2G7HA

Structure of an o6-methylguanine dna methyltransferase from methanococcus jannaschii (mj1529)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
167
structure length
167
Chain Sequence
MIIQIEEYFIGMIFKGNQLVRNTIPLRREEIFNFMDGEVVSNPEDEHLKVAEIILKLYFAEIDDKKVRELISYKLEVPEFTKKVLDIVKDIEFGKTLTYGDIAKKLNTSPRAVGMALKRNPLPLIIPCHRVVAKNSLGGYSYGLDKKKFILERERLNMVSFKFNKVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies of MJ1529, an O(6)-methylguanine-DNA methyltransferase
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
total genus 20
structure length 167
sequence length 167
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2006-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2g7hA02
3.30.160.460 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2g7hA01
3EUHA 4OOIA 2IRFG 2FNPA 2E7WA 5HVQC 5D5VB 3JW4A 3V8JA 3I5UA 4EJVA 4ENNA 2R3SA 2YX4A 4G7HF 2NAZA 4LMYA 4IRHA 1FZPB 3KP3A 4A12A 4M74A 3N97A 3RYRA 5FFZA 1FYLA 5CVJA 1KGSA 1ZLKA 2O8XA 2QWWA 1R22A 5LHIA 1XN7A 1WQ2A 3D5LA 4NQWA 2XASA 3QU3A 5L3GA 3E6MA 1IN7A 1IAWA 2XVCA 4KNYA 5L3BA 2P5VA 4YFNF 5ICCA 4LGWA 3V4GA 3O3KA 4ZZLA 4UV9A 1R1UA 3WU0A 4GXOA 3IRRA 2E1CA 3GFLA 4CO8A 5K5OA 4Y17A 4ZYDA 2FBHA 1T6SA 5LGUA 1V4RA 3KP2A 1ZGAA 3F21A 3WTXC 3E6DA 2GZWA 3OOPA 2ACJA 4EMSA 1FT9A 1TTYA 3VEPA 1TLHB 3K1PA 1ZH5A 5BPDA 1QO0D 5FLXK 2RQPA 1JHFA 3I71A 5AIPA 4EJWA 1XCBA 5LEKA 4I01A 2O3FA 2UWMA 4UVAA 3HSEA 4GCVA 4E70A 4L5JA 2QM3A 4CXFA 3WGHA 1K7AA 3TO6A 4EV0A 4KFCA 2RDPA 2A6EF 4XRFA 2O6GE 3FM3A 1O3RA 4EQQA 1RUNA 2IA2A 3HRMA 2X0LA 4A2UA 5IT3A 1G6NA 5TJJA 5K5QA 2IW5A 3I59B 3M7GA 3MCZA 4ENJA 4UVBA 3I59A 4A0XA 1T39A 2VODA 2CQKA 4HQEA 4BXUA 3BOQA 2Y0MA 1J5YA 2EJRA 1USSA 1RUOA 5HDNA 4XSXF 3EDPA 4G6DA 2YX7A 4IRIA 1W4MA 4GYIA 3R60A 2YR2A 3E6CC 2P4WA 2PQ8A 1NHAA 3J80Z 2FBIA 5FB2A 2IT0A 2L02A 1OYIA 1K78B 1XB4A 4R1HA 1BOAA 2XHKA 4CICA 3FMQA 2ESNA 4L9VA 1OYYA 4LLGF 1T2KA 4AIJA 1DPUA 1KU7A 3MEXA 4I02A 4KDPA 2VBYA 3KLNA 1GHCA 2A3SA 1XGNA 3LWFA 3ERED 3TGNA 3MZHA 1YW8A 4MTEA 2CWEA 2LDUA 2EWNA 2VE8A 1OKRA 1MJ9A 2H09A 3GFIA 5H20A 1D8JA 2V1DA 1MD0A 1CF7A 1P4XA 3M1EA 4EM0B 4O6JA 3EETA 4UNOA 1FYKA 4QWQA 4EGZA 4LB6B 3H3ZA 4A0ZA 2FRHA 4ENMA 3MFKA 3GLXA 2XRNA 1FBUA 2ZO4A 4IPAA 2BE5F 4PCQA 1E17A 1U3EM 3GVAA 2O61A 2F2EA 3VODA 2OAZA 5J8FA 2WV0A 3IKTA 3LFKA 3HTUA 1S29A 1UFMA 4DNCA 2BBYA 3BJ6A 4I7HA 1B6AA 1LQ1A 2F5CA 2W25A 5E1XA 5ILUA 3HYIA 2Y75A 2DK8A 4M72A 2W24A 2Y48A 3RI4A 1STZA 2XAGA 5KVRA 1OYWA 2QQ9A 3GW2A 2EV0A 2VOOA 1R1VA 3BJOA 1IN6A 4I98B 1IW7F 2FF4A 1CGPA 2PJPA 1SD4A 4I0AA 3TDUC 3E97A 4IJAA 3CDHA 4BHBA 4HF1A 2FXAA 2HTJA 1ON1A 2QLZA 3U9GA 3JAMK 1ZARA 1SMTA 1RZ4A 2V79A 3T5XA 2FE3A 2V9VA 3RKWA 2HTSA 2W84A 3R0JA 2A07F 1TQPA 4BH9A 2EA2A 2HGCA 4L9JA 2DPDA 1O7FA 1MDMB 2NNNA 3ISPA 1ZLJA 2Z5UA 4AIKA 3DV8A 3HRTA 1UCRA 2O03A 1R23A 3V7CA 2CGPA 4PGHA 4KICA 3FWEA 3CUQA 5D4RA 3I53A 3PFIA 4BAYA 4LG0B 3SHFA 5D8KB 3HTSB 3CLOA 1BI0A 1H0MA 4EJOA 5DCMB 3LA2A 2CYYA 3K1NA 3CO7C 5FGMA 1L0OC 2F5FA 1BIBA 4PZJA 1G3TA 2P5KA 3ML6A 3IKVA 4HZFA 1IN8A 1WSUA 1Z1DA 5DUKA 1YG2A 3R61A 2EV6A 4GO1A 1P4AA 4TV7A 3W6KB 2MA3A 2CSOA 1QBJA 4YFXF 2HFHA 3F22A 2K4BA 1SFUA 1KU9A 3IL2A 1H9TA 3MAJA 2QQBA 1EH7A 2TDXA 2HYGD 4IF4A 5HS9A 5ICEA 5JHUA 4U0YA 2GA2A 2ADUA 1Z6TA 2XAQA 3GZ6A 4HW0A 2GA1A 4MTDA 2G7UA 2EK5A 1U78A 1YTYA 3C18A 4F7ZA 2JZYA 3RKYA 5HS7A 4KA4A 2KIFA 4N0BA 1L3LA 3EYYA 1YQAA 2CG4A 2FEZA 2GIVA 1SMYF 1G3YA 3ZPLA 4OIOF 4ZYGA 3Q9SA 1DPRA 2DLLA 3ABTA 3BPVA 2NNYA 2OQRA 4I09A 2FU4A 1XSVA 2QZ8A 2ZCWA 2VOPA 2CFXA 3ZMTA 3QPTA 4AD9A 2M5WA 2CW0F 2L4AA 1AWCA 2XAFA 4LJZF 4CDGA 1D3YA 3Q9VA 3HOSA 2XUBA 4YG2F 5LHGA 2ZJ2A 4Z2YA 3TO9A 4KMUX 4RGSA 4G6QA 2VONA 1S7OA 1YW7A 4LLNA 4I2OA 3IHUA 5E18F 1J59A 2J5PA 4KN4X 2YPRA 3C3WA 1AOYA 3KZZA 1XMAA 3EQLF 2Z33A 4ETSA 1VTNC 5E1WA 5ILVA 5DCFA 2DTRA 3K1MA 4LLLA 3HOTA 1FP1D 5H6QA 1HKQA 4NB5A 1S7AA 1BI1A 1BBYA 3B02A 5HDKA 1KYZA 2A69F 3EYIA 3V8KA 1XGSA 2QQAA 1X3UA 4EJUA 1XGMA 4PGGA 3C1DA 3TKYA 1BI2A 1BJAA 3WE3A 3O2PE 5LRSA 1T0FA 2KIMA 3KP4A 3GXOA 2PFBA 3HRSA 3P9CA 2YSRA 1WRJA 2K7LA 3KZYA 2X4HA 3F6VA 1Y0UA 2C6YA 1ZAOA 1LDDA 2Z3YA 1SD6A 4WWCA 3NEUA 1LDKB 5LGTA 4KIBA 1BM9A 4KIGA 2P7CB 1LB2A 3FXRA 1J75A 1LDJA 3ABUA 2PI0A 5CJ9A 2Q2EA 3S2WA 4KUMA 2OU2A 4EM2A 2JSCA 1F4KA 5FO5A 1SD7A 3HHHA 5F1RA 2Q0OA 3KLOA 4RGXA 1FPQA 1UB9A 4IXAA 1R36A 4HBLA 5D4SA 1HW2A 3WG9A 1P6RA 4HLXA 4G94A 1HKSA 1G3WA 2HZTA 3T0YA 4UV8A 3TOBA 1FP2A 3DP7A 1TNSA 2QVOA 3JSOA 3L9FA 2ETHA 1BC7C 1QPMA 2D45A 5KK1A 4U88A 1B59A 3WTUC 2NYXA 1F5TA 1FOKA 4L9TA 3ROUA 3TQNA 2L4MA 1KA8A 3QRFF 3C7JA 3HUGA 1EH6A 2K4JA 2Q8KA 