A0XA 1C0WA 1G3TA 4HLXA 2DSYA 2JR1A 4KN7X 4JI2E 3C18A 1OYYA 4RGUA 2DB2A 2COMA 2XAFA 2V9VA 4F9CB 2RNJA 3L9FA 5AE3A 3M8FA 4WYQB 4I09A 1DI2A 2VOPA 1D8KA 2YZTA 3GFLA 1WWXA 1SD7A 2M30A 2UXNA 3T1YE 4M6YA 2UUCE 1BI1A 1OYIA 4Q47A 2FA5A 4BHCA 3M8EA 2PQ8A 5IT3A 2STTA 4NB5A 2DW4A 2RQPA 2ETHA 1UFMA 2O8XA 4R8OA 4P9FA 4BHPA 5JR3A 4WX9A 2M1BA 1XMQE 4M74A 2ZKZA 2C6YA 3TDUC 3Q9VA 1OYWA 1KU3A 1TQMA 3SZTA 1EH6A 4ZH4F 1O7LA 1ZBTA 4EM2A 4EGZA 2HYGD 3HIFA 2GA1A 3ERED 3QRFF 1SMYF 2H09A 1RC7A 1YS6A 1XDUA 4DR1E 4YY3E 2V85A 4JI6E 2A6EF 1O3QA 1K78B 1R7JA 4WPYA 4RGXA 2HFHA 2LBSB 3KP7A 1EH8A 4J8ZA 4R79A 1OPCA 3WTUC 1YW7A 1XB4A 5H20A 2W57A 2CPNA 3LLHA 2ODRC 5D5XB 5D4RA 4ZYDA 4B3RE 5K5QA 3D0SA 3M1EA 5DUIA 2KIMA 4KHPE 5E8GA 1FBUA 5DEQA 4XSXF 4BCAA 5CLSA 4I01A 4M72A 4RAZA 1DPRA 2K02A 5J8FA 4CO8A 1MJ9A 1R22A 4MEXF 2MC5A 1I1SA 2ZJ2A 2F5FA 4WFTA 1STUA 3I4PA 5H6RA 5FFXA 1GQEA 3WTYC 5HDNA 3FF5A 4EM0B 2H6CA 2NAZA 5BS6A 3T1BA 4G7HF 2DQLA 2HR3A 3MSWA 3REOA 2BEOA 1IN8A 2V88A 3HRUA 3DV8A 3HHGA 4I98B 2ZFWA 1RQ0A 3JW4A 1MDMB 5D6EA 4P96A 3L7WA 1EV7A 3WGHA 1HNZE 4YFXF 3ZOQB 3R6SA 2UU9E 4YIFA 2JTVA 2JT1A 4DUYE 2ZNZA 2NNNA 2M7QA 2JOXA 3TKYA 1QZZA 2QYOA 4UUVA 4P78A 1IN6A 3FMRA 1PP7U 4DR4E 2UWMA 3LWFA 4ZZDA 1R36A 3IHUA 2LMZA 1TLHB 3LA7A 2UZKA 5HS7A 5E17F 3C4BA 2O6GE 2V83A 2L2MA 5LMNE 1XNRE 1W7PD 2JZYA 1V3FA 1R5GA 4LTYA 2VT3A 2Y48A 5D5UB 3FMQA 2FXAA 1FYMA 2V79A 1I1GA 4F9AB 2Z3YA 5DCMA 1IBME 2ELHA 1BJAA 3RDIA 2W25A 5J6XA 1N32E 3DPLC 3KFWX 1QU6A 5E1XA 2K7LA 2QQ9A 2P5LC 1CF7A 4FT8A 1HKTA 3NQOA 4EM1A 2UXBE 2P5VA 3K2ZA 4OIRF 2XROA 2XUBA 4IVNA 5LLQA 3BPVA 2KJBA 4ZYHA 1ZRDA 1N33E 