2G7HA

Structure of an o6-methylguanine dna methyltransferase from methanococcus jannaschii (mj1529)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
167
structure length
167
Chain Sequence
MIIQIEEYFIGMIFKGNQLVRNTIPLRREEIFNFMDGEVVSNPEDEHLKVAEIILKLYFAEIDDKKVRELISYKLEVPEFTKKVLDIVKDIEFGKTLTYGDIAKKLNTSPRAVGMALKRNPLPLIIPCHRVVAKNSLGGYSYGLDKKKFILERERLNMVSFKFNKVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies of MJ1529, an O(6)-methylguanine-DNA methyltransferase
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
total genus 20
structure length 167
sequence length 167
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2006-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2g7hA02
3.30.160.460 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2g7hA01
2FMLA 4LD5A 1OPCA 3SHFA 1CF7B 3WG9A 1R36A 4G8XA 4DNCA 3J80Z 2AXLA 2M8EA 3SQNA 1ZGJA 1RZ4A 1MJ9A 1EH7A 4DQ2A 1FP2A 3QP5A 5LRSA 2FNAA 4A5NA 1HSTA 2IA0A 1S7AA 2JT1A 3ULQB 3ZPLA 5FO5A 2DK5A 4BNCA 3CTAA 2CG4A 5DCMB 2AS5F 2P6TA 5ED4A 2VN2A 3BJAA 1ZHFA 2O0YA 3R61A 1O3SA 3L7WA 1F4KA 3BPXA 2PMUA 1XD7A 4M9ZA 2QENA 4CHUA 5ERIA 3EQLF 3HOSA 2OZ6A 5HS9A 2Z33A 3E6DA 2B0LA 2L4AA 1XMKA 2JPBA 4GXOA 1H0MA 1ZG3A 4L9NA 1I1SA 3EETA 4YFKF 1BJAA 5ILSA 5IT9Z 2L02A 1IN7A 5ICGA 5KVRA 1JXSA 4ENMA 3IC7A 1DPRA 3VFZA 2BEOA 2A68F 1PP7U 5HVQC 3KP6A 2VODA 1SD5A 3I53A 5EEGA 2FRHA 1IF1A 2BE5F 3OV8A 2L3DA 2MH9A 3IWFA 5D8KB 4GYGA 1STZA 1IW7F 5LBQA 4D0PA 5F6FA 2YR2A 4XBFA 3LAJA 5BPIA 5E1ZB 3T5XA 4WXDA 2EWNA 2ZFWA 2OAZA 4ZZDA 3HRMA 2Q8KA 4WXCA 1U78A 1KQ9A 2K02A 2PBIA 4JQFA 3I64A 3MCZA 5E8IA 1S8NA 4HDUA 1YG2A 1OKRA 1OYIA 4LLLA 2UXNA 2ZNYA 3GWZA 1K78A 1QO0D 4KDPA 1KU9A 1IXCA 3GFLA 3JAMZ 3ISPA 5HDKA 2EFNA 4ESJA 1O57A 4AIHA 1B1BA 4Y13A 4YIFA 1K79A 2ZO4A 3J7AO 3HYIA 5HLIA 1GHCA 2XVCA 1U5TC 3T0YA 2HQNA 4QLCU 3TDUC 2FEZA 1G4DA 3EYIA 3JSOA 3DKWA 3MZYA 3D0SA 4L5IA 5DD4A 5D5VB 3WGHA 4L9JA 1PUEE 1FBQA 4HX4A 4YFXF 5JR3A 2R7FA 2UWMA 2DI3A 3M8EA 3F22A 5A2QZ 3LWFA 2HDCA 5H6QA 3HSEA 2KJBA 4HW0A 3WODF 4IHSA 4NB5A 4UUVA 4OMZA 2PQ8A 5BPDA 2LF8A 2E7XA 5L3DA 1MGTA 4A0YA 3I58A 4U88A 1YO5C 3Q9VA 1IN4A 2HFHA 1BIBA 2O6GE 4ZZLA 2F5CA 3F21A 3TQNA 3KFWX 4HA8A 2O03A 2JTVA 4WCGA 1C0WA 4B8XA 5D4RA 5LHGA 5FGMA 2DLLA 2EV0A 3REOA 1XDUA 4M74A 5FLXK 3C1DA 3NRVA 3QPTA 2DPDA 2UXXA 2EFWA 2LDUA 1RI7A 3L2CA 4A5MA 3FF5A 4ESFA 3EYYA 3WTYC 3HUGA 1XN7A 2NAZA 4AIJA 3H3ZA 4S04A 4S05A 3BZ6A 2FMYA 4XSZF 1G3TA 2FE3A 1P6RA 2LKPA 4EJOA 3EDPA 1EV7A 3QU6A 3IKVA 4Y17A 2FF4A 4WK8F 5LLQA 4KT5C 3JSPA 4P9UA 3FXQA 4CICA 3QOPA 1HKSA 1Z6TA 3JTHA 2RKHA 2W24A 1GXQA 5H6RA 4TV7A 1Z1DA 1XGNA 2DTRA 3IHUA 1S29A 1TQMA 1ODDA 2UZKA 4GGGA 3ZMTA 1FNNA 2KKOA 3KLOA 4KIBA 2EB7A 2ADUA 4LLGF 3E6BA 4RGUA 3O2PE 3IKTA 2MH2A 2XKOA 2DBBA 3KEOA 4XLNF 3K2ZA 3LA7A 2VBYA 2E1CA 4HLYA 2IW5A 4G6DA 2W85A 2GXGA 1RNLA 5F64A 1L3LA 4XRFA 1D3YA 2STTA 1UHMA 5J8CA 1P4XA 3MZHA 5LRRA 4MTEA 3BPVA 3RJPA 4HAMA 3FX3A 4FX4A 2VOOA 2XIGA 4EM1A 4U7DA 1HW5A 4ZYHA 4A6EA 2P4WA 3MWMA 3M8FA 3ZMUA 3P9KA 4ENJA 1SD7A 2FSWA 2VBZA 1FBSA 1ZG1A 1IRGA 1XMAA 1P2FA 2IJLA 3JAMK 1S3JA 2KIUA 3TO6A 3RTRA 3I59B 1ZGAA 1Z7UA 2VT2A 5DEQA 3RIRA 1TQPA 2H09A 1RUOA 3RI4A 2P5VA 2YU3A 4BHPA 4OMYA 3KP7A 1O3QA 1HBXG 2NS0A 2EV5A 1LQ1A 3WTXC 3IL2A 5LGTA 4CGZA 2COMA 5ILVA 1IXRC 5E1XA 3CLOA 2H6BA 3FHZA 5DV5A 2QUFA 1UB9A 3F6VA 1G6NA 5K5QA 2F5EA 1IN8A 3C18A 4KYWA 4LGWA 1BN5A 2L54A 3K1PA 3HHGA 5HS7A 1HW1A 2NNYA 2DQLA 5D5XB 2P7CB 1HKQA 4EJWA 4LK0F 2V1UA 2XKPA 4A6DA 2OQRA 3TOBA 4OIRF 4PDKA 2YX4A 3PQJA 4BYYA 1KGSA 3F8FA 1J7KA 3HTUA 5LHIA 3CO6C 1QNTA 1D5VA 2XASA 1FC3A 4LMYA 4GYIA 1XSXA 4QWQA 2DT5A 1T98A 1LB2A 3F8NA 2A3SA 1FZPB 4BQAA 3MEXA 5JVTA 5DUIA 1ZREA 4HX7A 3K1NA 5HLGA 2Q2EA 2W57A 3BROA 2K4BA 3R0JA 3FM5A 3GFIA 2XAJA 2RN7A 3P7NA 1W7PB 3E6CC 1IAWA 3SXYA 2JRTA 2NNNA 5D6EA 3Q9SA 2CQKA 1AWCA 2HYFA 3MAJA 1LDJA 3R4KA 1R23A 4EV0A 3BOQA 2HZTA 1GXPA 3ML6A 1RIOH 5CVVA 4A0ZA 4B09A 1YQAA 1TQIA 2DO7A 4IRGA 2FQ3A 1V4RA 5CVUA 3CUQB 1EH8A 1I1GA 2Y48A 4PZJA 1B59A 2ESHA 5LGNA 3FMQA 4HF1A 5LHHA 3F8MA 1U8RA 3FXUA 3GX4X 2M87A 3VOEA 1YLFA 2ZJ2A 2ISYA 3HOTA 3WGIA 2PMHA 3IRRA 4EQQA 1WWXA 2XROA 2XV4S 3KZZA 1FY7A 1KA8A 2PEXA 2QZ8A 3P9IA 2ZBKA 2GAUA 5LEJA 1V3FA 4LFUA 1HKTA 1OR7A 1AOYA 2HTJA 4ZYGA 3KZYA 3GLXA 5ICCA 3LAPA 2FNPA 3HRUA 3Q5FA 3TKYA 4ON0A 3LSTA 4RGRA 1KQ0A 2G7HA 1QZYA 2XUBA 1KU7A 1H9GA 3ELKA 2D2WA 1NHAA 1R5GA 3DPTA 3GFMA 5DCFA 3CUQC 1OMIA 3DV8A 1IRFA 4EJTA 3K9TA 5F1RA 3ROUA 1T6SA 2M30A 2MA3A 1U2WA 3RKXA 1USTA 5D5UB 1WRJA 1H9TA 2OQGA 3DQVC 2VT3A 1FSEA 2DW4A 2MLKA 2QBYB 1SD4A 3HHHA 4U0WA 3TGNA 4A12A 2EJRA 1R1VA 1LJ9A 2KIFA 3WTUC 1ZYRF 2GIVA 2V1XA 2L01A 2EA2A 1E17A 1ZN2A 5KK1A 3CDHA 1J0RA 4EGYA 2VXZA 3H3UA 1ZAOA 3F3XA 2A61A 3I5UA 4PGGA 1P4AA 3CO7C 2K4JA 2IA1A 2H27A 4HQMA 3ZMSA 2QQAA 4N0BA 5AIPA 4FX0A 5HDGA 5A2QK 5HLHA 4OIQF 4I2OA 3GZ5A 2QBYA 4I7HA 1UHWA 2JPCA 2RNJA 2QQ9A 1O3TA 2FU4A 4IRIA 1MD0A 5CVIA 3RPUA 2JZYA 2PI0A 3KP5A 1MJBA 2CO5A 2K86A 2KIMA 1U5TA 4XLPF 4IJAA 1ZRDA 4I98B 1K7AA 2NYXA 2OZUA 5DDGA 4HF2A 4Q4ZF 4MQ9F 3F72A 3V7SA 5D5WB 5ICEA 2XAFA 3WU0A 1W4MA 4IRHA 4LJZF 1F5TA 4NQWA 1SMTA 2P5LC 1ZRCA 