4M6YA 5DYMA 2YU3A 1C0WA 2DQLA 4KT5C 4OINF 3DEUA 3L7WA 1QZYA 1DUXC 3F72A 3TOAA 4XLNF 4S05A 3ZMUA 5D5WB 4AVPA 1IXCA 4ASNA 5CVRA 4R79A 3MWMA 5LLQA 1ODDA 4RB3C 1QGPA 5CLSA 1IN5A 4MGRA 4MNUA 3MZYA 5FFXA 3F8NA 1TQMA 5HLIA 3E3VA 5K5RA 5CVIA 2BEOA 1IRFA 4MEXF 3ELKA 4HDUA 4WF2A 2DQRA 1JHHA 1FY7A 3GZ5A 5BOXA 1Z91A 2OA4A 2GXGA 2FSWA 4B09A 2E7XA 3NRVA 3TDZC 4Q4ZF 1FC3A 2HYFA 5A2QZ 1PP8F 4RB1A 4ZYHA 2GWRA 1YYVA 1TBXA 1RIOH 2ZNZA 3I64A 3RTRA 3BP8A 3HHGA 2PLYA 3QAHA 3QP6A 4FHTA 4HF2A 1B4AA 4UVCA 2HS5A 3LQRA 4CYDA 3T1BA 2OZ6A 2M30A 3GO5A 2BYVE 4O5VA 4RAZA 4IRGA 1U5TB 2FBKA 4OIQF 2UXNA 4M9ZA 2WC2A 3F8CA 3HSRA 4A0YA 1FBSA 1W7PD 4KYWA 4HF0A 5BPIA 3MQ0A 5F6FA 1I1GA 3GF2A 3QPHA 4XSZF 3GFMA 1R7JA 1P2FA 2MLKA 2DW4A 3VB2A 2W57A 5JR3A 3V7RA 4U7DA 5H6RA 3FM5A 4MQVA 1HSJA 4P9FA 5LRRA 1IRGA 4GYGA 4CZZA 4R8HA 1SFXA 2MC3A 2ISZA 2LF7A 2FA5A 1P92A 1CF7B 2HR3A 5EEHA 2DT5A 1IN4A 2EA4A 3F8MA 2EFOA 1G3SA 3D0SA 4KN7X 2EFPA 3WU1B 3H92A 1D5VA 1W5TA 1LVAA 1YFHA 1U8RA 4L18B 4MHGA 4XLPF 1YO5C 2V6CA 2K02A 3WTYC 2STTA 1XCVA 4JK1X 2XKPA 3DXJF 3BWGA 4MQ9F 1O3TA 3CUQC 1U2WA 4AIHA 3RPUA 1YS7A 1TQIA 2Z9OA 1WWXA 1ZG3A 1W7PA 3J81K 4CHUA 5L3DA 3KP6A 3SZTA 3E5XA 4OIPF 2XGXA 4G9YA 3F23A 3ZMZA 2V1XA 2NS0A 4NHJA 1IF1A 5L3FA 4Q48A 5BS6A 2QBYA 3WTWC 2DFIA 1SD5A 5HLHA 2NRAC 2QBYB 3KCCA 3GX4X 5DD8A 2F5DA 3CJNA 3KEOA 5AONA 3KE2A 3N4MA 5JVTA 3L2CA 1PDNC 5BMZA 2H6BA 1YW9A 2W85A 3G73A 1MJBA 1GXQA 2EFNA 3GFJA 3ULQB 3DFGA 1H9GA 3I54A 5FD6A 1FNNA 2AXLA 2BGCA 2RC4A 4G8XA 1XDUA 1IZ1A 3TO7A 2V1UA 4RGRA 3WTVC 5ED4A 4G7ZF 5DEQA 2Z99A 3HRUA 2H94A 3GYHX 1R1TA 2PMHA 5L3EA 5D6EA 4RB0A 2ZNYA 2VT3A 2ESHA 4YIFA 2ZKZA 1QQIA 4FT8A 1KQ9A 3U1DA 4P55A 1USTA 4L0ZB 4KMFA 2P7VB 4AWXB 3FXUA 1ZG1A 5E17F 5LGNA 3I4PA 4PDKA 3COAC 1ZRCA 1U5TC 4OU0A 1I27A 3JTGA 4YFKF 1TW3A 3GWZA 2CO5A 3KETA 4HOBA 3FMRA 1OR7A 4WXDA 3DF8A 2VC0A 2O0YA 5HLGA 2DI3A 2RNJA 5E20A 2OZUA 1T38A 1IXRC 3E5UA 2MH2A 3H3UA 5ERIA 2HKXA 3R0AA 3ZMDA 3LA3A 4IVNA 3SXYA 2ZBKA 1REPC 1I5ZA 3BY6A 2J5OA 1I1SA 3B73A 1O7LA 4LK1F 4O3MA 2MH9A 3M8EA 5JI6A 1YIOA 2MLGA 4M71A 1HSTA 5D8LB 2RKHA 2LF8A 2F5EA 4LD5A 2P5LC 2PG4A 3BROA 2EFWA 5D6FA 2LSOA 2PN6A 3P7NA 4I0BA 5IT9Z 1FLIA 5A2QK 2L01A 2DAOA 3HIFA 3VOEA 3IRQA 2ZMEB 1E2XA 5LHHA 4U0VA 4Q5SF 2RGVA 2M8EA 3FF5A 4FX0A 1UHWA 1HKTA 3CUQB 2R7FA 3FZVA 1V3FA 2D2WA 3KP5A 4HV5A 3W6JB 5E8GA 1K79A 1HW1A 2XROA 3SFZA 2M1BA 1YS6A 5L3CA 3IWFA 4JBAA 4Q47A 2IP2A 5EEGA 2KJBA 4WK8F 4M73A 2WWYA 1HW5A 4HYEA 4A6DA 1T98A 3DQVC 3ZP5A 1ZN2A 2FMYA 1OMIA 1FWZA 4JQFA 2K86A 5BQTA 3J80K 3V8LA 3JTHA 1Z7UA 1MGTA 1A04A 3HSFA 2HDCA 3RDIA 1BIAA 1B9MA 2HWVA 4ZYEA 5DD4A 4EVIA 1ONVA 2QENA 1SAXA 3KEQA 5J6XA 5J8CA 5D5XB 2HKOA 1BC8C 4MEYF 3QOPA 1ZGJA 2HEOA 2PMUA 2GXBA 3R4KA 2ELHA 4RGUA 1J2XA 4OIRF 1W7PB 1U6GA 3M9AA 1Q1HA 2L3DA 1DDNA 1IUYA 3J81Z 3WTSC 4EJTA 3J7AO 2JTVA 2MD5A 4M9SA 4S04A 2A5YB 3LSTA 1JGSA 5E1ZB 5LEJA 3L00A 2DK5A 1LJ9A 5HS8A 4WCGA 1S8NA 3U2RA 4H0EA 5FD5A 2RN7A 2KRFA 4K2EA 2EB7A 4D0PA 3BZ6A 1XGOA 2H27A 1B1BA 2JT1A 4LK0F 2OD5A 3IC7A 4RB2C 1KQ8A 1LEAA 2JPBA 2VXZA 2XV4S 4QLCU 4B8XA 4U7BA 3K2ZA 3P9KA 3ZMSA 5AIQA 1HQCA 3BDDA 1K78A 3RKXA 1J9IA 5HDGA 2FOKA 3F8FA 2PBIA 1GVJA 4HAMA 2A68F 4LFUA 1F9NA 1R58A 1BN5A 2G7HA 4N9IA 2JRTA 2G9WA 1ZYRF 1LEBA 2H6CA 2IPQX 2KKOA 5JFRA 3ECOA 1WKMA 2IA0A 3FHZA 4IHTA 1DP7P 3DKWA 2VBWA 2COMA 1FSHA 4IHSA 2MBFA 4LG0A 1QZZA 4OMZA 2XAHA 5K1YA 2EFQA 1R5GA 1KYWA 1Z9CA 1FSEA 4KIFA 5F64A 2XIGA 2AS5F 4L5IA 3F6OA 2QUFA 2GQQA 4HV6A 1ZRFA 4HX7A 1R5HA 1S6LA 1B9NA 1ON2A 3M8FA 2PEXA 4HDVA 5CVVA 2HQRA 3LAPA 2ZMEA 4WX9A 2DU9A 1EH8A 3ZN1A 1Z6RA 1S3JA 1O57A 2XAJA 2K27A 2VE9A 3AAFA 4BHCA 4FX4A 2VBZA 5IT9K 3GUDA 2BV6A 2UXXA 4A5NA 2KIUA 2ZFWA 1G4DA 4ZH4F 2P6SA 2FNAA 1EV7A 5DV5A 1W5SA 4P96A 3T8RA 4ZZDA 4A6EA 1JE8A 2KJCA 1MDMA 3BJAA 4U0WA 1XSXA 3I58A 3R6SA 3NQOA 5HOOA 1TNTA 1O3SA 1IXSB 3IWZA 3KP7A 3ZMVA 3K69A 1XSDA 3CO6C 4DQ2A 3E5QA 4HX4A 3LA7A 5LBQA 3L09A 5FLXZ 4P9UA 2P8TA 3RIRA 4L9NA 4P5OA 5DCMA 1MKMA 4Y13A 2DBBA 2VBXA 4N9HA 3BPXA 2D1HA 4BNCA 6PAXA 2P6TA 3GEZA 1OPCA 3E6BA 1MJAA 1K6OA 1RNLA 1ULYA 3T8TA 4UXNA 1KQ0A 3WGGA 3WODF 2A61A 1TW2A 1P4WA 4UHTA 4M6XA 1FX7A 1RI7A 4CGZA 4WXCA 4BYYA 3I0TA 2IJLA 2VC1A 3PQKA 1ZG5A 3F8BA 2B0LA 1WI9A 3RPQA 5D5UB 3DPTA 2FQ3A 5CYVA 5CVUA 4RS8A 3QU6A 3ECHA 5TRDA 3G3ZA 2FMLA 2EV5A 4OMYA 3FXQA 1XD7A 3WE2A 5ICFA 1J7KA 2DPUA 3ZN0A 3REOA 1KU2A 3CUOA 3SQNA 4L0YB 2LKPA 1JXSA 4ON0A 1ZREA 2LNBA 2WTEA 4BHPA 2GAUA 5ICGA 3RJPA 1Z05A 2VT2A 3KFWX 4HLYA 2OQGA 3JAMZ 1ZRDA 4ENKA 1HBXG 4UUVA 2E1NA 3Q5FA 4HA8A 3OV8A 1XDSA 2M87A 3CTAA 2RV8A 3K9TA 4BQAA 3K0LA 1BI3A 3ZQ7A 1ZHFA 4LB5A 4M9XA 2JPCA 4A5MA 1D8KA 1HXDA 2RVCA 1F1ZA 3P9IA 2UZKA 1XMKA 2IA1A 5DUIA 1GXPA 4WXHA 2OBPA 1U5TA 3F3XA 3WTTC 1O3QA 2VN2A 1R00A 3PQJA 1UHMA 5ILSA 3V7SA 3WTZA 1MZBA 2QYOA 4EM1A 2R7DA 3JSPA 2L54A 1QNTA 1PUEE 2STWA 3SZPA 4HX8A 2M45A 4ESJA 3RYPA 2IVMA 5DDGA 3VFZA 4Y15A 2D1VA 2HQNA 1KU3A 4ESBA 2A6HF 3FMSA 2XKOA 3LAJA 1J0RA 1FBQA 1I6XA 4ESFA 4RAYA 4YIIA 1LNWA 4GGGA 3LQQA 1PP7U 2ISYA 2ZXJA 1FYMA 1SFEA 4XBFA 2DO7A 3QP5A 4EGYA 3FX3A 3DPLC 1YLFA 3WGIA 4G7OF 5E8IA 3O6BB 2HOEA 4HQMA