3IKTA 3I53A 1RZ4A 2ODRD 4L5JA 4N0BA 1PDNC 2ADUA 3NRVA 4I0BA 4YIIA 2JRTA 4RB2C 3HYIA 5LHHA 2FTXB 2NA2A 4K0KE 2X4HA 2NUFA 4AWXB 1IAWA 1F4KA 1FJGE 2ZCWA 4Q28A 4WXCA 2E7XA 4KT5C 2HQRA 3RYPA 3WU0A 1YS7A 3DF8A 3LAJA 1HNWE 3E5QA 2UXCE 2V89A 4BQAA 3F72A 3SZPA 4HLYA 1LNWA 3W6KB 4MTDA 2KRFA 2RN7A 1DQ3A 1QO0D 4N9HA 1HW2A 4WK8F 4FX4A 1ZG3A 2L54A 1USTA 4LF5E 4PGHA 4OIPF 2VONA 1T0FA 3HPZA 4BBYA 2HEOA 3L09A 1FNNA 3ZMTA 4KMFA 2L8TA 2WZOA 1J26A 3TO6A 3SXYA 3AAFA 2D1HA 2J5OA 3RKWA 5LL6R 1YG2A 1LDJA 3I59A 1YFHA 1YQAA 2V87A 1K78A 4M30A 3P9CA 2NRAC 1MZBA 3ISPA 1KU9A 2RVCA 3R0AA 3FWEA 2ESHA 3HTUA 2DO7A 4DV1E 3IC7A 1T2KA 3DJWA 2ZNYA 2R3SA 2RSMA 1T4NA 4DR5E 4N9IA 2OD5A 2FE3A 1Z7UA 2J5PA 3BWGA 4LK1F 3ABUA 4O6JA 2R7DA 4JQFA 4BC7A 3KZZA 3CUQB 4FHTA 4LD5A 5EEGA 1IUYA 4LLLA 1ZGAA 3BROA 5AE2A 2LTSA 2QUFA 4ESJA 5H6QA 2HKOA 4LMYA 4AIJA 1YLFA 5A2QZ 1BOAA 2UUAE 2YU3A 1GVJA 1TW3A 2P8TA 2MLGA 4EMSA 3OV8A 1J7KA 2MLKA 4IXAA 2UUBE 5AIPA 2A6HF 4S05A 2A61A 5AASA 4U88A 2DAOA 2OZ6A 2LKPA 1R00A 1DP7P 1BI3A 4YFKF 4G9YA 2ZBKA 3HRTA 1FSHA 1MDMA 4PGGA 4L9VA 1RIOH 1P92A 3ZN0A 3HUGA 2STWA 3T5XA 4U0VA 5D6FA 2NUGA 2V6CA 2O3FA 4TUIA 3F23A 2QQBA 4G6DA 2L33A 5CYVA 3S2WA 4O3MA 2HZTA 3ADGA 4F9BB 1QGPA 1D5VA 4F7ZA 4EJOA 3I64A 2L2KB 4UVBA 3MAJA 2RS7A 3QP6A 4M9SA 3P9KA 3V7SA 4KIBA 4M73A 3QU6A 4IRHA 3WE2A 3F8NA 2Y0MA 4JK1X 3Q9SA 2PBIA 2LUPB 3VOEA 2IA2A 3G3ZA 2XAQA 3RPUA 4RGRA 1W5TA 1TNTA 4U7DA 2QBYB 3G73A 1ON2A 1OR7A 4HAMA 5LEJA 1MD0A 1R58A 1IXRC 2M87A 2LNBA 1O3RA 5F64A 4GYGA 4RAYA 2LDUA 5AIQA 5E1ZB 1F5TA 1KYZA 2KIFA 4DV7E 1BIBA 4BAYA 4MEYF 2P7VB 1HNXE 5FFZA 3V8LA 4LF7E 2KONA 2FBIA 