4IXAA 4IVNA 5ICFA 5BS6A 3VEPA 2FOKA 2QLZA 1VTNC 1YS7A 4RGSA 1YYVA 2VONA 3V4GA 3ZQ7A 3U9GA 5CJ9A 3GEZA 3LQRA 3W6JB 2OD5A 2Z9OA 3WGGA 1Z6RA 4ENNA 2IP2A 3M9AA 3K1MA 4RAYA 1S6LA 3TO7A 1SD6A 5CYVA 3L9FA 2STWA 1J2XA 1QQIA 3WTSC 4UV9A 4Y15A 1UCRA 4YIIA 5BMZA 4MEYF 1XB4A 6PAXA 4G9YA 2OBPA 2CWEA 1B9MA 1IZ1A 3SZTA 4R79A 3RYRA 2QQBA 2EA4A 5K5RA 3KCCA 3J81K 2ELHA 4HV5A 4OINF 4I02A 4P55A 5H20A 3GZ6A 3FWEA 1FPQA 1KU2A 1I27A 3VODA 3QPHA 4OIPF 3ZN1A 4BXUA 1DP7P 2DPUA 2CSOA 3M1EA 5BOXA 3I54A 5HDNA 5D4SA 4AWXB 3R6SA 1RUNA 3BDDA 2RC4A 1B6AA 1S7OA 4KIFA 1R00A 3FMRA 1KYWA 1Z9CA 4PGHA 2EV6A 4P9FA 2IRFG 5J8FA 2LSOA 1BI3A 1DUXC 2ZMEA 1ULYA 4O6JA 4MTDA 5L3FA 5JHUA 4L9TA 2MBFA 2HGCA 3J80K 1WKMA 4WXHA 2VBXA 1REPC 2K7LA 3B02A 4AIKA 4G7OF 3WE2A 2CYYA 4KNYA 2W25A 3T8RA 3BP8A 3DEUA 1FLIA 4LB6B 3GXOA 3T8TA 1FOKA 1USSA 2PFBA 2V79A 4KN4X 3NQOA 3P9CA 2CW0F 2P7VB 1BC7C 3K69A 2IVMA 2NRAC 3WTZA 3J81Z 3F8CA 4OU0A 1R1UA 1LNWA 3R60A 4GCVA 3I4PA 1KQ8A 2D1VA 3WU1B 5JI6A 4M9XA 1T39A 4BH9A 3MQ0A 2RV8A 4AD9A 2VOPA 1CF7A 2FBIA 2ZNZA 4XSXF 1TLHB 2F5DA 1B9NA 1U5TB 4K2EA 3COAC 1ONVA 1P92A 2CGPA 2GA1A 2Z99A 4EJVA 2EK5A 1R58A 2P8TA 3ZMZA 4M6YA 2LF7A 1TTYA 4IPAA 3C7JA 4OOIA 4BAYA 5LEKA 1BBYA 3L00A 3FXRA 2RGVA 4R8HA 4CYDA 4MHGA 4YG2F 3T1BA 4ZYDA 3AAFA 1GVJA 1EH6A 3DF8A 2GA2A 2KRFA 4CZZA 2OU2A 3G3ZA 4EVIA 1LDKB 5HS8A 1IN6A 1Z05A 3ABTA 1PP8F 1BC8C 1J5YA 1QBJA 4KFCA 1MZBA 4G7ZF 1A04A 4IF4A 3S2WA 3E5XA 2R7DA 4EMSA 1QPMA 1BM9A 2ACJA 3F8BA 2XHKA 1ZG5A 4N9IA 5CVRA 2WWYA 5D6FA 5LGUA 4M73A 3WTTC 4UHTA 4I09A 2F5FA 1YIOA 4HLXA 2BGCA 3LA3A 2A5YB 3F6OA 1Y0UA 4LK1F 1K78B 1ZH5A 4L0YB 4L18B 2X0LA 4HBLA 3KP2A 4RGXA 3E5QA 5E20A 4KIGA 3ABUA 3BY6A 5EEHA 3PQKA 4ZYEA 1JGSA 1FYKA 2M45A 4F7ZA 1FWZA 2R3SA 2HKOA 1SAXA 3KP3A 4G94A 4LLNA 3TOAA 3FMSA 5FLXZ 2C6YA 4H0EA 3N97A 1B4AA 4RB1A 1TW3A 2VC1A 2ETHA 1T38A 2HQRA 3O3KA 5IT3A 2HYGD 1TBXA 2HEOA 2MD5A 1FYLA 4KA4A 2A07F 1Z91A 2M5WA 1ZRFA 2RDPA 5AIQA 2WC2A 2V9VA 3HSRA 4RS8A 1WQ2A 3JW4A 3N4MA 1HQCA 5CVJA 1W7PA 3GO5A 3FM3A 3LFKA 4JBAA 4UNOA 3R0AA 3GYHX 2FBKA 4Q48A 2Y75A 1BI1A 2D45A 1IXSB 5J6XA 3W6KB 4I0BA 4HZFA 2GQQA 1PDNC 5L3GA 1XGSA 4UV8A 2DQRA 5DD8A 4CO8A 1ZARA 1X3UA 3CJNA 3KLNA 1XGOA 1QGPA 4EJUA 4FHTA 3BJ6A 4HOBA 1YTYA 2K27A 1OYWA 5TJJA 1JHFA 2J5PA 3CUQA 1YS6A 3FZVA 2DFIA 4ESBA 2XAQA 3LQQA 1HXDA 1HSJA 2GXBA 5DUKA 5HOOA 1F9NA 1MDMB 1J59A 3M7GA 4E70A 2EFQA 1R22A 2Z5UA 4U7BA 1W7PD 3BWGA 2XAHA 4KN7X 3HIFA 4M9SA 2FA5A 3HRSA 2O61A 2WTEA 4Q47A 1UFMA 3RPQA 4ASNA 4UXNA 2P6SA 4HX8A 1KYZA 2ZKZA 2ZCWA 1F1ZA 5DYMA 5E17F 4Z2YA 3H92A 1KU3A 2LNBA 3I0TA 2DK8A 4BHBA 2BBYA 2F2EA 5D8LB 5E1WA 4UVCA 5ILUA 4L0ZB 4HDVA 4P96A 4ETSA 1R5HA 2EFPA 4RB2C 1SFUA 3SZPA 2Z3YA 1FP1D 2V6CA 2WV0A 1JE8A 2FXAA 2HOEA 2VC0A 2VE9A 1J9IA 4A2UA 3SFZA 3GUDA 1I5ZA 2DU9A 1P4WA 1LEBA 3KE2A 4GO1A 1YFHA 3O6BB 2HTSA 5DCMA 2EFOA 1YW9A 4YFNF 2ZXJA 2E7WA 4NHJA 1J75A 4L9VA 1U3EM 4MEXF 1O3RA 2ISZA 4P5OA 5E8GA 3MFKA 3GFJA 3RKWA 4G6QA 3ZP5A 2J5OA 1FT9A 2V1DA 3TO9A 2BV6A 2Q0OA 1WSUA 1IN5A 4BHCA 1SFEA 2YX7A 5TRDA 4EM0B 4JK1X 3IWZA 1W5TA 2MC3A 4M71A 1YW7A 1TNSA 5AONA 4WWCA 4MQVA 2PG4A 4HF0A 4LB5A 3EUHA 2XRNA 1FX7A 2PN6A 1R7JA 2RQPA 2A69F 3ECHA 3I71A 5L3EA 2XAGA 4O5VA 2G7UA 4AVPA 3E5UA 4IHTA 4I0AA 3ECOA 5FFXA 2TDXA 3I59A 3HRTA 1OYYA 2VE8A 3L09A 1I6XA 2CFXA 2A6EF 2HR3A 3E3VA 4EM2A 4UVAA 4I01A 5K5OA 3DFGA 1LVAA 4OIOF 1FBUA 1BI0A 3WTWC 4LG0A 5L3CA 5FB2A 1FYMA 4U0YA 3WE3A 2IPQX 3V7CA 3KP4A 3ERED 4FT8A 4G7HF 1LEAA 4CXFA 1XDSA 1MJAA 4KMFA 4R1HA 4KICA 1TW2A 4LG0B 4MNUA 4N9HA 4HV6A 2QVOA 1HW2A 3JTGA 2QM3A 2ESNA 2A6HF 4CDGA 1XSVA 1T2KA 1ON1A 1R1TA 3U2RA 1MKMA 1XCVA 5CLSA 3DXJF 2X4HA 2G9WA 3RYPA 3GVAA 3ZN0A 1BI2A 3V8LA 3BJOA 3GW2A 3V7RA 2IT0A 3HTSB 4L5JA 3ZMVA 3KETA 2OA4A 5E18F 4Q5SF 3U1DA 2HS5A 2H6CA 3OOPA 2YSRA 4KMUX 5L3BA 3C3WA 2E1NA 3RKYA 3E97A 1O7FA 2PJPA 2HKXA 3GF2A 2XGXA 2BYVE 1YW8A 1D8KA 2VBWA 3QP6A 2KJCA 3QAHA 1ON2A 3E6MA 1IUYA 3D5LA 5FD5A 2GWRA 4A0XA 3QRFF 1ZLKA 2L4MA 4U0VA 3IRQA 2D1HA 3F23A 4WF2A 2FBHA 5JFRA 1SMYF 1T0FA 4RB0A 5K1YA 2RVCA 1XCBA 4UVBA 3V8JA 3KEQA 2YPRA 2PLYA 3DPLC 1WI9A 3DP7A 1ZLJA 4MGRA 2HWVA 2W84A 3RDIA 5FFZA 1LDDA 3WTVC 1TNTA 4KUMA 4HQEA 4PCQA 4EGZA 4WX9A 3G73A 3VB2A 2O8XA 1SFXA 5FD6A 2QWWA 1CGPA 1D8JA 1JHHA 1O7LA 1W5SA 3HSFA 1U6GA 2IA2A 1QZZA 1G3YA 2M1BA 2P5KA 2MLGA 3PFIA 4HYEA 2O3FA 1XGMA 4ENKA 2QYOA 1DDNA 1BIAA 2DAOA 5BQTA 4M72A 4RAZA 1G3SA 1FSHA 1K6OA 5IT9K 1L0OC 2H94A 3TDZC 3QU3A 3B73A 2ZMEB 4O3MA 2JSCA 3ZMDA 1E2XA 2GZWA 4RB3C 3K0LA 1Q1HA 1BOAA 1DPUA 1XSDA 4M6XA 1MDMA 3V8KA 3NEUA 1G3WA 3LA2A 3CUOA 4ZH4F 2Y0MA
chains in the Genus database with same CATH superfamily