chains in the Genus database with same CATH superfamily
3EUHA 3OYHA 4DV3E 2DDAA 2GLIA 1IQOA 2EOEA 4M3BA 1W0UA 2WA0A 4OOIA 4R2EA 5A6KA 2IRFG 2UUZA 2FNPA 2E7WA 3AV0A 5HVQC 3J7AG 3E0JB 1JT0A 2VJ4A 4QPQA 3LSGA 4JI0E 5D5VB 3JW4A 3V8JA 4NHRA 2ME6A 1PUFA 2LREA 2DFFA 1N77A 1XMXA 2EPNA 3I5UA 4D1QA 3K4MA 4U87A 4BXFA 4EJVA 4ENNA 2R3SA 5IYCJ 2YX4A 4G7HF 2NAZA 3CDLA 3DTEA 3OOUA 3JCUC 4IRHA 4LMYA 4CCKA 1FZPB 2DOAA 3DU5A 4Y4RA 2Y30A 4CCJA 4YIRX 3KP3A 1F43A 3P1XA 2HU9A 1E3OC 4V2GA 4A12A 4M74A 3N97A 3RYRA 3H0GJ 4QTRA 3JRAA 1DGCA 5M5WJ 5FFZA 1FYLA 5CVJA 1OQYA 3AL0B 1YITI 1KGSA 2EPMX 2CSHA 2KDOA 1ZLKA 1MEYC 1B8IB 2O8XA 2QWWA 1R22A 1JI8A 5LHIA 1XN7A 1WQ2A 1N32E 3VWBA 3RSNA 3D5LA 4NQWA 2XASA 3QU3A 4ZDOA 4LF9E 5L3GA 4H4KC 3E6MA 1N75A 1ZKGA 4BY7J 1XMOE 1IN7A 1IAWA 1Y56A 1XNQE 2XVCA 3SEZA 3JRFA 5KL7A 2DA1A 3BT9A 4XK4A 5L3BA 3CCRI 2I5UA 4KNYA 2P5VA 5H2FC 2EM4A 2E5LE 3B6CA 4YFNF 5GAEJ 2B7EA 5ICCA 4LGWA 3V4GA 3O3KA 4E7ZA 4ZZLA 1B72B 1A5JA 4UV9A 1GQEA 1R1UA 4NZVA 4KISA 1HDDC 2EOOA 3WU0A 1MH3A 3CCYA 4GXOA 3IRRA 2E1CA 2XGCA 4AQYE 3GFLA 1LE8B 4CO8A 3RKQA 5K5OA 4Y17A 1A6QA 4ZYDA 2FBHA 3WHBA 1T6SA 5LGUA 3BTIA 3I4NJ 1RPWA 1BL0A 3VK6A 1V4RA 2ZXIA 4D5FA 3H9QA 3KP2A 1ZGAA 1A31A 3F21A 4IL6C 2EOJA 2V88A 4FTHA 3WTXC 2EQ1A 3E6DA 3H1CA 2GZWA 1EF4A 3OOPA 4XLHA 3BR5A 2MW8A 2ACJA 3FXJA 4EMSA 5A6JA 1FT9A 3QYBA 1TTYA 3VEPA 4ANJA 2WBMA 1TLHB 1S7EA 3K1PA 3QODA 1ZH5A 5EG0A 2YWQA 4RLQA 5BPDA 1QO0D 5EG0B 5FLXK 2RQPA 2LK2A 5DTDA 4DW6A 1JHFA 3I71A 5AIPA 2YTQA 1JGGA 4EJWA 1OR7C 3OS2A 2VQLA 3DBRB 4I6ZA 3S17J 1QZEA 3CJQB 1XCBA 2R92J 2DT7B 5LEKA 2E36A 2NVXJ 3M07A 4IHWA 5B1BH 2UU9E 4I01A 1WJDA 2O3FA 4E7HA 1MBGA 5EJCA 2UWMA 3M4OJ 2LCEA 5C4XJ 2KP6A 1MH4A 2HQAA 4UVAA 2XF5A 2DMQA 3HSEA 4GCVA 5F04A 4E70A 3CC7I 2VQGA 4FISA 1J26A 3VDXA 2YTNA 4L5JA 4UB6C 2YTPA 1AKHA 2QM3A 2WAEA 2LBSB 1XMQE 2WBSA 5J40A 4BQNA 2D5VA 3LLHA 1Y8QB 1YUIA 4CXFA 3WGHA 1K7AA 3C4BA 3TO6A 3VSKA 1MBFA 3F6GA 4EV0A 4KFCA 2RDPA 2EMYA 2A6EF 1O4XA 5FROA 4XRFA 2O6GE 3FM3A 1O3RA 3ADLA 4EQQA 2QCOA 1RUNA 2DRPA 2OTLI 2IA2A 2KLOA 2DMTA 4E6KG 3HRMA 2X0LA 4MO7A 3JRDA 4A2UA 2EOYA 3FISA 2NXNB 1NCSA 5IT3A 2A05A 1G6NA 3U1KA 5TJJA 2ZB9A 2CPNA 5K5QA 2IW5A 2XGEA 3I59B 3M7GA 3MCZA 2JOBA 4ENJA 2K4VA 1QHGA 3TL4X 2HJJA 4UVBA 5EYRA 3I59A 3I55I 4DUYE 4A0XA 1T39A 1APLC 1ETWA 2VODA 2CQKA 2QSFX 4HQEA 2XPWA 3CCSI 1D0XA 1O0WA 3GTGJ 3ESWB 4BXUA 3BOQA 1OCTC 2EMIA 1ZELA 3BQYA 2Y0MA 1YYWA 1J5YA 4RM3A 3ADGA 2W48A 4AUXA 2EJRA 2XDVA 3SFIA 1USSA 1RUOA 3H5AA 1WH5A 5HDNA 4XSXF 3FDYA 3S1MJ 3EDPA 4G6DA 2YX7A 4IRIA 1W4MA 3IAM2 3R60A 4GYIA 2FGGA 1LUJB 1P47A 2YR2A 3E6CC 2OCCH 2P4WA 2PQ8A 1NHAA 3EUHC 2FBIA 5FB2A 3J80Z 4O24A 2IT0A 1VQNI 2OF7A 3FIWA 2L02A 1OYIA 1K78B 2H8WA 1XB4A 2R7OA 2R4GA 4R1HA 1BOAA 2XHKA 4CICA 3FMQA 4A3DJ 1LPQA 2ESNA 3KIOA 4L9VA 1OYYA 4LLGF 1T2KA 4AIJA 2QKMB 1DPUA 4B4CA 3K70C 1KU7A 3UK3C 2UV1A 3MEXA 3ECRA 4HNVA 2VB6A 4I02A 1A36A 2MSYA 4KDPA 2VBYA 3KLNA 1GHCA 4DR7E 4M3GA 2X48A 3OYCA 4ZYAA 2A3SA 1XGNA 3LWFA 3ERED 4GZNC 4D7MA 3TGNA 3MZHA 1YW8A 1ZR9A 1HNWE 4MTEA 3PM1A 2CWEA 2LDUA 3JR9A 1NK3P 2EWNA 2VE8A 1POGA 5FLMJ 1I94E 2O9LA 1OKRA 3FXLA 4OWRB 1MJ9A 2H09A 5KNLA 3GFIA 5H20A 1RQ0A 2DFHA 1D8JA 3GBGA 1NG6A 1RC9A 1MD0A 2KZGA 2V1DA 4LOCA 1P4XA 3VYSB 3M1EA 3G71I 1CF7A 4EM0B 2GBYA 3EETA 4O6JA 4DR3E 1L4SA 3FK6A 2HVQA 4UNOA 1HLVA 3BG6A 5KAFC 1FYKA 4QWQA 5JVGF 4EGZA 1S5LC 4R2QA 1RESA 3AFHA 4LB6B 2JPAA 3H3ZA 4A0ZA 2FRHA 4ENMA 2H36X 4BC7A 3MFKA 1VQ7I 5M5XJ 2BOLA 3GLXA 2QEXI 1T8IA 1Z0XA 2XRNA 1FBUA 1FIPA 2ZO4A 5AC5A 4XLFA 4IPAA 1J09A 4DZJA 2BE5F 4PCQA 1WFXA 3PIOF 1E17A 1U3EM 3GVAA 2BHYA 4MLQA 4HSRA 3BTCA 2O61A 2F2EA 3VODA 1B69A 1BA5A 3ONQA 2VQHA 3ZQGA 2OAZA 5J8FA 2EN8A 3QYFA 2EPRA 2VLAA 2LJHA 2IS6A 2WV0A 5A6BA 4X66E 1DQ3A 3IKTA 2DLKA 1TF3A 3EPHA 2L2MA 5AE3A 3LFKA 3T1YE 3HTUA 1S29A 1RRJA 1UFMA 2VIXA 3I4MJ 1BBOA 2ELYA 4DNCA 4IHXA 4X6AJ 2BXZA 3UNGC 2BBYA 3BJ6A 3QPLA 3TEDA 1YRNB 4DZPA 1SVLA 1WCMJ 2BW3B 1WH7A 1FMWA 4I7HA 1TT0A 2ELJA 1B6AA 1UG2A 5E79C 2JP9A 1LQ1A 2EL5A 3JRBA 2BBGA 2K85A 3E7LA 2ENCA 2F5CA 3ZXSA 2ICWG 1JKOC 2GM4A 2F4MB 2W25A 1P7JA 