1GHCA 4A5NA 2PLYA 3LSTA 4L5IA 3HRSA 1BM9A 1W7PB 3U9GA 3LQQA 3J80Z 2PMUA 3MZHA 5BPIA 3GFIA 5FB2A 4GKKE 5F3WA 3JAMZ 2MC3A 2QENA 2JWOA 1WQ2A 3RYRA 2VBXA 4KICA 3HSRA 1UHWA 3HSFA 1XNQE 3CDHA 5L3EA 4IF4A 4DV5E 2B7TA 1X49A 2K4VA 3GFMA 1CF7B 5D5VB 5HS9A 3F8BA 5D8KB 1LDKB 5ILUA 3QP5A 5BOXA 4X66E 2H94A 3U1DA 4KA4A 2V1XA 4HW0A 4JI7E 2FV4B 4NXNE 3J80C 3FM5A 4GKJE 4LFBE 1YIOA 4EJWA 4WF2A 1WHQA 2E7WA 4A6DA 4I7HA 4A5MA 1IRFA 5FLXC 3HOSA 2IW5A 1HW1A 2AS5F 5ICGA 3F6OA 5LGTA 3KP6A 1XCBA 5ED4A 2IRFG 1F9NA 3HXLA 2VC1A 3M7GA 4HA8A 3ABTA 3TO9A 1BI0A 4HV6A 4EGYA 3LQRA 1L0OC 5DNYA 3R61A 4DMIA 1IN4A 1HR0E 1I94E 3CO6C 4G6QA 4ON0A 1J5EE 5ADZA 2BYVE 2VXZA 1T6SA 1G3SA 1AOYA 1YTYA 3CUQA 2EA2A 4LGWA 1XCVA 4FX0A 3JU0A 4DR7E 3BDDA 1REPC 4UNOA 2H36X 4UXNA 4I2OA 3F6GA 3I59B 1XMOE 5IWAE 1HBXG 3RI4A 2WC2A 2HS5A 4GCVA 1LDDA 2FNPA 3JTGA 4HOBA 3O6BB 4M71A 2M1SA 3VFZA 3E6DA 3F8CA 4LF8E 3FXUA 4CZZA 2PI0A 2FGGA 3PQJA 2L3DA 3K69A 3OOPA 1A04A 1L3LA 1W5SA 1XDSA 2EZ6A 2GXGA 1EH7A 2FSWA 3K9TA 3ZP5A 1FZPB 4ENNA 2IHR1 4P5OA 3B73A 3C3WA 1TW2A 2B9DA 2NUEA 1IF1A 4NXME 4U7BA 1K79A 2K27A 4KNYA 4DV3E 3IL2A 1ZN2A 2KKOA 2L4MA 3KEQA 5HOOA 3WTVC 3R60A 1WRJA 3R4KA 4DV6E 1JHFA 3AUZA 4QWQA 3DXJF 2CG4A 4MGRA 5L3BA 1KQ8A 4BH9A 1D3YA 1SD4A 2O0YA 2HOEA 2IA1A 2EA4A 3WU1B 2Z33A 2GWRA 3FXQA 5DD4A 3WG9A 2EV0A 3QAHA 2CGPA 3F6VA 4LFCE 1YYOA 1X47A 2L6MA 2IT0A 1O0WA 3KE2A 3GW2A 2QBYA 5EEHA 4CHUA 4DNCA 3PQKA 1MKMA 3JSOA 1XGMA 1LEBA 2D2WA 2M8EA 4UV8A 1YYKA 4LF6E 3J80K 3MCZA 2H6BA 5E20A 4LB6B 4R03A 4IJAA 4UV9A 2V1DA 2BV6A 2VOOA 1X3UA 1N34E 3F8MA 3JTHA 1GXPA 1Q1HA 5FLXK 3DP7A 2L3JA 3HPSA 2XRNA 2JSCA 