2FMLA 4LD5A 1OPCA 1HF0A 2KQRA 3SHFA 2WV1A 1CF7B 2HXIA 5FKLA 3LLHA 3WG9A 1R36A 1J09A 4G8XA 4DNCA 5IYDJ 3J80Z 2AXLA 4IO9F 2EMGA 2M8EA 2EMXA 4XRSA 3FDYA 2YSPA 2RREA 4PJ0C 3OR2C 3W6VA 2DB2A 3SQNA 1ZGJA 4PJMA 1RZ4A 1Y6IA 2K3FA 1MJ9A 5J47A 4F6NA 1EH7A 4DQ2A 3KYLA 2A25A 5B5EC 1FP2A 4LF8E 3ONQA 3QP5A 4B47A 5LRSA 4IX7A 2OUMA 2XSJC 2RPCA 2FNAA 4A5NA 5A6BA 1HSTA 4KWYA 4W97A 1OR7C 2LY1A 2IA0A 2K85A 1S7AA 2JT1A 2EPMX 3ULQB 3ZPLA 5FO5A 2DA2A 2DK5A 2RNGA 5IP6A 1RETA 3JRGA 4BNCA 2JR1A 1YUIA 3CTAA 3FISA 4XNFA 1MNMC 2CG4A 4Q28A 5DCMB 3OYNA 3IUOA 2AS5F 4CH7A 4IHVA 2P6TA 5ED4A 2EM4A 2VN2A 2JK3A 3BJAA 1ZHFA 2IGMA 2O0YA 3KIOA 3R61A 1O3SA 3L7WA 5B66C 1F4KA 3BPXA 4O43A 2QGUA 2PMUA 1QA6A 2JUCA 4DV3E 1XD7A 4M9ZA 1Y56A 1QU3A 2L33A 1UBDC 1I39A 2QENA 4CHUA 4JOMA 2K7IA 2M0CA 3HOZJ 5ERIA 3A03A 5LMUE 5KL7A 3EQLF 4IJDA 3HOSA 1Z77A 3CC7I 2NVTJ 2OZ6A 5HS9A 3A01B 2YPNA 1XNQE 1LE8B 2BXYA 2Z33A 3E6DA 2B0LA 2L4AA 3JCUC 1XMKA 2JPBA 4GXOA 2XAUA 4AC0A 4YHHE 1UG0A 2DN0A 1H0MA 3BR0A 1ZG3A 4L9NA 1I1SA 3EETA 4YFKF 1YPNA 1BJAA 4LOCA 3WHCA 4II2A 4HEIA 5ILSA 5IT9Z 2L02A 5TISC 1IN7A 5ICGA 4Y52J 3KEYA 5KVRA 1JXSA 4ENMA 3IC7A 1DPRA 3F0CA 3VFZA 2BEOA 4B3SE 2A68F 4LF5E 1NH3A 3ECRA 1PP7U 2B63J 1F43A 1WXRA 1WJBA 5HVQC 3KP6A 2VODA 1SD5A 4KZSA 3I53A 2XC7A 1FIAA 2EZIA 5EEGA 5A6JA 1YYWA 2FRHA 4ZTFA 5HLTA 5FKOA 1IF1A 2BE5F 4ITVA 1X48A 2XDVA 3OV8A 3CCLI 2L3DA 2MH9A 3IWFA 5D8KB 1HNWE 4GYGA 1STZA 2MGQA 1VFCA 1IW7F 5HNFA 3MZ8A 5LBQA 4D0PA 4L5NC 5DM7F 5F6FA 4OWRB 2YR2A 1IV6A 3EPHA 4XBFA 3LAJA 4PK4A 5BPIA 2YRHA 2VJIA 5E1ZB 2NVUB 3S14J 2FV4B 1BL0A 1DGCA 4I6ZA 4DBQA 3T5XA 4WXDA 2N3HA 2EWNA 2ZFWA 2OAZA 4ZZDA 1IG7A 3BG5A 3L2WA 3GTJJ 3HRMA 2Q8KA 4WXCA 2MFZA 1U78A 2M9AA 2I10A 1KQ9A 2L2MA 2K02A 4CYCB 4UUTA 2EIMH 2PBIA 2BXZA 4JQFA 4IQJA 3I64A 3MCZA 5C44J 2JN6A 5E8IA 3S2DJ 2EN7A 2WBSA 4RAFA 1S8NA 2VKEA 2L9RA 4HDUA 1YG2A 4JI4E 1OKRA 1OYIA 3A0HC 4LLLA 4OX9E 2DMUA 2UXNA 2L9VA 2ZNYA 3GWZA 1AKHA 3MN2A 3CP8A 1IRZA 2FOWA 1X2MA 5B1AH 1K78A 1PJSA 3JRCA 2XGCA 1UJ8A 2FJ1A 4YELA 4LU9A 2EMBA 1QO0D 4KDPA 2BW3B 1U8BA 2XF7A 1KU9A 5M5XJ 2GXAA 2CSHA 2EMKA 1IXCA 1BJZA 1DGWY 2IAIA 2QQ8A 4BDZA 2GOMA 1R71A 1TP4A 5KL2A 3GFLA 3JAMZ 3ISPA 5HDKA 2EFNA 4W1UA 4ESJA 1O57A 4AIHA 1JUPA 3E0JB 3AV0A 2L2OA 2FGGA 1ITYA 4JI2E 1B1BA 4Y13A 4BACA 4YIFA 1K79A 3K6QA 4AUXA 2EPRA 2JA5J 3PIOF 2E60A 2DOAA 3CMAI 2XGDA 2ZO4A 3ZR8X 2MKDA 4A3GJ 3J7AO 3HYIA 3TQMA 3K70D 2ICWG 5HLIA 1GHCA 1GQEA 4Q35B 2XVCA 1U5TC 3T0YA 5FRNA 4B3AA 2HQNA 1E3OC 4QLCU 3TDUC 4KJZA 2FEZA 2XSDC 1G4DA 2IGNA 5IXMB 5M3MJ 3EYIA 1UN6B 3JSOA 3DKWA 2EOFA 3OIOA 5CFFE 3MZYA 1CQTA 1QVUA 1TZLA 3BG9A 3D0SA 4L5IA 5DD4A 5D5VB 3WGHA 4L9JA 1PUEE 4RHBB 3Q3SA 5T6JA 2WB1N 1FBQA 3K4KA 3OYJA 3ZQLA 4HX4A 2EZLA 4YFXF 5JR3A 1YOVB 2R7FA 2UWMA 4F3QA 2DI3A 5AASA 1MMSA 3KPHA 2PJRA 4JI3E 1X6EA 3M8EA 3S32A 1YJ9I 3F22A 5A2QZ 3LWFA 1ZR4A 1RC7A 2HDCA 5H6QA 3HSEA 3OL4A 3EUAA 1WJAA 2KJBA 4HW0A 3WODF 4IHSA 4GKKE 4NB5A 4UUVA 4OMZA 2PQ8A 3CDLA 2E36A 4X0GA 2ODRC 2GLIA 3LMMA 5BPDA 2LF8A 2MD0A 2E7XA 2DODA 5L3DA 1MGTA 5EG0B 4A0YA 2HOAA 3MMYB 3I58A 3MHSC 4U88A 4D9JA 5IP9J 1YO5C 4A93J 4NNJA 3Q9VA 1IN4A 3HGYA 5JLXA 4X6AJ 2LRSA 2HFHA 1BIBA 2O6GE 4ZZLA 1JI8A 1BB8A 2F4IA 1V55H 2F5CA 5JHFA 4XN0A 4CCJA 3F21A 3ABKH 3TQNA 5E3MA 1QHGA 2QSHX 2LV2A 4ZC3A 3N05A 2LLKA 3V42A 4BQNA 2H8WA 3KFWX 4HA8A 2HC5A 4M3EA 4RM2A 2RAEA 2RSMA 2O03A 2JTVA 4AYBA 4WCGA 2BB8A 2CQXA 1SC7A 2NA2A 3ASOH 2EMAA 2LVHA 3VYSB 2VQGA 1C0WA 1VQ8I 4B8XA 2IEKA 3FK6A 5D4RA 5LHGA 5FGMA 5FROA 2DLLA 2EV0A 3REOA 1XDUA 2CJJA 4C3JJ 4M74A 4B1RA 2ZC2A 5FLXK 1HNZE 1VF9A 3C1DA 3NRVA 1YE9A 2EL6A 3BTCA 4M3BA 3FXJA 2DOEA 3HPHA 3QPTA 4PSXA 5J1UA 4A3LJ 3A02A 2DPDA 2L7ZA 2UXXA 3H0DA 2EFWA 2YTEA 1ZR2A 3LSHA 2DIXA 2LDUA 2B7VA 3M99B 4M3FA 3U1KA 2EORA 2LJHA 3ZQHA 1RI7A 1YX3A 2YU9J 3L2CA 4A5MA 1RESA 2OCEA 3JRBA 3FF5A 4ESFA 3CCVI 3ZGKA 4X62E 2LUPB 2JWTA 3EYYA 3HQ1A 3WTYC 3CCQI 2R7UA 4NXNE 2VJ4A 3HUGA 1XN7A 1U9NA 1H89C 3ABLH 1AA7A 3BTIA 1X3ZB 2NAZA 4AIJA 4BCAA 3H3ZA 5DNYA 4S04A 3S1NJ 3X2QH 4S05A 3BZ6A 2FMYA 4XSZF 1PJQA 4OOGC 1G3TA 1WZ2A 2FE3A 2MKNA 1P6RA 2LKPA 4EJOA 3EDPA 1EV7A 3BCAA 4ANJA 5J4VA 4BJ6C 2WBTA 4B3TE 3QU6A 2KDOA 3IKVA 2DSYA 4Y17A 1UHSA 1W0TA 5F0HA 3VYTB 3OYEA 4R2EA 2FF4A 5EGOB 4WK8F 3CCRI 5LLQA 4KT5C 4TUIA 3JSPA 4P9UA 1OQYA 3FXQA 4PUSA 4CICA 3S15J 5BNGA 3QOPA 1G8XA 1HKSA 3DU5A 2L92A 2AXTC 1Z6TA 3JTHA 1O4XA 4DV7E 2J7JA 2RKHA 2E2JJ 1H8AC 2W24A 3B6AA 1GXQA 3EUHC 2COBA 5H6RA 1VQOI 2LREA 4TV7A 2HNHA 4TUGA 3H35A 3JR9A 2KPMA 2RSIA 5EZHA 3T1YE 1R5ID 1Z1DA 3C2GA 3HTXA 2IBDA 1MNEA 1XGNA 3ZQGA 2R5ZA 3K4BA 5C4XJ 2DTRA 2WY7Q 5EDNA 3IHUA 1S29A 1GLNA 1TQMA 1ODDA 1BW5A 3QYEA 4FTHA 1J5EE 2UZKA 4GGGA 3EQ1A 5GTHC 1WJCA 3ZMTA 1FNNA 1VZ0A 4NDLA 4BBRJ 2DA3A 3FXMA 2KKOA 3KLOA 4KIBA 2EB7A 2BZTA 2ADUA 4LLGF 1N3GA 2EIKH 2EMHA 1GTKA 1B69A 3BZKA 3E6BA 4RGUA 1SAUA 3O2PE 3IKTA 2HPMA 2MH2A 2O9LA 1T4OA 4CZCA 3W3CA 2XKOA 3RSNA 2DBBA 2JUGA 1NG7A 3KEOA 4XLNF 3K2ZA 3LA7A 2MG4A 2VBYA 2E1CA 4HLYA 2LY2A 2ZXHA 3JTZA 1YYKA 2IW5A 5KHDA 3BR5A 1PVEA 4G6DA 1FMWA 2W85A 4IS1C 2GXGA 1EJ9A 1ACIA 1RNLA 5F64A 1L3LA 2EPAA 3PNVA 4ZDPA 2W82A 2CS3A 4XRFA 3S1MJ 1D3YA 2STTA 4JI5E 3FHNA 1UHMA 2KZVA 1WJDA 5J8CA 5IWAE 1P4XA 2V87A 4Y4RA 1SFOJ 3LSGA 2I5UA 3MZHA 5LRRA 3IWBA 4MTEA 3BPVA 3A0BC 2M9HA 3RJPA 2K5CA 4HAMA 2I9IA 2VKDA 3FX3A 1R49A 3GTOJ 4FX4A 1IBKE 2DA1A 3FKJA 2XIGA 4EM1A 4RDUA 4U7DA 2VOOA 1HW5A 2VJJA 2XB0X 1UG2A 1AKHB 2D5VA 2R4GA 2X6YA 2VPRA 3JRDA 1WJEA 4ZYHA 3FIGA 1PKPA 4A3CJ 4A6EA 4PFOA 2YTGA 2YTPA 2W00A 2P4WA 3ADGA 3MWMA 3M8FA 1TWFJ 3DEWA 1X2NA 3P9KA 3ZMUA 4ENJA 1SD7A 4DW6A 4LFBE 4DUYE 2FSWA 3Q0UA 2VBZA 2EWLA 1FBSA 1UZCA 3MVPA 