5GAHJ 2CV0A 1XX5A 5E1XA 5ILUA 1BBGA 1TT5B 2AXTC 3W2AA 1N25A 3BGHA 3HYIA 2Y75A 1X19A 2CMPA 2DK8A 4M72A 2EMWA 2W24A 2VF1A 4FK5C 2Y48A 3RI4A 4FASD 1STZA 3QQAA 2NOGA 2XAGA 4M0VA 1GVDA 5KVRA 3OYBA 2M1SA 1OYWA 2QQ9A 4NC7A 3GW2A 1T4OA 4OAZA 4BJ5C 5GP9A 1MNEA 2DT6A 2EV0A 2VOOA 1R1VA 3PSFA 2DMUA 3EQ1A 3BJOA 1N33E 1IN6A 4I98B 1XTAA 2EOFA 4JI6E 5E3NA 1AH5A 2RREA 3THOB 1IW7F 2FF4A 4C2TA 3BC8A 4BMJA 1CGPA 3GTKJ 2PJPA 2JWOA 3Q0UA 3L2RA 4E7IA 1SD4A 2L2OA 4XQFA 2M7AA 4I0AA 2X6XA 3KPHA 3J7ZI 2A6TA 1D1BA 2JMWA 3TDUC 1GV2A 3CESA 3CJRB 2R5ZB 2M7QA 3G1MA 3E97A 4IZZA 1K83J 2R5ZA 3DTKA 3OIOA 2EZKA 2LFBA 4IJAA 3CDHA 4BHBA 2LV2A 4HF1A 2FXAA 3H3VK 1T56A 2HTJA 1ON1A 2QLZA 2LYCA 3U9GA 3JAMK 3GTMJ 2ZSIB 1YYOA 2L9NA 4OAYA 1ZARA 2LE2A 1SMTA 3IWBA 2QF7A 1RZ4A 2V79A 3DU6A 4I8OA 3T5XA 1EA3A 2FE3A 1F2IG 2V9VA 3RKWA 3ZQFA 2HTSA 2W84A 3R0JA 4ITVA 2A07F 4UB8C 1TQPA 2QSGX 4BH9A 2YUSA 2AHQA 4R2PA 2EA2A 2HGCA 4L9JA 2DPDA 2EL4A 1PDAA 1O7FA 1E3PA 1LKXA 2B7VA 2ZJQF 1MDMB 4CUGA 2NNNA 3ISPA 2L2KB 1ZLJA 1G2DC 2HOTA 5FRNA 2Z5UA 4WSGA 4AIKA 5M5YJ 2YTFA 3DV8A 2V86A 1HCRA 3HRTA 1UCRA 2O03A 1R23A 5CFFE 1FTTA 1A1LA 1MIJA 3V7CA 3BTLA 2CGPA 4PGHA 4KICA 2ZJPF 3FWEA 2LMDA 3CUQA 2EJ4A 1OISA 4XONA 5D4RA 3I53A 4C3HJ 2V8QB 3PFIA 3MMYB 4BAYA 3HB9A 2R5YA 2DJIA 4LG0B 4IOCF 3SHFA 4UUTA 5D8KB 4E7JA 1FOYA 5EZHA 3HTSB 3T1HE 3CLOA 3Q0VA 1ACIA 4PSWA 4IKFA 1BI0A 1X2NA 1BOBA 1WJ5A 2FV4B 4FCYA 1H0MA 3ADJA 5C4JJ 4EJOA 5DCMB 1ZGWA 3LA2A 2CYYA 3K1NA 4BGDA 1IG7A 3CO7C 1KYQA 3G6EI 5FGMA 3ZQLA 2RQQA 1L0OC 2EINH 2F5FA 1BIBA 3I3LA 1JUSA 4PZJA 4IOAF 1SC7A 1G3TA 1R4NB 2P5KA 4NUBA 5KL5A 3ML6A 3IKVA 1YE9A 3OR2C 4HZFA 2YTOA 3BQZA 3K2AA 4NDLA 1IN8A 1WSUA 1Z1DA 1Y1WJ 2IGOA 5A2QC 3H0DA 5DUKA 1YG2A 2V9KA 3R61A 2EV6A 1IUFA 4EEFG 4R2AA 4R8OA 4ABZA 4GO1A 1P4AA 4TV7A 3HUGB 3W6KB 1DGRM 2LY1A 4N4NB 2B63J 2MA3A 2CSOA 1QBJA 2J7JA 4YFXF 5T6JA 1PJRA 2HFHA 3F22A 4BS9A 2MKNA 2O7OA 1QVTA 2K4BA 3AG4H 2EL6A 2NA2A 5F0CA 1SFUA 4RBOA 1KU9A 3IL2A 1H9TA 5IYBJ 2WZOA 3MHSC 2EOHA 2HOSA 3DCFA 3MAJA 2QQBA 4HNTA 1G8XA 3A0BC 3BR3A 2JVGA 2HYJA 2ZJRF 4TUGA 4QSHA 3CLQA 1QVUA 2JN6A 1EH7A 5AASA 2TDXA 2HYGD 4IF4A 5HS9A 4DBQA 5ICEA 2QSHX 4IEJA 1TC3C 2LR8A 2Y31A 5JHUA 4U0YA 2GA2A 4DIQA 2ADUA 3K4JA 1Z6TA 2XAQA 3GZ6A 2EMFA 4HW0A 2GA1A 4MTDA 4Y33A 2MC6A 4AU7A 3BG7A 2G7UA 2EK5A 1IGNA 1U78A 2MFZA 3W3CA 1YTYA 3C18A 4F7ZA 2JZYA 3RKYA 4IO9F 2EMZA 5HS7A 4KA4A 1RMDA 2KIFA 4N0BA 2DMYA 2EPAA 2L7FP 3A4CA 3AG2H 1L3LA 2Q1ZB 3OMYA 3EYYA 4LF7E 2OPTA 3GTQJ 2RQLA 3OS1A 1YQAA 2CG4A 4XRSA 2EH3A 2FEZA 4UUSA 4JI2E 4L5NC 1I6HJ 4W1UA 3J80C 3IV5A 2GIVA 5KL4A 1SMYF 4UUSB 1TWHJ 1PUFB 4JX4A 4RM2A 1G3YA 4ZC3A 3S15J 3ZPLA 4OIOF 4ZYGA 3Q9SA 5BR8E 3ABMH 3HGGA 1DPRA 2DLLA 3ABTA 5LD2C 3PJRA 3A2KA 3BPVA 1PKPA 1G2FC 2NNYA 1Z3YA 2OQRA 4I09A 2FU4A 3CCQI 1XSVA 4A3EJ 2IAIA 2JA7J 5A69A 2QZ8A 2ZCWA 5CQEA 4ZTFA 2CFXA 2VOPA 3ZMTA 1BB8A 1UHZA 2EIJH 3QPTA 2IS1A 3BG5A 3PNTA 2CQXA 4AD9A 1AU7A 2M5WA 1OCRH 1JKQC 2PJRA 2DA3A 2XGDA 4F9AB 2CW0F 2L4AA 1AWCA 4L8NA 2OCEA 5J4VA 2VE7C 3V42A 3F6HA 2XAFA 2EN2A 4LJZF 1YZ9A 2DGCA 4CDGA 1D3YA 3Q9VA 3OYKA 2IS2A 4DV6E 2EOMA 3HOSA 2XUBA 2HXOA 2JA6J 3GTJJ 2BXYA 4YG2F 1P7IA 4F9BB 5LHGA 2ZJ2A 4Z2YA 3TO9A 2AQEA 2BHZA 4KMUX 1DU6A 4E4HA 4X65E 4E7LA 4RGSA 1N3GA 5FKKA 1RR8C 4G6QA 4A3FJ 2YPNA 2VONA 1S7OA 5AE2A 1YW7A 4LLNA 4MFDA 4I2OA 2V87A 3VYYA 3BR2A 3PL8A 3OWTA 3IHUA 5IOZA 5E18F 1J59A 2L9RA 2E1OA 2J5PA 3BLYA 4DYQA 3W6VA 2EN6A 2EQRA 3O8GA 4KN4X 3AKZA 4PJJA 2YPRA 3C3WA 1AOYA 2ENAA 4D7NA 2EZHA 3KZZA 2N3HA 1XMAA 3EQLF 3EUAA 4ETSA 2Z33A 5DM6F 2LG4A 2EMHA 5DNYA 1VTNC 2L5QA 2CJJA 1BW6A 4XKVA 5E1WA 4PJMA 5ILVA 1LFUP 2MYSA 4BKXA 2OV7A 1GZ6A 5JLWA 5DCFA 1Y39A 2DTRA 4Y3OA 3TP3A 3K1MA 4LLLA 5EGOA 3TW6A 2LBFB 3HOTA 2L8TA 1OCOH 3MD2A 1FP1D 1IRXA 5H6QA 4LTYA 4CZCA 1HKQA 4NB5A 1S7AA 1BI1A 1BBYA 3B02A 2Y0SN 5HDKA 2K9QA 3GTLJ 1KYZA 4HSTA 3AG3H 3U21A 4XLAA 2EPCA 4F55A 2I13A 2A69F 4YELA 3EYIA 4DV0E 2ENHA 4JI5E 3J81C 3V8KA 1FIAA 4N4RB 4XIDA 2HDDA 1XGSA 1VFCA 2QQAA 1Z1BA 1X3UA 2H1LA 3H9GA 3KWRA 2I9IA 4EJUA 1MNDA 1XGMA 1YX3A 4PGGA 2DJNA 3C1DA 3TKYA 4F92B 1BI2A 1BJAA 3WE3A 2L6MA 3O2PE 5LRSA 2WAQA 2NVTJ 1T0FA 4MLOA 2MABA 2KIMA 4J8ZA 3KP4A 3GXOA 2PFBA 3HRSA 3P9CA 5FKLA 1YUJA 2YSRA 1WRJA 2K7LA 3KZYA 2X4HA 4Z6YA 2BVMA 2DODA 3F6VA 1Z77A 3CCVI 1Y0UA 3ZCOA 3HPSA 1TWGJ 2C6YA 1ZAOA 1LDDA 2Z3YA 1SD6A 1OLTA 4WWCA 2KIQA 3NEUA 1LDKB 5LGTA 4KIBA 1BM9A 4KIGA 3TMOA 2P7CB 1HC8A 2IS4A 1X2MA 1LB2A 3FXRA 1IRZA 1J75A 3FBNB 1LDJA 2DN0A 3ABUA 2PI0A 3K4CA 3K6QA 5CJ9A 1VQKI 2DA4A 2Q2EA 3S2WA 2EORA 4KUMA 2OU2A 4EM2A 4B3SE 3KEYA 2JSCA 1F4KA 3OL4A 5FO5A 3THNA 1JUPA 