2YT4A 3I5UA 4X64E 3B02A 1Z6TA 1W7PA 1ODDA 1NHAA 5CVUA 2MD5A 3WTSC 1JGSA 1HKSA 2ISZA 1QPMA 1YZ9A 2CFXA 3EYYA 2W85A 5ILSA 1XN7A 1TTYA 1YW9A 4G7OF 3WTWC 3KCCA 3E5UA 4BNCA 3IRRA 3M9AA 2LE2A 1KGSA 2JOBA 1YW8A 1RNLA 2HKXA 2CWEA 4HYEA 4DQ2A 4HBLA 3J81Z 3V8JA 5J8CA 4L0YB 5KK1A 1YYVA 2HHHE 1XMAA 1SMTA 3ZMDA 2DQRA 2LF8A 3WODF 2DBBA 4XLNF 2D1VA 3SHFA 2OAZA 1FY7A 2UXDE 4M9ZA 4ESFA 1RUNA 1SD6A 1LEAA 1J75A 3QPTA 2HTJA 2L01A 5HVQC 2IJLA 3MEXA 2OBPA 2P5KA 3FMSA 3O2PE 1Z1DA 5E1WA 4G94A 1WI9A 1K6OA 1B4AA 4HF2A 2QM3A 4DV0E 2VE8A 4OIOF 4M9XA 5FD5A 1FYLA 1BC8C 3R0JA 3VYYA 4IRGA 3CTAA 4KFCA 2HTSA 3ZMVA 1V4RA 4RS8A 5KVRA 4JI3E 1TQPA 2FMYA 1U5TC 4LB5A 1FP1D 2EB7A 1ZYRF 5LGNA 3E6BA 2FQ3A 3GVAA 3BJAA 3NEUA 4QLCU 3IWBA 4EJUA 5IT9Z 1FBQA 5HLIA 2VBYA 3K0LA 3H3ZA 5DV5A 3FIGA 5K5RA 3I71A 4P9UA 5E8IA 1HSTA 4NQWA 1VTNC 3H3UA 2CQKA 3C4TA 3QPHA 4GGGA 2F8BA 2N3GA 5LGUA 1IXCA 1R23A 1ONVA 5ICEA 4UVCA 3V4GA 1KYWA 1SFXA 2W84A 3F21A 4IHSA 5L3GA 2EK5A 2BGCA 3ZQ7A 2PMHA 1U6GA 4X62E 3GUDA 2EV5A 2ISYA 1TNSA 2XVCA 6PAXA 3F22A 2CO5A 4U0WA 1S3JA 1IN5A 4F54A 1MJBA 4LK0F 4A0ZA 1WSUA 2NS0A 1I27A 5HLHA 3RIRA 2VQFE 1KU2A 3VODA 4PDKA 2TDXA 5LRRA 2L3CA 4OOGC 4KN4X 4HF1A 3K6QA 4MQVA 1HKQA 1U8RA 3I0TA 4B09A 4Q4ZF 3P9IA 4P7DA 4LFAE 3HSEA 5D5WB 1R1VA 2BBYA 1GZ6A 5CJ9A 3J7Yp 2CSOA 3ZN1A 5E18F 3COAC 4IHTA 3ML6A 4P55A 2DK5A 3HHHA 5HDGA 4EJVA 3HTSB 3JSPA 5A2QC 1G3YA 1P4XA 4I0AA 4AD9A 3ADLA 1PUEE 5CVRA 2ZM6E 3RKYA 3C7JA 5D4SA 5DCFA 1G3WA 4HX4A 3GYHX 2K4BA 4HV5A 2VQEE 1Y0UA 2PG4A 3GZ5A 5JHUA 3L00A 3GXOA 3V7RA 4RB3C 1D8JA 2XASA 2G9WA 2FRHA 4YFNF 3BP8A 4U0YA 4Q5SF 2GXBA 4BXUA 1BIAA 1S7AA