1N75A 1ZG1A 1WJPA 3IP4B 1RC9A 2LK2A 1IRGA 4ABZA 1XMAA 1G59A 1VQ7I 1P2FA 2IJLA 3JAMK 1S3JA 4XN3A 1SR9A 2KIUA 3MKZA 4M0VA 2EMWA 3HPGA 3TO6A 1LE8A 5AC5A 3VSKA 3RTRA 3I59B 4IEJA 3WG7H 1ZGAA 4F93B 4IKFA 4A3JJ 2DYRH 1Z7UA 2VT2A 5DEQA 3RIRA 4FISA 1TQPA 1RKTA 2H09A 3OIQA 1RUOA 2TCTA 2IS6A 3J7Yp 3RI4A 4I76A 4DMIA 2P5VA 1YRNB 3IH3A 3F6HA 2YU3A 4HSTA 4BHPA 4OMYA 3KP7A 1O3QA 2EPUA 2MDGA 1HBXG 2NS0A 5J4YA 4BE2A 2EV5A 3NAUA 1BR4A 3WTXC 3IL2A 1LQ1A 5LGTA 4CGZA 3AUZA 2COMA 5ILVA 1PDAA 1IXRC 1JUSA 3DU6A 5E1XA 3HG9A 3CLOA 2MC5A 2H6BA 3FHZA 3M1CA 3OWTA 2EZKA 3I4MJ 5DV5A 2QUFA 1ZELA 3SEQA 3UK3C 1UB9A 3F6VA 1G6NA 4JI8E 3D5RC 5K5QA 2F5EA 1XNRE 1IN8A 3C18A 3S93A 5H2FC 2V4JC 4KYWA 1Z3YA 5A2QC 4R2SA 4LGWA 2X9DA 1VQ5I 3H1CA 1BN5A 2L54A 1RQ0A 3H9JA 2I8DA 3K1PA 1TL8A 3MD2A 4NBQA 3HHGA 5HS7A 1POGA 1HW1A 2NNYA 2DQLA 1YX5A 2VI6A 1ETVA 5D5XB 3HDDA 2P7CB 1HKQA 4EJWA 4DZJA 4KITB 4LK0F 2V1UA 2VJ5A 1YJWI 1T0FC 2XKPA 2HYJA 2K40A 2OQRA 4A6DA 4O24A 3TOBA 4OIRF 1V5FA 4PDKA 2YX4A 1IO2A 2R76A 3PQJA 2YTFA 4BYYA 1KGSA 3F8FA 1J7KA 3HTUA 4MLVA 5LHIA 2DFHA 3CO6C 2Y0SN 1XPXA 1QNTA 1VQNI 1D5VA 4M3DA 2XASA 1XMQE 1X47A 1VNDA 1FC3A 4LMYA 4GYIA 1XSXA 4NUBA 1W36C 1ZBQA 1I3QJ 2NOJB 4Y3OA 3LNQA 4A3EJ 3OIPA 5DS9A 2M7BA 2H1KA 4QWQA 2X6WA 2DYSH 2DT5A 2AQFA 1T98A 2EPFA 1LB2A 4X9JA 1BR1A 3F8NA 5IYBJ 2A3SA 5M5YJ 1FZPB 2GM4A 5AC4A 1TWAJ 3PJRA 3GBGA 2R5YB 5KCMA 4BQAA 3MEXA 5JVTA 2R7SA 5DUIA 1QPIA 2N8XA 1IBLE 5CQGA 1ZREA 4HX7A 3S1RJ 1D0XA 3K1NA 5HLGA 5KL3A 2Q2EA 2W57A 4BL0B 1X1PA 3BROA 5B1BH 3OYAA 2DRPA 2K4BA 2DMTA 3A4CA 4N4RB 3QPSA 3R0JA 3HUGB 1FOXA 1GV2A 3FM5A 2QSGX 2LR8A 1JGGA 4QTRA 2D9HA 2CU7A 4I8OA 2X1EA 1IQOA 3GFIA 4IOCF 2XAJA 4XLAA 2RN7A 3P7NA 2F4VE 1W5CC 1W7PB 2F4OB 3E6CC 1IAWA 1R4MB 3SXYA 1DP3A 2DA5A 2JRTA 3HC7A 2NNNA 1VQ4I 3PIPF 5D6EA 2WBMA 3OL3A 3Q9SA 2CQKA 2LY9A 1AWCA 2HYFA 3MAJA 2YRKA 1LDJA 4JYKA 5A6KA 3R4KA 3RZOJ 1R23A 1ORKA 1P7IA 4EV0A 3BOQA 4XKCA 3IV5A 1WH5A 2HZTA 1GXPA 4AM3A 3ML6A 1X1AA 1RIOH 1B8IB 2R7XA 2E1OA 1ETQA 3HPZA 5CVVA 4DR1E 3G1MA 3G1OA 3I55I 1Y8RB 4A0ZA 1HDPA 2ENAA 3VHTB 5TGTA 1N25A 1L4SA 3J80C 3FBNB 4B09A 2YRMA 2CUJA 4XKBA 4IL6C 1YQAA 1TQIA 2DO7A 2DMNA 2EM6A 1HNXE 4IRGA 1IBME 2FQ3A 4BY7J 2IS1A 1V4RA 2ID3A 1GZ6A 4H4KC 5CVUA 3CUQB 3ZOQB 2DJIA 3H5RA 4PFPA 1TN9A 2L7KA 3GMEA 1EH8A 1I1GA 2Y48A 2X6XA 4PZJA 1B59A 2ESHA 5LGNA 3FMQA 4J00A 4HF1A 1TC3C 4P1WA 5LHHA 2JOXA 3F8MA 1U8RA 2A6TA 2CUZA 3FXUA 3GX4X 1MMNA 2M87A 4JYAE 3MKWB 3VOEA 1YLFA 2ZJ2A 2ISYA 2ECBA 2IGOA 3HOTA 4J8ZA 3WGIA 4NHRA 2PMHA 2KDZA 2LE2A 1WHUA 3IRRA 2X48A 5DTDA 1QRYA 1IMUA 3S17J 3LFUA 4EQQA 1WWXA 2XROA 2XV4S 3KZZA 1FY7A 1KA8A 2PEXA 2EQ3A 1TF3A 1RR8C 2QZ8A 2AO9A 2LYCA 3P9IA 3RQIA 2ZBKA 2GAUA 5LEJA 4JI1E 1V3FA 3CJTB 3SJMA 2K9QA 4LFUA 1HKTA 1OR7A 3LOCA 1QHHD 4CCKA 1AOYA 2HTJA 2UUZA 4ZYGA 4IOAF 5F3WA 3GZNB 1RKWA 1X5WA 2EILH 3KZYA 3QOEA 3GLXA 1X4OA 2B7TA 3ABMH 2E1MC 2DCEA 5ICCA 3LAPA 2FNPA 2HZDA 3HRUA 1IRXA 4G12A 3Q5FA 3TKYA 4ON0A 3THNA 3LSTA 4RGRA 3BG7A 1KQ0A 5E3NA 4R2DA 4R2QA 2G7HA 1QZYA 2K9MA 3OS0A 2XUBA 1KU7A 1Z67A 1H9GA 3ELKA 2D2WA 1NHAA 3DPTA 1R5GA 3GFMA 2NS7A 1MMAA 5DCFA 4E7HA 2Z16A 1MW7A 2K9NA 3CUQC 1LPQA 2LJUA 1OMIA 2HVSA 2KRHA 2F8BA 3DV8A 1IRFA 4EJTA 2M4IA 1Y0NA 3K9TA 5F1RA 3ROUA 4DYCA 1T6SA 4RLFA 2M30A 2NVQJ 3CC4I 5AE1A 2WBUA 3OTOE 2MA3A 1U2WA 3RKXA 1KONA 1USTA 3E1SA 2CTDA 5HODA 5D5UB 4F54A 2IS2A 1JKOC 1WRJA 1H9TA 3UR3C 2OQGA 2EM7A 5AE2A 2PMZA 3H36A 3DQVC 3UKGA 3IWDA 2VT3A 1D1CA 1HCRA 1FSEA 2ZJPF 2DW4A 3BT9A 1WJ5A 3BR6A 1HDDC 2EMCA 2YU8A 3HKZN 4ZDOA 4MFEA 2MLKA 2QBYB 4F55A 5GTIC 2QKLB 1SD4A 2ID6A 1MEYC 2FTXB 3J7YJ 2JSPA 2LKXA 2KT0A 3HHHA 4U0WA 2LVSA 3TGNA 4A12A 2EJRA 1OJLA 3GTKJ 1R1VA 4LG3A 5LD2C 1A1JA 2NOGA 1ETWA 2W1OA 4NXME 1LJ9A 2KIFA 3WTUC 1ZYRF 3OYDA 5HNHA 4F9BB 2GIVA 1FOYA 2V85A 2V1XA 4UY8I 1MBJA 2L01A 2EA2A 1E17A 3SDBA 2LKSA 3H0GJ 4UB6C 2V6EA 4FCYA 4KHPE 2R7TA 5F0FA 4R2AA 2KMUA 1ZN2A 5KK1A 3CDHA 1J0RA 4EGYA 3AL0C 2VXZA 3H3UA 5C4JJ 1DQ3A 4BBSJ 2WAEA 1X3CA 2DA4A 1Y1VJ 4V2FA 1ZAOA 3F3XA 3H5AA 5FKMA 2V8QB 4FK5C 2A61A 3E7LA 2EOEA 4WSGA 3DWLE 3HB9A 3I5UA 1WHNA 3SFIA 4PGGA 4QPQA 4BU2A 4G6TB 3HOVJ 4MFDA 5EEAA 1P4AA 1W0UA 3A01A 2DDAA 3CO7C 2K4JA 4XMYA 2IA1A 3VYUB 2V88A 2H27A 4HQMA 3ZCOA 3ZMSA 2QQAA 3CCYA 3PFYA 4N0BA 5AIPA 3SDGA 1N77A 4L5EA 4FX0A 3LMLA 5HDGA 5LMNE 5A2QK 2Y31A 3CJQB 1MBEA 1WVRA 3SYTA 5HLHA 4OIQF 1OCRH 4I2OA 2K9LA 2EPLX 1WI3A 2IHR1 3GZ5A 4X64E 1P9QC 4JI6E 5M5WJ 2OCCH 4BKXA 2F5VA 2HI3A 3TW6A 3J7AY 1K4TA 2QBYA 5TSEA 5FLXC 4DOZA 4I7HA 3OYHA 1GT0C 2NVXJ 5IV8B 1UHWA 2JPCA 2TRTA 2RNJA 2EPOA 2QQ9A 1O3TA 2FU4A 4IRIA 1QZEA 4JX4A 2HDDA 3VWBA 1MD0A 5E3OA 2JA8J 5CVIA 3RPUA 1S7EA 2B7EA 1UELB 2JZYA 2BOLA 2OTJI 4WSPA 2OJED 2X1DA 1SEUA 2DLKA 4I99C 2PI0A 2ENHA 2RS7A 4DUZE 2E1MB 3KP5A 3BGHA 1Y1WJ 4BE0A 2Q1ZB 2VKHA 3M3YJ 5IP7J 1MJBA 3IH2A 2CO5A 4OAZA 3QYFA 2K86A 2KIMA 2ZFUA 3QWLA 4BBYA 1U5TA 1S72I 4XLPF 4IJAA 1ZRDA 2R7QA 4I98B 1K7AA 4PJLA 2NYXA 2CW7A 3K4JA 2EN6A 2EMYA 3TP0A 2OZUA 2RQLA 5DDGA 4EATA 2LUQA 2LD5A 4AYBN 2LTPA 4HF2A 4RLQA 2JMWA 4XK4A 4Q4ZF 2R7WA 4MQ9F 2YSOA 3F72A 3V7SA 5D5WB 2JP9A 4ZJZA 2EN1A 3TEDA 5ICEA 2XAFA 3WU0A 2CPNA 2HQ5A 