1SD7A 2JA2A 4DYCA 4M3FA 1N78A 2ECCA 4PFPA 1U9NA 3HHHA 5F1RA 2Q0OA 3MKWB 2P0WA 3KLOA 4RGXA 1FPQA 1UB9A 3GZNB 4IXAA 2IGNA 1R36A 2CUFA 3KYLA 2V83A 4HBLA 4D5CA 5D4SA 2VUMJ 1WHNA 4RAGA 2JRMA 1HW2A 1U0JA 1P6RA 4HLXA 3WG9A 5F3WA 4G94A 3IUOA 1HKSA 4XKWA 4CCOA 3DPUA 4B1RA 2FD5A 2LUQA 2A25A 1G3WA 2HZTA 3PSIA 3BZCA 3T0YA 2KDZA 4XICA 4UV8A 3ZRGA 2RSMA 3TOBA 1FP2A 3DP7A 3O8HA 1TNSA 2QVOA 5KAIC 5K7HA 1G2HA 2LKSA 2LVHA 1PJQA 2HC5A 3JSOA 2VL8A 4DUZE 3L9FA 1I3QJ 5JHFA 4RDUA 3RQ4A 2ETHA 1BC7C 4BXXJ 3IWCA 3HZJA 1QPMA 4K0KE 4CSWA 2E2JJ 1HNZE 1JTXA 2D45A 5KK1A 3AUZA 4CYCB 4U88A 1B59A 4W97A 1IV8A 3WTUC 1TN9A 2NYXA 1F5TA 1FOKA 3M99B 1WJCA 4L9TA 3ROUA 1W36C 3QYEA 3TQNA 2L4MA 2EM7A 1KA8A 3QRFF 3C7JA 3HUGA 3PO2J 2YU8A 1JK1A 2LTPA 1X1AA 1EH6A 2K4JA 4BEHA 2MG4A 2Q8KA 4M6YA 5DYMA 2YU3A 3ABKH 2VQEE 1C0WA 2DQLA 1FJLA 4DV1E 1R71A 5IYDJ 4R2RA 4KT5C 4OINF 3S2DJ 4C9YA 5JLXA 3DEUA 4A3KJ 3HJEA 2JK3A 2EPPA 3OYFA 3L7WA 4P7DA 2V26A 1QZYA 1DUXC 3SEQA 3L2WA 5TSEA 3F72A 1FEXA 1JJ6C 3H9JA 3TOAA 4I99C 4XLNF 4S05A 1UELB 2E2IJ 3RCOA 1E0EA 3ZMUA 5D5WB 2EOSA 4AVPA 2Q8UA 1IXCA 4ASNA 5CVRA 4KT6A 4R79A 3MWMA 3RQIA 2ODRC 5LLQA 1ODDA 4RB3C 2XAUA 1QGPA 3CCEI 5CLSA 1D1AA 1IN5A 1MMDA 2QQ8A 4MGRA 4KZSA 1LFPA 3MZYA 4MNUA 5FFXA 5C44J 2CT1A 3F8NA 1TQMA 5HLIA 3S3MA 5IP9J 3E3VA 2FTXB 5K5RA 4XKCA 1K4SA 5CVIA 3DJWA 1X3CA 2K9SA 2BEOA 2XF6A 3RMPA 1IRFA 4XR6A 4M9VC 2AO9A 4MEXF 3ELKA 1TZLA 2EMGA 4HDUA 3CMAI 4WF2A 2YTJA 2DQRA 1JHHA 1FY7A 3GZ5A 5BOXA 2EOQA 2PMZN 2M4IA 3H35A 1Z91A 3JREA 1VQLI 2BY1A 2EPXA 2OA4A 1OCCH 5GPCA 4IX7A 4A93J 2WB1N 4FQGA 1X3WB 2KMUA 3C6KA 2E5NA 1AKHB 2GXGA 4WPYA 2FSWA 4G6TB 3C2BA 5CQGA 5B66C 3BIDA 4B09A 2E7XA 3OY9A 2KONA 2WY7Q 3NRVA 2E1MB 3FIGA 3TDZC 2YTDA 4Q4ZF 1FC3A 2HYFA 5A2QZ 1PP8F 2KISA 4RB1A 2HQ5A 2V7FA 4BBRJ 2ODRD 4ZYHA 5KL3A 2R76A 2GWRA 1YYVA 2WBTA 1TBXA 2DOEA 5A6AA 2CFOA 4PUSA 4JI8E 1RIOH 2ZNZA 2CUEA 3I64A 3RTRA 1IJWC 4O43A 2L7MP 3BP8A 3HHGA 2XPVA 1R5ID 2X1EA 2PLYA 2M7BA 2JVAA 3KYDB 1V5FA 3QAHA 4JX6A 2NUEA 3QP6A 5EEAA 4FHTA 2K7IA 4HF2A 1B4AA 1LLMC 5F08A 4UVCA 2HS5A 3LQRA 4CYDA 2EZIA 3T1BA 4FETA 2OZ6A 5E3LA 2M30A 4XKBA 3GO5A 2BYVE 1FOWA 1PYVA 4O5VA 4RAZA 4IRGA 5BNGA 2N8XA 2KHXA 2EMLA 1VQ5I 4CA0A 1U5TB 2EM5A 2EM2A 2KT0A 2FBKA 4A3CJ 4OIQF 4JI1E 3SZGA 2UXNA 2M8GX 3F0CA 4M9ZA 2JUCA 2JXPA 2WC2A 3F8CA 1VQ9I 3HSRA 1ETVA 1FBSA 4A0YA 4WSPA 2V85A 1W7PD 2I8DA 4F9CB 2L3CA 4KYWA 3F9KA 2EZLA 4HF0A 5BPIA 3MQ0A 5F6FA 1I1GA 1DGWY 2ADRA 3AL0C 4AIDA 2X6YA 3GF2A 3QPHA 4XSZF 2DCEA 3CCLI 3DEEA 2BB8A 4X1EA 3DLLF 3GFMA 5F27A 1R7JA 1IBME 1P2FA 2MLKA 2DW4A 1X5WA 4M6VA 2ELKA 3VB2A 3VYRB 1FKAE 2W57A 5JR3A 3V7RA 3CQZJ 5FKMA 4U7DA 5J47A 5H6RA 3CCMI 3FM5A 4CCNA 4MQVA 3CP2A 4X9JA 1D5YA 2VKDA 4WYQB 1HSJA 4P9FA 1WPKA 3CC2I 3FXOA 3C6MA 5LRRA 1DP3A 4NXME 1ZU1A 4JP0A 2EM8A 1IRGA 4GYGA 1TL8A 1HNXE 4CZZA 4R8HA 2VJIA 1SFXA 3DKXA 2MC3A 2ISZA 2LF7A 3CMEI 2FA5A 2AQFA 1P92A 1LFBA 1CF7B 2HR3A 1TWAJ 5EEHA 2DT5A 4BUPA 4DR5E 4GFBA 1T4NA 3K7AJ 3HBLA 4RAFA 3BCBA 4QPOA 3GMEA 4X0GA 3CCJI 3RZOJ 1IN4A 1MBEA 2F4OB 2EA4A 2VKVA 4JX5A 2YSOA 3F8MA 2EFOA 3S8PA 1G3SA 1ETYA 3G2BA 2EM6A 3D0SA 2EM3A 4KN7X 2CTDA 5IPAA 2EQ0A 4B3TE 2EFPA 4II3A 3WU1B 2WADA 3FK7A 3H92A 1X6FA 1D5VA 2XB0X 3C2HA 2LMZA 2D9HA 1W5TA 4TUIA 2F4VE 1LVAA 1YFHA 4R2SA 2DIXA 1WJEA 4F6NA 2B9SA 2IBDA 1HDPA 4WFTA 2Y69H 1U8RA 4L18B 1MMGA 2X9DA 4MHGA 4XLPF 2YTEA 2OTJI 1YO5C 2V6CA 4V19K 4YY3E 2EPUA 1TF6A 1FMVA 2K02A 1V55H 3WTYC 1ETOA 2STTA 1YX5A 2X85A 1X1DA 1XCVA 1ZBQA 4LFAE 2JOXA 4JK1X 2B3TB 3ZQIA 2XKPA 3DXJF 3BWGA 4MQ9F 1O3TA 3BZKA 3CUQC 2KOUA 2OC6A 1U2WA 2EZ6A 4AIHA 3HOXJ 4LF6E 3LL7A 5IWAE 2NS8A 3RPUA 1YS7A 1TQIA 2BY2A 1HF0A 1UZCA 2Z9OA 2L7ZA 1RR7A 2VKEA 2Z1DA 1WWXA 3VYUB 1ZG3A 2Y2ZA 2GHFA 1W7PA 3J81K 4CHUA 5L3DA 3KP6A 3FKIJ 5EDNA 2EOZA 3SZTA 2GOMA 4B47A 1ZR4A 1ZAAC 3E5XA 2EIMH 5GPAA 2FX0A 4OIPF 2WV1A 4DJAA 3S14J 2XGXA 4G9YA 2DA6A 3L2QA 2R7VA 1KZHA 3F23A 1X48A 1I39A 3ZMZA 3SDGA 2V1XA 2IGMA 2NS0A 5HODA 2R7ZJ 2LRSA 1UJ8A 2M0CA 4NHJA 4DV5E 2HZDA 2KQRA 3J7AY 1IF1A 5L3FA 1D0YA 1T95A 3VYXA 2YT4A 4B3ME 4Q48A 5BS6A 3WTWC 2QBYA 3EPLA 2DFIA 1SD5A 5CPRB 5HLHA 2A5WA 2F8BA 3OIQA 1CQTA 2NRAC 2QBYB 4JI7E 4BEHB 3TW7A 4BC9A 3KCCA 2Q2EB 4F93B 4RLFA 4A69C 2VASA 3GX4X 5DD8A 1NH3A 2LTSA 2EMBA 2F5DA 3CJNA 3GTPJ 3KEOA 4G12A 5AONA 3KE2A 3K10A 2BY0A 1ETQA 4X64E 2K9NA 3N4MA 2B9DA 1RC7A 2ZC2A 5JVTA 1AAYA 3L2CA 5B3SH 5F0FA 1PDNC 5BMZA 2H6BA 1YW9A 2V9PA 3W2WA 2DDBA 2W85A 3G73A 1MJBA 1GXQA 4CH7A 4DR1E 2EFNA 3W2VA 2LO3A 3FBIB 3GFJA 3ULQB 1SVMA 3DFGA 1H9GA 4LG3A 2LRDA 3Q0WA 2ZMEC 1UILA 3I54A 5FD6A 1FNNA 4XN3A 4IJDA 2AXLA 2BGCA 2RC4A 3PUBA 