3C2HA 4O5GA 3LSPA 1W4MA 4IRHA 3RCOA 4HTGA 1E3HA 4LJZF 3I56I 1F5TA 4NQWA 1SMTA 4QIWN 2P5LC 2EMIA 3OMLA 3M07A 3L1PA 5LFAA 1ZRCA 2XF5A 4IXAA 1W1WE 2JXPA 1FEXA 4R03A 4MLOA 2MC4A 4IVNA 5ICFA 5BS6A 3VEPA 3ADLA 2FOKA 2R93J 2WAQA 2QLZA 2DJNA 3PL8A 4YIRX 4X8WA 2E71A 4Z6YA 3GTPJ 2BW3A 3BCBA 1VTNC 2YZTA 2EQ0A 1YS7A 4RGSA 1YYVA 2CW8A 3PNYA 3V4GA 2VONA 3ZQ7A 2EMFA 2E5LE 5K7ZA 2NUGA 2WADA 3U9GA 4A3FJ 2NS8A 4BMJA 2BY2A 3D5SC 4IHXA 3AG1H 3BBGA 2DGCA 4LIVA 5CJ9A 3AFHA 3GEZA 2CRGA 3LSKA 2M1SA 3IAM2 3LQRA 4DR5E 3W6JB 1LKXA 1UMQA 2OD5A 1MBHA 2KFDA 2XPVA 5F04A 2FUG2 2EOOA 3FXKA 1Z6RA 4NC8A 4N4NB 3WGGA 4ENNA 4ZTJA 2IP2A 2GLOA 2Z9OA 4M6VA 4XICA 2NABA 3M9AA 3K1MA 1GDTA 2IXSA 2NUEA 3K4MA 4RAYA 3W2VA 1X58A 1S6LA 4DR2E 3TO7A 1SD6A 2EM8A 1NG6A 1MBKA 5CYVA 3L9FA 1X19A 3I9V2 1WCMJ 3KYCB 2STWA 1ZTRA 1J2XA 1QQIA 4F52A 3PSIA 4UV9A 3AG3H 4Y15A 3WTSC 2ZM6E 1UCRA 4RA2A 4A3KJ 2UXBE 1X1BA 4YIIA 2YU5A 5BMZA 1ERDA 4MEYF 1XB4A 6PAXA 1KZHA 4GDFA 4G9YA 5KAFC 1MMDA 2OBPA 4GRIA 2E72A 2CWEA 2EQRA 3S8PA 2EOJA 3NWSA 2GIZA 1B9MA 4A3IJ 1IZ1A 3IH4A 2QCOA 3QODA 4XIDA 2MC6A 3CJRB 2LFBA 3SZTA 4R79A 4UUSA 4LTYA 4MLQA 5AE3A 2YS9A 5FKNA 3RYRA 2QQBA 4BEHA 3CMMA 2NVYJ 2EA4A 4NC6A 2P81A 2EOZA 2E2IJ 4D7MA 3KCCA 5K5RA 3J81K 2ELHA 2EL4A 4HV5A 4OINF 4I02A 4P55A 5H20A 3GZ6A 3FWEA 4V2GA 4DR3E 1FPQA 1KU2A 1OISA 1I27A 3VODA 1OFCX 3MKLA 3QPHA 4OIPF 2EPCA 4DR7E 2HDWA 1YRNA 3DLAA 3ZN1A 1VQKI 4BXUA 1DP7P 2DPUA 1FKAE 4GKJE 4DGWB 1X1CA 2GOXB 3C2BA 2OF7A 2CSOA 4WYQB 4AQYE 2LG4A 3M1EA 5BOXA 3I54A 5HDNA 5D4SA 2JYAA 3ZXSA 2HXOA 4QSHA 4AWXB 4HG2A 3R6SA 2DMQA 1RUNA 3BDDA 2RC4A 1LLMC 1FJGE 1B6AA 1JT6A 1DU0A 3ADIA 1HOMA 2V9PA 3TBIA 2QEXI 4DV0E 1S7OA 4FQGA 1JTXA 4KIFA 1S9HA 1T95A 1R00A 1EKZA 2A5WA 2X51A 3AG2H 3FMRA 2V89A 4QPOA 1KYWA 1Z9CA 3J81C 2E5ZA 4PGHA 4BJ5C 2EV6A 3RPUD 4P9FA 2IRFG 3BQYA 5J8FA 2M34A 2EBIA 1STUA 5KL4A 1A36A 4BJTA 1LUJB 5KL6A 3JRAA 2LSOA 4LF4E 1E0EA 1BI3A 3SZGA 3U21A 3RZDJ 4DJAA 4UUSB 2ZMEA 1HLVA 1DUXC 2HGHA 1ULYA 2N8GA 4O6JA 4MTDA 2V9KA 5L3FA 5EG0A 2BHZA 1A6IA 5JHUA 4L9TA 2MBFA 2ZB9A 2HGCA 4B4CA 3J80K 1WKMA 3DJWA 4WXHA 2VBXA 4WFTA 5E3LA 3G6EI 4HRIA 2ENCA 1REPC 3EPKA 4B3ME 2K7LA 1R9TJ 3B02A 3H5NA 4JP0A 4AIKA 4NZVA 5EJCA 4G7OF 1V54H 3WE2A 2YWQA 2YTIA 2CYYA 4KNYA 5KAIC 2WCC3 2W25A 2ELKA 2DMYA 1TWCJ 2VF1A 3T8RA 3BP8A 2F4MB 3DEUA 1FLIA 4LB6B 3GXOA 4PJJA 3T8TA 3OYBA 1FOKA 3JU0A 3M8JA 1USSA 2PFBA 4F9AB 4BXXJ 1V5EA 2V79A 4KN4X 4LF6E 3NQOA 4D1QA 3HJEA 3P9CA 3OMYA 4AU7A 1JKPC 2CW0F 3F9KA 2P7VB 1BC7C 1A1LA 4YEJA 3K69A 1JJ6C 2E2HJ 2IVMA 1Y39A 2VB6A 2EM0A 5EZGA 2NRAC 4JX6A 1GV5A 4F2JC 3WTZA 2JY9A 2V1NA 2R7OA 3LSJA 3J81Z 3ZQFA 3F8CA 4M30A 2MSYA 2CUFA 1HC8A 4OU0A 1R1UA 3K6GA 1LNWA 1X49A 1A1KA 1U9OA 3R60A 4XLCA 1D0ZA 1M1EB 4GCVA 3NARA 2VQHA 2CUEA 4RM3A 3OS1A 4XQFA 3I4PA 5FKKA 3HOWJ 1KQ8A 2D1VA 3WU1B 4BXFA 3S3NA 5IY5H 1RMDA 2UU9E 2EH3A 5JI6A 4M9XA 1X6FA 4BH9A 1T39A 1MH4A 4L8NA 3MQ0A 2RV8A 3ERMA 4AD9A 1ENHA 1OLTA 2X6OA 2EOIA 2ZJRF 2VOPA 1FIPA 1CF7A 2FBIA 4JI7E 2ZNZA 2ME6A 1NK3P 3OS2A 4XSXF 1TLHB 2F5DA 4LITA 2G0EA 3K10A 1SVLA 2EIJH 4C9YA 4CSWA 2UUAE 1B9NA 3S1QJ 1U5TB 4K2EA 4X1EA 4XORA 3HGGA 3CMYA 2HPIA 1DGRM 4RBOA 3ZOBA 1B8IA 2EJ4A 2LTSA 2UXCE 3COAC 1ONVA 2BBGA 2Y30A 3MKYB 2L7MP 3PSFA 3M4OJ 3H09A 4BGDA 1A1GA 3DBLB 1T33A 3H3VK 1P92A 2DTZA 2WA0A 2VIXA 2CGPA 2CMPA 2GA1A 5J40A 3FBIB 4BUPA 1B72B 2Z99A 4R2RA 1YHQI 4EJVA 2EK5A 1R58A 2P8TA 2KIQA 3ZMZA 4M6YA 4E7SA 2LF7A 5LL6R 1TTYA 3IWCA 1SVOA 1F2IG 4O4KA 4IPAA 3C7JA 4OOIA 4BAYA 5LEKA 1BBYA 1XC5A 2L0KA 2JOBA 3JRFA 2EOYA 2EOHA 3L00A 4XKVA 3FXRA 2RGVA 3K4LA 4R8HA 4CYDA 4MHGA 4YG2F 3P5JA 1ETXA 1VQLI 2BY3A 4DR6E 3RMPA 1YYOA 1HR0E 4CA0A 3T1BA 4ZYDA 3AAFA 1GVJA 2PRTA 1EH6A 3DF8A 4N4OB 2W7NA 4E7IA 2GA2A 2YUSA 5FRMA 4WPYA 1JKQC 1BBGA 2KRFA 4CZZA 2OU2A 5CPRB 3G3ZA 4EVIA 1ZGWA 1LDKB 2O7OA 2EN2A 5HS8A 2JVHA 3JAMC 3EPJA 1T08B 1IN6A 1Z05A 4XL9A 2YTOA 3ABTA 3J7AG 1PP8F 1BC8C 1J5YA 2QKMB 1LVKA 2KONA 1QBJA 4KFCA 1MZBA 1YIJI 4G7ZF 1FTZA 1A04A 4IHYA 5A6AA 2OPTA 3BF2A 4CYCA 3O8GA 4A69C 4IF4A 3S2WA 2W4SA 4F92B 1PYVA 3E5XA 2R7DA 4EMSA 4C2TA 4E7ZA 1T56A 4XRMA 4E7LA 5BR8E 1QPMA 1BM9A 2ACJA 3F8BA 2XHKA 3BC8A 1ZG5A 4N9IA 5CVRA 1Y8QB 2WWYA 1S5LC 5D6FA 5LGUA 4M73A 1WGXA 3WTTC 3HPSA 4UHTA 4I09A 3Q0WA 3AKZA 2F5FA 4F9CB 1YIOA 4HLXA 1T4LB 4C2UA 3QYBA 5FJ8J 2LCEA 3VYRB 1HA8A 1N78A 2BGCA 2DA7A 1IDYA 1I6HJ 1OCZH 3LA3A 4MO7A 4XKWA 2A5YB 3QG5C 3F6OA 3S16J 4B43A 1A1HA 1Y0UA 2ZSHB 5GADJ 4LK1F 2EMLA 2VUMJ 4B48A 1Q1VA 1K78B 4DV1E 2JJ7A 2M8GX 1ZH5A 1IV8A 4L0YB 4L18B 2X0LA 4HBLA 3KP2A 4RGXA 3E5QA 4B44A 4DR4E 1OCCH 3ZQQA 4K0KE 5E20A 3PNTA 4KIGA 1JJ8C 1ZQ3P 3ABUA 2DXIA 5K7HA 2KL4A 4XONA 3BY6A 2K3PA 3KYDB 5EEHA 3PQKA 4CCOA 4ZYEA 1JGSA 2DMIA 3NWTA 1FYKA 4HPQA 3BQZA 2KISA 5CKTA 3HOXJ 2EINH 2CV0A 4E4HA 2M45A 4F7ZA 1FWZA 1XMXA 2R3SA 3OYFA 4F6MA 2HKOA 1SAXA 3KP3A 4G94A 4LLNA 4J19A 2XB5A 3ZRGA 1K6YA 3TOAA 4IQ4A 3L2VA 2VASA 3FMSA 5A6BD 5FLXZ 2Z2SB 3Q0VA 5KNLA 4EEFG 2C6YA 4H0EA 2I13A 3N97A 2M7QA 1WJFA 4ZDLA 2EPNA 1B4AA 4RB1A 3G4SI 3TW7A 4IZZA 1WHQA 4C3HJ 1BA5A 1MNDA 1TW3A 2VC1A 2XGEA 4DYQA 5DM6F 2ETHA 2Y9ZA 1AU7A 2ECCA 2FQ4A 1X3WB 1T38A 4A3MJ 2X85A 2EPXA 2HQRA 2B9SA 1Z1BA 5IT9C 3O3KA 4HNUA 2MDRA 3W2WA 5IT3A 2HYGD 4J01A 3ADJA 1TBXA 3BR2A 1G2FC 2UXDE 2DT7B 2HEOA 2MD5A 2R5YA 3THOB 2E19A 1IDZA 1FYLA 2HQAA 1D0YA 3O8HA 3L2QA 2VKVA 4KA4A 2ADRA 5JLWA 4V19K 2A07F 1Z91A 2L2KB 1IC8A 2LTRA 2M5WA 4KT6A 2M4GA 2RDPA 2QF7A 2ZSIB 4XLEA 1ZRFA 4P7DA 2NXNB 5AIQA 4B3RE 1U0JA 3JRIA 3VSLA 2WC2A 3DTKA 2CQ7A 2V9VA 2B3TB 2L3CA 3HSRA 2LP0A 1YSAC 1XMOE 1N32E 3OOUA 4RS8A 4A3DJ 4LFAE 1WQ2A 4DV5E 3JW4A 3N4MA 1HQCA 5CVJA 2CQQA 1A31A 1W7PA 3I3LA 2RS6A 2XPUA 2LBFB 3GO5A 3FM3A 3LFKA 4JBAA 5FLVA 3W2AA 1TWGJ 1MBFA 3R0AA 4UNOA 3GYHX 3H9QA 4DV6E 4X65E 3OYKA 2FBKA 1ZR9A 4Q48A 1MSEC 2Y75A 2HVRA 3DBHB 1BI1A 3C6MA 3CCMI 1IXSB 2D45A 2F48A 3W6KB 2OC6A 4I0BA 5J6XA 2EOQA 4IHWA 5GAHJ 2HOSA 2V83A 4HZFA 2DT6A 3CDIA 2GQQA 1PDNC 3AL0B 5L3GA 1XGSA 4UV8A 2DQRA 5DD8A 2MYSA 3WHBA 4BS9A 4E7JA 2E1MA 5CQEA 4CO8A 1ZARA 3JREA 2EM9A 1X3UA 3CCEI 4HSRA 3CJNA 1IUFA 3B6CA 3CZ6A 3KLNA 3HBLA 1XGOA 1QGPA 2L6MA 4EJUA 4FHTA 3BJ6A 3LL7A 2L9SA 2E35A 3QQAA 4HOBA 1YTYA 2K27A 1OYWA 5TJJA 1JHFA 2J5PA 4S0HB 1NTCA 2N3GA 3CUQA 1YS6A 1LFPA 2IGKA 2DFIA 3FZVA 4A3BJ 4ESBA 2XAQA 2HJJA 3CCSI 1HXDA 3LQQA 1BBOA 2LMDA 1TF6A 2EL5A 1HSJA 2GXBA 5DUKA 4XRSG 1VQMI 1APLC 5F27A 1JK2A 2KRCA 5HOOA 1F9NA 1OCOH 2DDBA 5F08A 3PO2J 2HHHE 2LMZA 2E34A 1MDMB 2BHYA 1D1AA 1J59A 3FXOA 1MMGA 2HU9A 2EZHA 3M7GA 4XOPA 2Y9YA 3VPRA 1EF4A 1A6QA 4E70A 2EFQA 3DLLF 2EPPA 1EA3A 4DBRA 1R22A 2Z5UA 4U7BA 1W7PD 2PMZN 2M7AA 1F36A 3DCFA 2YTDA 3RKQA 1NK2P 3BWGA 2XAHA 3BTJA 4KN7X 2EM3A 2GHFA 3HIFA 4M9SA 1AAYA 4D5CA 1OCTC 2FA5A 3HRSA 2K9SA 2BVLA 1FTTA 4RMNA 2O61A 2EN8A 2WTEA 1JTYA 4Q47A 2YTNA 1NEIA 2XPWA 1UFMA 3RPQA 4ASNA 1JT0A 4UXNA 2P6SA 1PJTA 3HM5A 1KYZA 2ZKZA 4HX8A 2ZCWA 1F1ZA 5DYMA 4C2MJ 5IOYA 5E17F 2EN3A 4Z2YA 2MW8A 3H92A 1KU3A 2LNBA 4E7KA 5IYCJ 1FMVA 4UB8C 1PUFB 2KHXA 4P78A 2A05A 3I0TA 3S3OA 2DK8A 2H8RA 2VE7C 4BHBA 1IGNA 2BBYA 4D7NA 2F2EA 2JQ7A 2JRMA 5D8LB 5E1WA 4UVCA 5GPAA 5ILUA 2ELJA 3EUKL 4L0ZB 3OSFA 1TT0A 1WPKA 4HDVA 3P1XA 3T1HE 4P96A 4ETSA 1R5HA 1MBGA 2X1CA 5A69A 2EFPA 4RB2C 2EZ6A 1BW6A 1MIJA 3TMOA 3CC2I 2UUCE 1SFUA 3SZPA 2KZGA 2Z3YA 1FP1D 2V6CA 1X4PA 2WV0A 3K4CA 3HL2A 3HOUJ 4GZNC 1N33E 3FIWA 1IQSA 4OAYA 1JE8A 2FXAA 2WZOA 2HOEA 4B3XA 4BEHB 2VC0A 2VE9A 4JV5E 2BY0A 1J9IA 4A2UA 4X66E 3SFZA 1QU6A 1D1BA 2R7RA 1G2HA 4YRVA 4M2ZA 3CCUI 3GUDA 1ZU1A 1I5ZA 5J1YA 9ANTA 2R5ZB 2DU9A 1P4WA 3HXLA 5C3EJ 2JA2A 1LEBA 2VQCA 1BR2A 1FOWA 1Z7LA 2H1LA 3KE2A 1AHDP 4GO1A 3FKIJ 1YFHA 3O6BB 2VXDA 2HTSA 5DCMA 3DKXA 2LBSB 2EFOA 1YW9A 4YFNF 5GPCA 2ZXJA 1ETKA 2BY1A 2E7WA 1WFXA 4NHJA 1EKEA 1J75A 4L9VA 1U3EM 4MEXF 1O3RA 2ISZA 4BC9A 2AQEA 4P5OA 5E8GA 4XLFA 3ZQIA 3EPLA 1UHZA 2ZJQF 2JPAA 1Z0XA 3MFKA 1O0WA 3GFJA 3RKWA 1PUFA 4G6QA 3BIDA 3CESA 1LFUP 3ZP5A 2J5OA 1FT9A 2V1DA 1YUJA 3UNGC 1I50J 3SEZA 1JK1A 3TO9A 1X6HA 2BV6A 2Q0OA 1WSUA 2M4KA 1IN5A 2VL8A 3F6GA 3S3MA 4BHCA 2P0WA 1SFEA 2YX7A 2WY8Q 4CCMA 5TRDA 1G2DC 4EM0B 4JK1X 3IWZA 1W5TA 2MC3A 4M71A 2VQLA 1YW7A 1TNSA 3BR1A 2DLQA 2LO3A 2YTJA 2EOMA 1ZAAC 4M9VC 1B72A 3BZCA 2VPLA 4M3GA 5AONA 4WWCA 3GTGJ 4MQVA 4BQOA 2PG4A 4HF0A 2VLAA 3EUHA 2XRNA 4LB5A 1FX7A 4DIQA 2PN6A 1R7JA 2RQPA 2A69F 4JI0E 2E5NA 3ECHA 4BQQA 2EP3A 3OSGA 3VYYA 3I71A 5L3EA 1GVDA 2XAGA 4O5VA 4CCLA 1A1IA 2G7UA 1RRJA 2DOFA 2V86A 2EMZA 2Z1DA 4AVPA 4BC7A 2PX9A 2PJRB 3E5UA 1N36E 3K70C 4IHTA 1P7JA 2L7FP 4I0AA 3ECOA 5FFXA 3L2UA 2TDXA 3LSIA 3I59A 3D1NI 3HRTA 3VK6A 1OYYA 2CQNA 2VE8A 4Y7NJ 4F91B 4D5FA 2EOSA 5J1RA 3L09A 1I6XA 1SVMA 1WH7A 2W48A 3G71I 2CT1A 5K7FA 2CFXA 2XRLA 4XM3A 4LIUA 2A6EF 2HR3A 3E3VA 1A35A 2RQQA 2ZXIA 4EM2A 3EPZA 4UVAA 4I01A 2VQEE 5K5OA 2RTXA 3DFGA 1VQ9I 2L2NA 5FLMJ 3HOYJ 1LVAA 1DU6A 4OIOF 1FBUA 5F0CA 1BI0A 1K4SA 3DTEA 3GTMJ 3MSWA 5GAEJ 2EOXA 4DKKA 3DEEA 2CV2A 1I3AA 3WTWC 4LG0A 5L3CA 5FB2A 1FYMA 4U0YA 3WE3A 4R8OA 2IPQX 2Q8UA 3V7CA 3KP4A 2XF6A 3ERED 1XS9A 2VQFE 2EPKX 2R7ZJ 4FT8A 3BG6A 4G7HF 2HOTA 1LEAA 3GTLJ 1ZBTA 4CXFA 1SANA 2EQ1A 1XDSA 1YZ9A 1MJAA 4KMFA 5IPAA 5GP9A 4DV4E 4R1HA 4KICA 1TW2A 2KHMA 4PSWA 1VQPI 4NQWB 3QPLA 2FX0A 4LG0B 2ELZA 4MNUA 3G2BA 3DPUA 2LOOA 4N9HA 1XX5A 4HV6A 2M3AA 2QVOA 3OR1C 1HW2A 2WB1A 2VRDA 3JTGA 3C4BA 1W36D 4YY3E 2QSFX 2QM3A 3TL4X 2ESNA 3PUBA 3GTQJ 3OYCA 3PM1A 1K61A 1RPWA 2A6HF 2NUFA 4CDGA 1XSVA 2LC2A 3GLLA 4R2PA 1ON1A 1R1TA 3U2RA 1T2KA 3S2HJ 1MKMA 1XCVA 2KLOA 5CLSA 2UUBE 3DXJF 1SFKA 2EM5A 1DI2A 1TT5B 3J7ZI 2X4HA 2G9WA 4XOTA 4XR6A 3RYPA 3GVAA 3HKZA 3DBRB 3DTIA 3KZIC 3ZN0A 5IOZA 3CP2A 4BDYA 2V7FA 3L2RA 1BI2A 3V8LA 3BJOA 3GW2A 3V7RA 3A2KA 2L5QA 2LBFA 2IT0A 3KX2A 3HTSB 2LRDA 4L5JA 3ZMVA 3KETA 2OA4A 2CH0A 3K7AJ 5E18F 4XLHA 4Q5SF 2DMPA 4AIDA 4HNTA 2KP6A 1YJNI 2EE8A 3VYXA 3U1DA 2HS5A 5KL5A 2H6CA 4DV2E 1J26A 1ETOA 3LSMA 3OOPA 2YSRA 4KMUX 5L3BA 4BE1A 3C3WA 5JVGF 3MHHC 5F1JA 1ZK8A 2E1NA 3RKYA 2F6CA 3E97A 1BOBA 1YI2I 1PJRA 1MH3A 1O7FA 1YITI 4FASD 2PJPA 2HKXA 3RQ4A 3CF5F 2ZMEC 3GF2A 4GFBA 2JVAA 2Q2EB 2XGXA 2BYVE 1YW8A 1D8KA 2VBWA 3QP6A 5B3SH 2KJCA 3QAHA 1ON2A 3PO3J 1MSFC 3E6MA 3KWRA 1IUYA 2EN4A 3IAS2 3D5LA 4JX5A 5J3LA 4II3A 5FD5A 2JA6J 5ADZA 2GWRA 3OYGA 1R6RA 4A0XA 3QRFF 1ZLKA 2FD5A 2L4MA 1VQ6I 4R2CA 2K4VA 1AH5A 3CD6I 3CLQA 2LT7A 4U0VA 