5J1YA 4G8XA 1XDUA 1IZ1A 1NK2P 3TO7A 4KHPE 2EN1A 2W4SA 2V1UA 5KL2A 5KL6A 1X58A 4RGRA 1VQ4I 3WTVC 2VJ5A 5F1JA 5ED4A 4G7ZF 2CV1A 5DEQA 1B8IA 1BJZA 1WXRA 2Z99A 3HRUA 2LP0A 2H94A 3GYHX 1R1TA 2PMHA 3QOEA 4NQWB 2F4IA 1ORKA 1UN6B 5L3EA 5D6EA 2WB1A 2PJRB 1VI0A 3CD6I 4RB0A 1GTKA 2ZNYA 3PUFA 4BL0B 1WVRA 4NC8A 4BE1A 2VT3A 2ESHA 1Q1VA 2CQNA 4YIFA 2UXBE 4NBQA 2ZKZA 1QQIA 2GOXB 1UMQA 2JUGA 1QHHD 2BVLA 1QU6A 4FT8A 1KQ9A 2V89A 2NVUB 3U1DA 2OJED 3L1PA 4P55A 1USTA 4L0ZB 4KMFA 3CF5F 4LFCE 2P7VB 2L33A 4AWXB 3FXUA 1VF9A 1ZG1A 5E17F 5LGNA 3I4PA 3NWTA 2UUCE 4PDKA 3COAC 3EPKA 4ZDPA 2K5CA 1ZRCA 2CV2A 2CUJA 3HL2A 1U5TC 4OU0A 5DS9A 1I27A 3JTGA 2R7RA 2NUGA 2VQCA 3RPUD 2JA5J 1BR4A 3K70D 1A1KA 3HPGA 2L7KA 3LNQA 4YFKF 2XSJC 4LIUA 1TW3A 4LF5E 3JU0A 2EILH 3GWZA 3B6AA 4AYBN 1R6RA 2CO5A 3KETA 2NOJB 4HOBA 3FMRA 4IHYA 3CCUI 1OR7A 2DXIA 4WXDA 3BF2A 3JRIA 2W7NA 1JKRC 4JV5E 3DF8A 3SDBA 2L2NA 2VC0A 2O0YA 5HLGA 4B3RE 2PRTA 3FXKA 2V1NA 3IH2A 2LBFA 1R49A 2DI3A 2RNJA 4GKJE 2K9MA 5E20A 2OZUA 2CUZA 2EP3A 1T38A 1WJBA 1A1JA 4DR6E 3JAMC 4OX9E 1IXRC 3C2GA 4DV7E 3E5UA 1YOVB 4BE0A 3X2QH 3OS0A 2XSDC 2MH2A 1W36D 3IP4B 4PJNA 2VPRA 3H3UA 5ERIA 2HKXA 3FXMA 3R0AA 3ZMDA 2DSYA 3LA3A 4IVNA 3SXYA 2ZBKA 1REPC 3VHTB 4PJ0C 1I5ZA 3BY6A 3KX2A 1YRNA 4IQJA 4JYAE 1TWCJ 4YRVA 5DM7F 1QU3A 3M1CA 1AHDP 2J5OA 1I1SA 1OFCX 1SEUA 2FJ1A 3HEFA 3MKYB 4BBSJ 3B73A 1O7LA 3G4SI 1H88C 1G59A 4LK1F 3DBLB 4O3MA 2MH9A 2YRMA 3M8EA 5JI6A 3JRHA 2IGKA 4F54A 1HOMA 1R9TJ 1YIOA 2MLGA 2VJJA 5K7ZA 4M71A 3BBGA 4Y7NJ 3N05A 2XPUA 1HSTA 2E5ZA 5D8LB 2RKHA 3BTJA 3IH4A 2LF8A 2F5EA 2COBA 4LD5A 1JTYA 4LFBE 4M2ZA 2LLKA 2P5LC 2PG4A 1HR0E 2QKLB 3BROA 2DA5A 2EFWA 2EN7A 5D6FA 1X1CA 1A1GA 2KHMA 2LSOA 2PN6A 4XRMA 2EPKX 3P7NA 2B7TA 1XPXA 4I0BA 1MW7A 2Y9YA 1YJWI 5IT9Z 4BJ6C 3PIPF 1FLIA 5KHDA 5A2QK 2L01A 2DAOA 3HIFA 5GTHC 3VOEA 3IRQA 2ZMEB 2BZTA 2O8KA 1E2XA 2OUMA 5LHHA 4U0VA 3A02A 4Q5SF 2RGVA 2M8EA 2MDGA 5IP7J 3FF5A 4FX0A 2DMPA 1UHWA 1A1IA 1YJNI 1HKTA 3CUQB 3G1OA 4D9JA 2R7FA 3LMMA 3FZVA 1V3FA 2D2WA 2YTIA 1YYKA 3JRGA 5M3FJ 3KP5A 4HV5A 3W6JB 1MSEC 3K6GA 5E8GA 1MBKA 3S1QJ 1Z67A 5A6BD 3A1YA 2X6OA 1K79A 4BBYA 3PO3J 1HW1A 2XROA 5C3EJ 3D5RC 3SFZA 2M1BA 3GCMA 1YS6A 5L3CA 3IWFA 5FLVA 4JBAA 3BR1A 2RTXA 4Q47A 1ZQ3P 2IP2A 5EEGA 2KJBA 4WK8F 4LF4E 4M73A 2WWYA 1IC8A 2E35A 4PJLA 2EPOA 4A3BJ 4IQ4A 1HW5A 2PX9A 1KJKA 4J00A 2L9SA 1A6IA 4HYEA 4A6DA 4B43A 4MIMA 4Q28A 1T98A 1DU0A 2UXDE 4J01A 3DQVC 4XL9A 2M9AA 3ZP5A 4R2DA 4XN0A 1Y0NA 1ZN2A 4PFOA 3SJMA 2YZTA 3ZOQB 4DKKA 2FMYA 1ETKA 5IOYA 4C3JJ 3HOZJ 1OMIA 2YU9J 5AE1A 3LSKA 1FWZA 3ASOH 4JQFA 2K86A 5IV8B 5BQTA 3MZ8A 3J80K 3V8LA 3ZOBA 4B44A 4OOGC 3K4BA 1X1BA 1EKZA 3JTHA 2EPFA 5E3OA 3C4TA 1Z7UA 2L9VA 4B3XA 1MGTA 1Z7LA 1A1FA 2L92A 1A04A 3HSFA 2ID6A 1YI2I 2HDCA 3LSMA 2GIZA 3A01B 3MN2A 1BIAA 3RDIA 1B9MA 4HG2A 2HWVA 3TQMA 2JSPA 4Y52J 3S32A 2KPMA 2RS7A 1GLNA 2EM0A 4ZYEA 3D1NI 5DD4A 4AVZA 4EVIA 1ONVA 2QENA 4A3JJ 2LC2A 4KWYA 3S93A 1SAXA 1ZBTA 3KEQA 5J6XA 2ZM6E 5J8CA 5D5XB 4DBRA 2HKOA 2V4JC 1S9HA 1MBJA 1BC8C 1I3AA 1JT6A 1SVOA 2E72A 2LT7A 1DI2A 2EE8A 4MEYF 3S3NA 2X6WA 3QOPA 1ZGJA 2HEOA 2PMUA 2GXBA 5LMUE 3R4KA 2EOIA 1X3ZB 3PNYA 2RSIA 2DFEA 2MD0A 3CC4I 2EIKH 1LVKA 2ELHA 1IQSA 3QPSA 4HEA2 1J2XA 4RGUA 2YSPA 1V5GA 4OIRF 1W7PB 3BG3A 1U6GA 3S16J 1OJLA 3S2HJ 2JVHA 1R4MB 1Q1HA 3M9AA 2VXDA 2L3DA 3HM5A 1DDNA 1IUYA 3WU2C 3J81Z 4C3IJ 5HLTA 3WTSC 2R7WA 4EJTA 2TRTA 3J7AO 2JTVA 2W82A 1HA8A 2DA2A 4KITB 2M4KA 2KRCA 3ZQCA 4II2A 2MD5A 2RS6A 4M9SA 3ASNH 1DQUA 4M3EA 2EMCA 4S04A 2A5YB 2XF7A 3LSTA 1JGSA 2CH0A 4M3DA 5E1ZB 3TBIA 1ETXA 2CQQA 3H09A 5LEJA 3EUKL 4DV2E 1A35A 3L00A 4LIVA 1SR9A 3H36A 2DK5A 1LJ9A 2QGUA 5HS8A 4WCGA 3HC7A 4ZJZA 1S8NA 4MFEA 1D0ZA 4RMNA 1VQPI 1A1HA 3U2RA 4H0EA 1WI3A 5FD5A 1VQOI 4JOMA 3QG5C 4DYRA 3HGYA 3OYNA 2RN7A 1LE8A 4BCAA 3G1LA 2KRFA 3OL3A 4K2EA 2EB7A 3MHHC 4E7SA 4D0PA 2RPCA 3BZ6A 5FLXC 2FUG2 1WJFA 3OR1C 4DV4E 2G0EA 1XGOA 2H27A 1B1BA 2JT1A 2HPIA 4LK0F 4XLEA 2OD5A 3CDIA 1EJ9A 4BACA 1K6YA 4BDYA 3IC7A 4RH8A 4NC6A 4RB2C 2F48A 2EMKA 1KQ8A 2LOOA 1LEAA 2JPBA 2VXZA 1X1PA 2XV4S 4B8XA 4QLCU 4U7BA 4XOPA 1ITYA 2KZVA 3K2ZA 4GRIA 3GTOJ 3P9KA 3ZMSA 1P9QC 4XRSG 5AIQA 1IV6A 1T4LB 2VQFE 1HQCA 2HPMA 4YHHE 3BDDA 4CCLA 1K78A 3RKXA 2DLQA 3OYDA 5HDGA 1J9IA 1SAUA 2FOKA 3VPRA 2ELZA 3F8FA 1UHSA 2PBIA 1GVJA 4HAMA 2A68F 3HG9A 2MC5A 2RNGA 4LFUA 1F9NA 1R58A 1BN5A 2DA7A 1MNMC 2G7HA 4N9IA 2JRTA 2CRGA 3WHCA 3M8JA 2G9WA 3LSHA 1QRYA 4LITA 1K61A 1ZYRF 4XOTA 1LEBA 2EMAA 2H6CA 2XB5A 2IPQX 2LH9A 2KKOA 2HOAA 5JFRA 3MVPA 4EATA 2JQ7A 1BR1A 3S1RJ 1XC5A 3ECOA 5TGTA 2NS7A 1WKMA 2W00A 1T08B 2IA0A 3FHZA 4IHTA 1X4PA 3SYTA 2LD5A 1DP7P 1BR2A 3DKWA 2CW8A 2VBWA 2COMA 1FSHA 2E1MC 5M3MJ 1YIJI 4IHSA 4BU2A 5IY5H 2BW3A 3I9V2 1Y8RB 1D1CA 2MBFA 4LG0A 3I56I 3CJTB 4XMYA 2DOFA 3MKZA 4JI3E 1S72I 2FOWA 1PJSA 1U8BA 2YRKA 2V6EA 1IDZA 5FJ8J 3CMMA 5FKOA 1QZZA 4OMZA 5IP6A 2XAHA 5K1YA 4F91B 2EFQA 1YSAC 3EPJA 1R5GA 1KYWA 1UAAA 3NAUA 4P1WA 3LOCA 3OYEA 2WY8Q 5GTIC 2BY3A 4R2CA 3LSJA 1Z9CA 1Z21A 1FSEA 3KZIC 2W1OA 4KIFA 3J7Yp 1SANA 3AG1H 4O5GA 3H5RA 4GKKE 2CS3A 5F64A 4XORA 1OCZH 2XIGA 2AS5F 3HPHA 4L5IA 3OMLA 3F6OA 3FHNA 2QUFA 2GQQA 4HV6A 1ZRFA 4HX7A 1R5HA 4BQQA 1S6LA 2LJUA 1ZR2A 5EF6A 1B9NA 5HNFA 3OSGA 1JKPC 4DR2E 1ON2A 3ZGKA 3M8FA 2PEXA 2DTZA 4C2UA 3ADIA 4HDVA 4M30A 5CVVA 1K4TA 1NTCA 2HQRA 3LAPA 5LMNE 1IBKE 2ZMEA 4WX9A 2KFDA 2DU9A 1EH8A 4S0HB 2MDRA 1VQ6I 2F6CA 3ZN1A 3H5NA 1Z6RA 1S3JA 2NVYJ 2HVSA 1Z3XA 3BG9A 1O57A 3D5SC 2XAJA 3DF6A 2K27A 4DOZA 2L3JA 2EBIA 2VE9A 3HOVJ 1GUUA 2H1KA 3HPZA 3AAFA 4BHCA 4FX4A 2VBZA 5IT9K 1IMUA 2M9HA 9ANTA 2N3GA 4IHVA 4E7KA 3GUDA 1TP4A 1JUMA 2BV6A 2UXXA 1VZ0A 4A5NA 4RHBB 2ZXHA 2E34A 2R93J 2XC7A 2KIUA 1Y6IA 2ZFWA 3DLAA 2ID3A 3OSFA 2ECBA 2X1DA 4XM3A 4ZH4F 1G4DA 2P6SA 3HDDA 1T33A 2FNAA 4F6MA 2ME0A 1EV7A 1T0FC 1MMAA 3FKJA 5DV5A 3IWDA 1W5SA 4P96A 3T8RA 3WG7H 2LUPB 3ZQQA 1XG1A 3Q3SA 3M3YJ 4A6EA 4ZZDA 1JE8A 5K7FA 1RETA 4CYCA 5AC4A 2HNHA 3HOYJ 2KJCA 2ZFUA 2R7SA 2E71A 1WJAA 4XLCA 1MDMA 3BJAA 4U0WA 3TP0A 2NVQJ 2JJ7A 1XSXA 3I58A 1W0TA 2P81A 3R6SA 3MKLA 1WHQA 3NQOA 3L2VA 5HOOA 2LY9A 2KL4A 2MGQA 1EKEA 1TNTA 1PJTA 1B72A 1SFOJ 2WCC3 2VPLA 4NXNE 1O3SA 2EPZA 3KYCB 1IXSB 2K40A 2R1FA 3IWZA 3KP7A 3ZMVA 1X6EA 3JTZA 1W5CC 3LSRA 1IDYA 1E3HA 3K69A 1XSDA 3CO6C 4AC0A 1ZTRA 2LVSA 3E5QA 4DQ2A 4HX4A 4IS1C 3LA7A 5LBQA 5LFAA 1W1WE 3DTIA 3L09A 5FLXZ 3A01A 4P9UA 5J1RA 2P8TA 3RIRA 4L9NA 2HHHE 3UKGA 4O4KA 3EPZA 4P5OA 2M3AA 1KONA 2M0MA 5DCMA 1MKMA 4RA2A 4Y13A 2DBBA 2R0QC 1BW5A 1WJPA 1QPIA 2VBXA 4N9HA 3P5JA 1GT0C 1OCPA 2D1HA 3BPXA 2MC4A 2EPLX 4BNCA 6PAXA 2YRHA 2P6TA 3GEZA 3HKZN 1OPCA 4N4OB 1TWFJ 3NARA 3E6BA 1YPNA 1MJAA 2IHR1 1K6OA 4JYKA 2DYRH 1RNLA 1ULYA 3T8TA 3S3OA 4DGWB 3DWLE 4UXNA 1GV5A 1KQ0A 3WGGA 1V54H 2A61A 3WODF 1TW2A 4BDZA 1P4WA 4UHTA 3CF2A 4M6XA 1PVEA 1FX7A 2Y9ZA 1XNRE 3K4LA 2Z16A 1VQ8I 3OTOE 1RI7A 4CGZA 1UBDC 2F5VA 2YU5A 4WXCA 4AM3A 4BYYA 1VQMI 3I0TA 2NABA 3MSWA 1RKWA 2IJLA 2HDWA 2VC1A 3PQKA 3F8BA 4FE4A 5HNHA 2LKXA 1M1EB 4A3MJ 1ZG5A 2B0LA 1WI9A 1MMSA 4MLVA 1I50J 3OYIA 3RPQA 5D5UB 2E1MA 5IT9C 4LU9A 2R7QA 3DPTA 2R5YB 4X62E 2K9LA 2FQ3A 2XRLA 5CYVA 4ZTJA 4P78A 2FQ4A 4F3QA 2EM9A 5CVUA 2E2HJ 4ZDLA 2E19A 1QA6A 5EGOB 4RS8A 3QU6A 3ECHA 5TRDA 1X6HA 3G3ZA 2FMLA 3OYJA 3DBHB 2EV5A 5B5EC 2UXCE 4OMYA 2LTRA 4BJTA 1JK2A 3FXQA 3HOUJ 1XD7A 3WE2A 5ICFA 1J7KA 1H8AC 1MSFC 3PNVA 2DPUA 3ZN0A 5F0HA 4B48A 4F2JC 2X51A 3REOA 1KU2A 3CUOA 3QWLA 1WGXA 3SQNA 1H89C 3BR6A 2IXSA 1ENHA 2LKPA 4L0YB 4R03A 3A0HC 3ERMA 1JXSA 1STUA 2DMNA 4YEJA 5TISC 4DR4E 1WHUA 4ON0A 5J3LA 1ZREA 1ERDA 2LNBA 4FE7A 1VNDA 2WTEA 2L0KA 4BHPA 4UY8I 3E1SA 3J7YJ 2GAUA 3ABLH 4A3LJ 5ICGA 3RJPA 2YS9A 4GEQB 1NG7A 1Z05A 2PMZA 4F52A 2VT2A 4BE2A 3KFWX 4V2FA 3VSLA 2NUFA 2K3FA 4J19A 2WBUA 5J4YA 5J1UA 4HLYA 2OQGA 4AYBA 3JAMZ 3CZ6A 4GDFA 2Y0SA 4ENKA 1ZRDA 3K4KA 2HI3A 1HBXG 4UUVA 5EZGA 2E1NA 2IEKA 4L5EA 3Q5FA 3VYTB 3OIPA 3OV8A 4HA8A 5FKNA 1XDSA 2M87A 4QIWN 3CTAA 3NWSA 2K3PA 2RV8A 2JYAA 3K9TA 4BQAA 3BR0A 1U9OA 2LY2A 5B1AH 1WZ2A 3K0LA 1BI3A 3ZQHA 4KJZA 2VI6A 2CW7A 3ZQ7A 1ZHFA 4LB5A 2EWLA 3HKZA 4M9XA 1Y1VJ 1J5EE 3HQ1A 2JPCA 2CU7A 4A5MA 2QA4I 2DYSH 3JRCA 1D8KA 3L2UA 1HXDA 2RVCA 1SFKA 1F1ZA 3P9IA 4HPQA 2UZKA 1XMKA 2IA1A 1YHQI 5DUIA 4A3IJ 4JI4E 2O5RA 1GXPA 4WXHA 2OBPA 1U5TA 1YJ9I 4LF8E 2VKHA 3F3XA 1MMNA 3WTTC 3LMLA 2CQ7A 4C30A 1O3QA 2VN2A 2EN4A 2VRDA 4PSXA 4NNJA 3CMYA 2UUBE 1R00A 3PQJA 1UHMA 1X4OA 3A03A 5KCMA 1NEIA 1IBLE 3BCAA 4DMIA 2WAQN 2JR1A 5ILSA 3V7SA 2R7UA 1V5EA 1GDTA 2DMIA 2ZSHB 3WTZA 1MZBA 1ZK8A 1N36E 3HTXA 2QYOA 4EM1A 2HVRA 2R7DA 2M34A 3JSPA 4HEIA 4B3AA 4CCMA 2L54A 3CP8A 3GLLA 2R7TA 1QNTA 1PUEE 2STWA 5LL6R 3SZPA 1X47A 4HX8A 2M45A 3RYPA 4ESJA 4Q35B 2IVMA 5DDGA 5GAGJ 3VFZA 2GXAA 4Y15A 3IH3A 3OYGA 2TCTA 4A3GJ 2E60A 2EN3A 4X8WA 2H8RA 2D1VA 2HQNA 4C2MJ 4HTGA 5IXMB 1X49A 1FOXA 1KU3A 4HRIA 2GPIA 4ESBA 3LFUA 3ZR8X 2A6HF 3FMSA 3IAS2 2XKOA 3LAJA 1MBHA 3OYMA 2EOXA 1J0RA 1FBQA 3HOWJ 1N34E 3PFYA 1I6XA 1RKTA 4ESFA 3OYAA 4RAYA 4YIIA 1LNWA 5FRMA 5E3MA 2DB2A 4I76A 4GGGA 1XS9A 4PK4A 4BY1J 3S1NJ 2JWTA 3LQQA 1FTZA 1PP7U 2YTGA 1AA7A 2ISYA 2ZXJA 1JJ8C 3UR3C 3LSPA 1FYMA 1SFEA 4XBFA 2JY9A 2RAEA 3OYLA 2HGHA 2DO7A 3QP5A 4HNUA 3FX3A 3LSIA 4EGYA 5ADZA 2GLOA 2EMXA 2M2EA 1FJGE 3DPLC 5GADJ 2ZXWH 2EQ3A 2WAFA 3DEWA 3DKYA 1YLFA 2I10A 3WGIA 2JA8J 2N8GA 2M4GA 4BQOA 1UG0A 4G7OF 3HXLA 3RZDJ 5E8IA 2KRHA 3O6BB 4XNFA 2HOEA 2X1CA 2MKDA 3K4NA 2R7XA 2HXIA 2Z2SB 1F36A 2UUAE 4HQMA 1IO2A 5CKTA