2QA4I 3IRQA 1UILA 2IS4A 2D1HA 3F23A 2OTLI 1D5YA 4WF2A 2M0MA 3BLYA 2GBYA 2ELYA 2FBHA 3DKYA 5JFRA 1SMYF 1T0FA 2B9DA 1H88C 4RB0A 5K1YA 2RVCA 1XCBA 3A1YA 4FE4A 4UVBA 2AHQA 1GUUA 3V8JA 3KEQA 1I94E 2YPRA 4U87A 4DYRA 2PLYA 3DPLC 2L8TA 1WI9A 4BY1J 1P47A 3DP7A 4CUGA 1ZLJA 1NCSA 4AVZA 4MGRA 2M2EA 2HWVA 2W84A 2L9NA 2O5RA 3RDIA 2ME0A 4Y33A 1JKRC 1A5JA 2OV7A 3C6KA 2R1FA 5FFZA 1ZKGA 1LDDA 5M3FJ 1X1DA 1Z3XA 3TP3A 3WTVC 2Y69H 1TNTA 5EYRA 3ESWB 2WAFA 3JRHA 4GEQB 1KJKA 4KUMA 4NC7A 4HQEA 3K4NA 4PCQA 4EGZA 4RAGA 3DF6A 4WX9A 3G73A 1OCPA 3VB2A 2O8XA 1SFXA 1UAAA 3H9GA 4KISA 2R92J 2GPIA 1KYQA 4ZYAA 2H36X 5FD6A 1QVTA 2QWWA 2ZXWH 1CGPA 2CV1A 2Y0SA 3OYIA 1XG1A 1D8JA 1JHHA 1O7LA 1K83J 3OY9A 1W5SA 1ETYA 4DZPA 2DFFA 3HSFA 1U6GA 2EM2A 1DQUA 2IA2A 3HZJA 1QZZA 1G3YA 2JWOA 2KOUA 4RH8A 2JA7J 2WAQN 5GAGJ 2ODRD 2M1BA 2P5KA 1JUMA 1VI0A 3ZQCA 3FK7A 3FXLA 2MLGA 3PFIA 1FJLA 1LFBA 3AG4H 3I4NJ 3CF2A 5EGOA 4HYEA 2CFOA 3ASNH 2O3FA 5EF6A 1XGMA 1E3PA 3BR3A 4ENKA 2QYOA 3PUFA 2R0QC 1DDNA 1BIAA 2DAOA 2R7VA 1T8IA 1V5GA 3GCMA 1N34E 2Y2ZA 2UV1A 4FE7A 5BQTA 3BTLA 4M72A 4RAZA 3CQZJ 1G3SA 5E79C 2HVQA 1FSHA 3CCJI 1K6OA 3CMEI 1T4NA 2DA6A 5IT9K 3K2AA 2BVMA 1L0OC 2H94A 2O8KA 4C30A 3TDZC 3QU3A 3LSRA 1Z21A 1XTAA 4LF9E 1TWHJ 3WU2C 2MABA 3B73A 4HNVA 3OYLA 3VDXA 2ZMEB 4FETA 4PJNA 1RR7A 4O3MA 2EPZA 2DFEA 2JSCA 3ZMDA 2L3JA 4CCNA 1E2XA 3G1LA 2GZWA 2V26A 4RB3C 3OYMA 1A1FA 4LFCE 4E6KG 3K0LA 4MIMA 1Q1HA 1BOAA 2LH9A 1IJWC 1XSDA 1DPUA 1R4NB 3HEFA 4M6XA 3V8KA 1MDMA 4LF7E 2JVGA 3BG3A 4C3IJ 3NEUA 1G3WA 3LA2A 3CUOA 2YT4A 4ZH4F 2YTQA 2Y0MA 3C4TA 4HEA2
chains in the Genus database with same CATH topology
2FMLA 4LD5A 1OPCA 3SHFA 1CF7B 3LLHA 3WG9A 1R36A 4G8XA 4DNCA 3J80Z 2AXLA 2M8EA 2DB2A 3SQNA 1ZGJA 1RZ4A 1MJ9A 1EH7A 4DQ2A 1FP2A 4LF8E 3QP5A 5LRSA 2FNAA 4A5NA 1HSTA 2IA0A 1S7AA 2JT1A 3ULQB 3ZPLA 5FO5A 2DK5A 4BNCA 2JR1A 3CTAA 2CG4A 4Q28A 5DCMB 2AS5F 2P6TA 5ED4A 2VN2A 3BJAA 1ZHFA 2O0YA 3R61A 1O3SA 3L7WA 1F4KA 3BPXA 2PMUA 4DV3E 1XD7A 4M9ZA 2L33A 2QENA 4CHUA 5ERIA 5LMUE 3EQLF 3HOSA 2OZ6A 5HS9A 1XNQE 2Z33A 3E6DA 2B0LA 2L4AA 1XMKA 2JPBA 4GXOA 4YHHE 1H0MA 1ZG3A 4L9NA 1I1SA 3EETA 4YFKF 1BJAA 5ILSA 5IT9Z 2L02A 1IN7A 5ICGA 5KVRA 1JXSA 4ENMA 3IC7A 1DPRA 3VFZA 2BEOA 4B3SE 2A68F 4LF5E 1PP7U 1WXRA 5HVQC 3KP6A 2VODA 1SD5A 4KZSA 3I53A 5EEGA 1YYWA 2FRHA 1IF1A 2BE5F 1X48A 3OV8A 2L3DA 2MH9A 3IWFA 5D8KB 1HNWE 4GYGA 1STZA 1IW7F 5LBQA 4D0PA 4L5NC 5F6FA 2YR2A 4XBFA 3LAJA 5BPIA 5E1ZB 2FV4B 3T5XA 4WXDA 2N3HA 2EWNA 2ZFWA 2OAZA 4ZZDA 3HRMA 2Q8KA 4WXCA 1U78A 1KQ9A 2L2MA 2K02A 2PBIA 4JQFA 3I64A 3MCZA 5E8IA 1S8NA 4JI4E 4HDUA 1YG2A 1OKRA 1OYIA 4OX9E 4LLLA 2UXNA 2ZNYA 3GWZA 1K78A 4LU9A 1QO0D 4KDPA 1KU9A 1IXCA 3GFLA 3JAMZ 3ISPA 5HDKA 2EFNA 4ESJA 1O57A 4AIHA 3AV0A 2FGGA 4JI2E 1B1BA 4Y13A 4YIFA 1K79A 3K6QA 2ZO4A 3J7AO 3HYIA 5HLIA 1GHCA 1GQEA 2XVCA 1U5TC 3T0YA 2HQNA 4QLCU 3TDUC 2FEZA 1G4DA 3EYIA 3JSOA 3DKWA 5CFFE 3MZYA 3D0SA 4L5IA 5DD4A 5D5VB 3WGHA 4L9JA 1PUEE 5T6JA 1FBQA 4HX4A 4YFXF 5JR3A 2R7FA 2UWMA 5AASA 2DI3A 3M8EA 3F22A 5A2QZ 3LWFA 1RC7A 2HDCA 5H6QA 3HSEA 2KJBA 4HW0A 3WODF 4IHSA 4GKKE 4NB5A 4UUVA 4OMZA 2PQ8A 2ODRC 5BPDA 2LF8A 2E7XA 5L3DA 1MGTA 4A0YA 3I58A 4U88A 1YO5C 3Q9VA 1IN4A 2LRSA 2HFHA 1BIBA 2O6GE 4ZZLA 2F5CA 3F21A 3TQNA 3KFWX 4HA8A 2RSMA 2O03A 2JTVA 4WCGA 2NA2A 1C0WA 4B8XA 5D4RA 5LHGA 5FGMA 2DLLA 2EV0A 3REOA 1XDUA 4M74A 5FLXK 1HNZE 3C1DA 3NRVA 3QPTA 2DPDA 2UXXA 2EFWA 2DIXA 2LDUA 2B7VA 2LJHA 1RI7A 3L2CA 4A5MA 3FF5A 4ESFA 4X62E 2LUPB 3EYYA 3HQ1A 3WTYC 4NXNE 3HUGA 1XN7A 2NAZA 4AIJA 4BCAA 3H3ZA 5DNYA 4S04A 4S05A 3BZ6A 2FMYA 4XSZF 4OOGC 1G3TA 2FE3A 1P6RA 2LKPA 4EJOA 3EDPA 1EV7A 4B3TE 3QU6A 3IKVA 2DSYA 4Y17A 2FF4A 4WK8F 5LLQA 4KT5C 4TUIA 3JSPA 4P9UA 3FXQA 4CICA 3QOPA 1HKSA 2L92A 1Z6TA 3JTHA 4DV7E 2RKHA 2W24A 1GXQA 5H6RA 4TV7A 4TUGA 3T1YE 1Z1DA 3HTXA 1XGNA 2DTRA 3IHUA 1S29A 1TQMA 1ODDA 1J5EE 2UZKA 4GGGA 3ZMTA 1FNNA 2KKOA 3KLOA 4KIBA 2EB7A 2ADUA 4LLGF 3E6BA 4RGUA 3O2PE 3IKTA 1T4OA 2MH2A 2XKOA 2DBBA 3KEOA 4XLNF 3K2ZA 3LA7A 2VBYA 2E1CA 4HLYA 3JTZA 1YYKA 2IW5A 4G6DA 2W85A 2GXGA 1RNLA 5F64A 1L3LA 4XRFA 1D3YA 2STTA 4JI5E 1UHMA 5IWAE 5J8CA 1P4XA 2V87A 3MZHA 5LRRA 3IWBA 4MTEA 3BPVA 3RJPA 4HAMA 3FX3A 4FX4A 1IBKE 2VOOA 2XIGA 4EM1A 4U7DA 1HW5A 3FIGA 4ZYHA 1PKPA 4A6EA 3ADGA 2P4WA 3MWMA 3M8FA 3ZMUA 3P9KA 4ENJA 1SD7A 4LFBE 4DUYE 2FSWA 2VBZA 2EWLA 1FBSA 1ZG1A 1IRGA 1XMAA 1P2FA 2IJLA 3JAMK 1S3JA 1SR9A 2KIUA 4M0VA 3TO6A 3RTRA 3I59B 1ZGAA 1Z7UA 2VT2A 5DEQA 3RIRA 1TQPA 2H09A 1RUOA 3J7Yp 3RI4A 4DMIA 2P5VA 3F6HA 2YU3A 4BHPA 4OMYA 3KP7A 1O3QA 1HBXG 2NS0A 2EV5A 1LQ1A 3WTXC 3IL2A 5LGTA 4CGZA 3AUZA 2COMA 5ILVA 1IXRC 5E1XA 3CLOA 2MC5A 2H6BA 3FHZA 5DV5A 2QUFA 1UB9A 3F6VA 1G6NA 4JI8E 5K5QA 2F5EA 1XNRE 1IN8A 3C18A 4KYWA 5A2QC 4LGWA 1BN5A 2L54A 1RQ0A 3K1PA 3HHGA 5HS7A 1HW1A 2NNYA 2DQLA 5D5XB 2P7CB 1HKQA 4EJWA 4LK0F 2V1UA 2XKPA 4A6DA 2OQRA 3TOBA 4OIRF 4PDKA 2YX4A 3PQJA 4BYYA 1KGSA 3F8FA 1J7KA 3HTUA 5LHIA 3CO6C 1QNTA 1D5VA 2XASA 1XMQE 1X47A 1FC3A 4LMYA 4GYIA 1XSXA 1ZBQA 4QWQA 2DT5A 1T98A 1LB2A 3F8NA 2A3SA 1FZPB 4BQAA 3MEXA 5JVTA 5DUIA 1IBLE 1ZREA 4HX7A 3K1NA 5HLGA 2Q2EA 2W57A 3BROA 2K4BA 3R0JA 3FM5A 4I8OA 3GFIA 2XAJA 2RN7A 3P7NA 2F4VE 1W7PB 3E6CC 1IAWA 3SXYA 2JRTA 2NNNA 5D6EA 3Q9SA 2CQKA 1AWCA 2HYFA 3MAJA 1LDJA 3R4KA 1R23A 4EV0A 3BOQA 2HZTA 1GXPA 3ML6A 1RIOH 3HPZA 5CVVA 4DR1E 4A0ZA 3J80C 4B09A 1YQAA 1TQIA 2DO7A 1HNXE 4IRGA 1IBME 2FQ3A 1V4RA 1GZ6A 5CVUA 3CUQB 3ZOQB 1EH8A 1I1GA 2Y48A 4PZJA 1B59A 2ESHA 5LGNA 3FMQA 4HF1A 5LHHA 2JOXA 3F8MA 1U8RA 3FXUA 3GX4X 2M87A 4JYAE 3VOEA 1YLFA 2ZJ2A 2ISYA 4J8ZA 3HOTA 3WGIA 2PMHA 2LE2A 3IRRA 4EQQA 1WWXA 2XROA 2XV4S 3KZZA 1FY7A 1KA8A 2PEXA 2QZ8A 3P9IA 2ZBKA 2GAUA 5LEJA 4JI1E 1V3FA 4LFUA 1HKTA 1OR7A 1AOYA 2HTJA 4ZYGA 5F3WA 3KZYA 3GLXA 2B7TA 5ICCA 3LAPA 2FNPA 3HRUA 3Q5FA 3TKYA 4ON0A 3LSTA 4RGRA 1KQ0A 2G7HA 1QZYA 2XUBA 1KU7A 1H9GA 3ELKA 2D2WA 1NHAA 1R5GA 3DPTA 3GFMA 5DCFA 3CUQC 1OMIA 2F8BA 3DV8A 1IRFA 4EJTA 2M4IA 3K9TA 5F1RA 3ROUA 1T6SA 2M30A 5AE1A 3OTOE 2MA3A 1U2WA 3RKXA 1USTA 5D5UB 4F54A 1WRJA 1H9TA 2OQGA 5AE2A 3DQVC 3IWDA 2VT3A 1FSEA 2DW4A 2MLKA 2QBYB 1SD4A 2FTXB 3HHHA 4U0WA 3TGNA 4A12A 2EJRA 1R1VA 4NXME 1LJ9A 2KIFA 3WTUC 1ZYRF 4F9BB 2GIVA 2V85A 2V1XA 2L01A 2EA2A 1E17A 4KHPE 1ZN2A 5KK1A 3CDHA 1J0RA 4EGYA 2VXZA 3H3UA 1DQ3A 1ZAOA 3F3XA 2V8QB 2A61A 3I5UA 1WHNA 4PGGA 1P4AA 3CO7C 2K4JA 2IA1A 2V88A 2H27A 4HQMA 3ZMSA 2QQAA 4N0BA 5AIPA 4FX0A 3LMLA 5HDGA 5LMNE 5A2QK 5HLHA 4OIQF 4I2OA 2IHR1 3GZ5A 4X64E 4JI6E 2QBYA 5FLXC 4I7HA 1UHWA 2JPCA 2RNJA 2QQ9A 1O3TA 2FU4A 4IRIA 1MD0A 5CVIA 3RPUA 2JZYA 4WSPA 2PI0A 2RS7A 4DUZE 3KP5A 1MJBA 2CO5A 2K86A 2KIMA 4BBYA 1U5TA 4XLPF 4IJAA 1ZRDA 4I98B 1K7AA 2NYXA 2OZUA 5DDGA 2LUQA 4HF2A 4Q4ZF 4MQ9F 3F72A 3V7SA 5D5WB 5ICEA 2XAFA 3WU0A 2CPNA 1W4MA 4IRHA 4LJZF 1F5TA 4NQWA 1SMTA 2P5LC 3OMLA 1ZRCA 4IXAA 4R03A 4IVNA 5ICFA 5BS6A 3VEPA 3ADLA 2FOKA 2QLZA 4X8WA 1VTNC 2YZTA 1YS7A 4RGSA 1YYVA 2VONA 3V4GA 3ZQ7A 2E5LE 2NUGA 3U9GA 4BMJA 5CJ9A 3GEZA 2M1SA 3LQRA 4DR5E 3W6JB 2OD5A 2Z9OA 3WGGA 1Z6RA 4ENNA 2IP2A 3M9AA 3K1MA 2NUEA 4RAYA 4DR2E 1S6LA 3TO7A 1SD6A 5CYVA 3L9FA 2STWA 1J2XA 1QQIA 3WTSC 4UV9A 4Y15A 2ZM6E 4JI3E 2UXBE 1UCRA 4YIIA 5BMZA 4MEYF 1XB4A 6PAXA 4G9YA 2OBPA 2CWEA 1B9MA 1IZ1A 2MC6A 3SZTA 4R79A 4LTYA 5AE3A 3RYRA 2QQBA 2EA4A 5K5RA 3KCCA 3J81K 2ELHA 4HV5A 4OINF 4I02A 4P55A 5H20A 3GZ6A 3FWEA 4DR3E 1FPQA 1KU2A 1I27A 3VODA 3QPHA 4OIPF 4DR7E 3ZN1A 4BXUA 1DP7P 2DPUA 1FKAE 4GKJE 2CSOA 4WYQB 4AQYE 3M1EA 5BOXA 3I54A 5HDNA 5D4SA 4AWXB 3R6SA 1RUNA 3BDDA 2RC4A 1FJGE 1B6AA 3ADIA 4DV0E 1S7OA 4KIFA 1R00A 1EKZA 3FMRA 2V89A 1KYWA 1Z9CA 3J81C 4PGHA 2EV6A 4P9FA 2IRFG 5J8FA 1STUA 2LSOA 4LF4E 1BI3A 1DUXC 2ZMEA 1ULYA 4O6JA 4MTDA 5L3FA 5JHUA 4L9TA 2MBFA 2HGCA 3J80K 1WKMA 3DJWA 4WXHA 2VBXA 4WFTA 4B3ME 1REPC 2K7LA 3B02A 4AIKA 4G7OF 3WE2A 2CYYA 4KNYA 2W25A 2DMYA 2VF1A 3T8RA 3BP8A 3DEUA 1FLIA 4LB6B 3GXOA 3T8TA 1FOKA 3JU0A 1USSA 2PFBA 4F9AB 2V79A 4KN4X 4LF6E 3NQOA 3P9CA 2CW0F 2P7VB 1BC7C 3K69A 2IVMA 2NRAC 3WTZA 2JY9A 3J81Z 3F8CA 4M30A 4OU0A 1R1UA 1LNWA 1X49A 3R60A 4GCVA 3I4PA 1KQ8A 2D1VA 3WU1B 2UU9E 5JI6A 4M9XA 1T39A 4BH9A 4L8NA 3MQ0A 2RV8A 4AD9A 2VOPA 1CF7A 2FBIA 4JI7E 2ZNZA 4XSXF 1TLHB 2F5DA 2UUAE 1B9NA 1U5TB 4K2EA 2LTSA 2UXCE 3COAC 1ONVA 3H09A 1P92A 2CGPA 2GA1A 2Z99A 4EJVA 2EK5A 1R58A 2P8TA 3ZMZA 4M6YA 2LF7A 5LL6R 1TTYA 3IWCA 4IPAA 3C7JA 4OOIA 4BAYA 5LEKA 1BBYA 2JOBA 3L00A 3FXRA 2RGVA 4R8HA 4CYDA 4MHGA 4YG2F 4DR6E 3RMPA 1YYOA 1HR0E 3T1BA 4ZYDA 3AAFA 1GVJA 1EH6A 3DF8A 2GA2A 4WPYA 2KRFA 4CZZA 2OU2A 3G3ZA 4EVIA 1LDKB 5HS8A 3JAMC 1IN6A 1Z05A 3J7AG 3ABTA 1PP8F 1BC8C 1J5YA 2KONA 1QBJA 4KFCA 1MZBA 4G7ZF 1A04A 4IF4A 3S2WA 3E5XA 2R7DA 4EMSA 5BR8E 1QPMA 1BM9A 2ACJA 3F8BA 2XHKA 1ZG5A 4N9IA 5CVRA 2WWYA 5D6FA 5LGUA 4M73A 3WTTC 3HPSA 4UHTA 4I09A 4F9CB 1T4LB 2F5FA 1YIOA 4HLXA 2BGCA 3LA3A 2A5YB 3F6OA 1Y0UA 4LK1F 1K78B 4DV1E 1ZH5A 4L0YB 4L18B 2X0LA 4HBLA 3KP2A 4RGXA 3E5QA 4DR4E 4K0KE 5E20A 4KIGA 3ABUA 3BY6A 5EEHA 3PQKA 4ZYEA 1JGSA 1FYKA 2M45A 4F7ZA 1FWZA 2R3SA 2HKOA 1SAXA 3KP3A 4G94A 4LLNA 3TOAA 3FMSA 5FLXZ 2C6YA 4H0EA 3N97A 2M7QA 1B4AA 4RB1A 1WHQA 1TW3A 2VC1A 2ETHA 1T38A 2HQRA 5IT9C 3O3KA 2MDRA 5IT3A 2UXDE 2HYGD 3ADJA 1TBXA 2HEOA 2MD5A 1FYLA 4KA4A 2A07F 1Z91A 2L2KB 2LTRA 2M5WA 1ZRFA 2RDPA 4P7DA 5AIQA 4B3RE 2WC2A 2V9VA 2B3TB 2L3CA 3HSRA 1XMOE 1N32E 4RS8A 4LFAE 1WQ2A 4DV5E 3JW4A 3N4MA 1HQCA 5CVJA 1W7PA 2RS6A 3GO5A 3FM3A 3LFKA 4JBAA 4UNOA 3R0AA 3GYHX 4DV6E 4X65E 2FBKA 4Q48A 2Y75A 1BI1A 2D45A 1IXSB 5J6XA 3W6KB 4I0BA 2V83A 4HZFA 2GQQA 1PDNC 5L3GA 1XGSA 4UV8A 2DQRA 5DD8A 4BS9A 2E1MA 4CO8A 1ZARA 1X3UA 3CJNA 3KLNA 1XGOA 1QGPA 2L6MA 4EJUA 4FHTA 3BJ6A 4HOBA 1YTYA 2K27A 1OYWA 5TJJA 1JHFA 2J5PA 2N3GA 3CUQA 1YS6A 3FZVA 2DFIA 4ESBA 2XAQA 3LQQA 1HXDA 1HSJA 2GXBA 5DUKA 5HOOA 1F9NA 2HHHE 2LMZA 1MDMB 1J59A 3M7GA 4R8OA 4E70A 2EFQA 1R22A 2Z5UA 4U7BA 1W7PD 3BWGA 2XAHA 4KN7X 3HIFA 4M9SA 2FA5A 3HRSA 2O61A 2WTEA 4Q47A 1UFMA 3RPQA 4ASNA 4UXNA 2P6SA 4HX8A 1KYZA 2ZKZA 2ZCWA 1F1ZA 5DYMA 5E17F 4Z2YA 3H92A 1KU3A 2LNBA 2KHXA 4P78A 3I0TA 2VE7C 2DK8A 4BHBA 2BBYA 2F2EA 5D8LB 5E1WA 4UVCA 5ILUA 4L0ZB 4HDVA 3P1XA 3T1HE 4P96A 4ETSA 1R5HA 2EFPA 4RB2C 2EZ6A 2UUCE 1SFUA 3SZPA 2Z3YA 1FP1D 2V6CA 2WV0A 1N33E 1JE8A 2FXAA 2WZOA 2HOEA 2VC0A 2VE9A 4JV5E 1J9IA 4A2UA 4X66E 3SFZA 1QU6A 4M2ZA 3GUDA 1I5ZA 2DU9A