chains in the Genus database with same CATH topology
3EUHA 4DV3E 4OOIA 2IRFG 2FNPA 2E7WA 3AV0A 5HVQC 3J7AG 4JI0E 5D5VB 3JW4A 3V8JA 3I5UA 4EJVA 4ENNA 2R3SA 2YX4A 4G7HF 2NAZA 4LMYA 4IRHA 1FZPB 3KP3A 3P1XA 4A12A 4M74A 3N97A 3RYRA 5FFZA 1FYLA 5CVJA 1KGSA 1ZLKA 2O8XA 2QWWA 1R22A 5LHIA 1XN7A 1WQ2A 1N32E 3D5LA 4NQWA 2XASA 3QU3A 4LF9E 5L3GA 3E6MA 1XMOE 1IN7A 1IAWA 1XNQE 2XVCA 4KNYA 5L3BA 2E5LE 2P5VA 4YFNF 5ICCA 4LGWA 3V4GA 3O3KA 4ZZLA 4UV9A 1GQEA 1R1UA 3WU0A 4GXOA 3IRRA 2E1CA 4AQYE 3GFLA 4CO8A 5K5OA 4Y17A 4ZYDA 2FBHA 1T6SA 5LGUA 3VK6A 1V4RA 3KP2A 1ZGAA 2V88A 3F21A 3WTXC 3E6DA 2GZWA 3OOPA 2ACJA 4EMSA 1FT9A 1TTYA 3VEPA 1TLHB 3K1PA 1ZH5A 5BPDA 1QO0D 5FLXK 2RQPA 1JHFA 3I71A 5AIPA 4EJWA 1XCBA 5LEKA 2UU9E 4I01A 2O3FA 2UWMA 4UVAA 3HSEA 4GCVA 4E70A 1J26A 4L5JA 1XMQE 2QM3A 2LBSB 3LLHA 4CXFA 3WGHA 1K7AA 3C4BA 3TO6A 3F6GA 4EV0A 4KFCA 2RDPA 2A6EF 4XRFA 2O6GE 3FM3A 1O3RA 3ADLA 4EQQA 1RUNA 2IA2A 3HRMA 2X0LA 4A2UA 5IT3A 1G6NA 2CPNA 5TJJA 5K5QA 2IW5A 3I59B 3M7GA 3MCZA 2JOBA 4ENJA 2K4VA 4UVBA 3I59A 4DUYE 4A0XA 1T39A 2VODA 2CQKA 4HQEA 1O0WA 4BXUA 3BOQA 2Y0MA 1YYWA 1J5YA 3ADGA 2EJRA 1USSA 1RUOA 5HDNA 4XSXF 3EDPA 4G6DA 2YX7A 4IRIA 1W4MA 4GYIA 3R60A 2FGGA 2YR2A 3E6CC 2P4WA 2PQ8A 1NHAA 3J80Z 2FBIA 5FB2A 2IT0A 2L02A 1OYIA 1K78B 1XB4A 4R1HA 1BOAA 2XHKA 4CICA 3FMQA 2ESNA 4L9VA 1OYYA 4LLGF 1T2KA 4AIJA 1DPUA 1KU7A 3MEXA 4I02A 4KDPA 2VBYA 3KLNA 1GHCA 4DR7E 2A3SA 1XGNA 3LWFA 3ERED 3TGNA 3MZHA 1YW8A 1HNWE 4MTEA 2CWEA 2LDUA 2EWNA 2VE8A 1I94E 1OKRA 1MJ9A 2H09A 3GFIA 5H20A 1RQ0A 1D8JA 2V1DA 1MD0A 1CF7A 1P4XA 3M1EA 4EM0B 4O6JA 3EETA 4DR3E 4UNOA 1FYKA 4QWQA 4EGZA 4LB6B 3H3ZA 4A0ZA 2FRHA 4ENMA 2H36X 4BC7A 3MFKA 3GLXA 2XRNA 1FBUA 2ZO4A 4IPAA 2BE5F 4PCQA 1E17A 1U3EM 3GVAA 2O61A 2F2EA 3VODA 2OAZA 5J8FA 2LJHA 2WV0A 4X66E 1DQ3A 3IKTA 2L2MA 5AE3A 3LFKA 3T1YE 3HTUA 1S29A 1UFMA 4DNCA 2BBYA 3BJ6A 4I7HA 1B6AA 1LQ1A 2F5CA 2W25A 5E1XA 5ILUA 3HYIA 2Y75A 2DK8A 4M72A 2VF1A 2W24A 2Y48A 3RI4A 1STZA 2XAGA 4M0VA 5KVRA 2M1SA 1OYWA 2QQ9A 3GW2A 1T4OA 2EV0A 2VOOA 1R1VA 3BJOA 1N33E 1IN6A 4I98B 4JI6E 1IW7F 2FF4A 4BMJA 1CGPA 2PJPA 2JWOA 1SD4A 4I0AA 3TDUC 2M7QA 3E97A 4IJAA 3CDHA 4BHBA 4HF1A 2FXAA 2HTJA 1ON1A 2QLZA 3U9GA 3JAMK 1YYOA 1ZARA 2LE2A 1SMTA 3IWBA 1RZ4A 2V79A 4I8OA 3T5XA 2FE3A 2V9VA 3RKWA 2HTSA 2W84A 3R0JA 2A07F 1TQPA 4BH9A 2EA2A 2HGCA 4L9JA 2DPDA 1O7FA 2B7VA 1MDMB 2NNNA 3ISPA 2L2KB 1ZLJA 2Z5UA 4AIKA 3DV8A 2V86A 3HRTA 1UCRA 2O03A 1R23A 5CFFE 3V7CA 2CGPA 4PGHA 4KICA 3FWEA 3CUQA 5D4RA 2V8QB 3I53A 3PFIA 4BAYA 4LG0B 3SHFA 5D8KB 3HTSB 3T1HE 3CLOA 1BI0A 2FV4B 1H0MA 3ADJA 4EJOA 5DCMB 3LA2A 2CYYA 3K1NA 3CO7C 5FGMA 1L0OC 2F5FA 1BIBA 4PZJA 1G3TA 2P5KA 3ML6A 3IKVA 4HZFA 1IN8A 1WSUA 1Z1DA 5A2QC 5DUKA 1YG2A 3R61A 2EV6A 4R8OA 4GO1A 1P4AA 4TV7A 3W6KB 2MA3A 2CSOA 1QBJA 4YFXF 5T6JA 2HFHA 3F22A 4BS9A 2K4BA 2NA2A 1SFUA 1KU9A 3IL2A 1H9TA 2WZOA 3MAJA 2QQBA 4TUGA 1EH7A 5AASA 2TDXA 2HYGD 4IF4A 5HS9A 5ICEA 5JHUA 4U0YA 2GA2A 2ADUA 1Z6TA 2XAQA 3GZ6A 4HW0A 2GA1A 4MTDA 2MC6A 2G7UA 2EK5A 1U78A 1YTYA 3C18A 4F7ZA 2JZYA 3RKYA 5HS7A 4KA4A 2KIFA 4N0BA 2DMYA 1L3LA 3EYYA 4LF7E 1YQAA 2CG4A 2FEZA 4JI2E 4L5NC 3J80C 2GIVA 1SMYF 1G3YA 3ZPLA 4OIOF 4ZYGA 3Q9SA 5BR8E 1DPRA 2DLLA 3ABTA 3BPVA 1PKPA 2NNYA 2OQRA 4I09A 2FU4A 1XSVA 2QZ8A 2ZCWA 2VOPA 2CFXA 3ZMTA 1UHZA 3QPTA 4AD9A 2M5WA 4F9AB 2CW0F 2L4AA 1AWCA 4L8NA 3F6HA 2VE7C 2XAFA 1YZ9A 4LJZF 4CDGA 1D3YA 3Q9VA 4DV6E 3HOSA 2XUBA 4YG2F 4F9BB 5LHGA 2ZJ2A 4Z2YA 3TO9A 4KMUX 4X65E 4RGSA 4G6QA 2VONA 1S7OA 5AE2A 1YW7A 4LLNA 2V87A 4I2OA 3VYYA 3IHUA 5E18F 1J59A 2J5PA 4KN4X 2YPRA 3C3WA 1AOYA 2N3HA 3KZZA 1XMAA 3EQLF 2Z33A 4ETSA 5DNYA 1VTNC 5E1WA 5ILVA 1GZ6A 5DCFA 2DTRA 3K1MA 4LLLA 3HOTA 2L8TA 1FP1D 5H6QA 4LTYA 1HKQA 4NB5A 1S7AA 1BI1A 1BBYA 3B02A 5HDKA 1KYZA 2A69F 4DV0E 3EYIA 4JI5E 3J81C 3V8KA 1XGSA 2QQAA 1X3UA 3KWRA 4EJUA 1XGMA 4PGGA 3C1DA 3TKYA 1BI2A 1BJAA 3WE3A 2L6MA 3O2PE 5LRSA 1T0FA 4J8ZA 2KIMA 3KP4A 3GXOA 2PFBA 3HRSA 3P9CA 2YSRA 1WRJA 2K7LA 3KZYA 2X4HA 3F6VA 1Y0UA 3HPSA 2C6YA 1ZAOA 1LDDA 2Z3YA 1SD6A 4WWCA 3NEUA 1LDKB 5LGTA 4KIBA 1BM9A 4KIGA 2P7CB 1LB2A 3FXRA 1J75A 1LDJA 3ABUA 2PI0A 3K6QA 5CJ9A 2Q2EA 3S2WA 4KUMA 2OU2A 4EM2A 4B3SE 2JSCA 1F4KA 5FO5A 1SD7A 3HHHA 5F1RA 2Q0OA 3KLOA 4RGXA 1FPQA 1UB9A 4IXAA 1R36A 2V83A 4HBLA 1WHNA 5D4SA 1HW2A 3WG9A 1P6RA 4HLXA 5F3WA 4G94A 1HKSA 2LUQA 1G3WA 2HZTA 3T0YA 4UV8A 2RSMA 3TOBA 1FP2A 3DP7A 1TNSA 2QVOA 4DUZE 3JSOA 3L9FA 2ETHA 1BC7C 3IWCA 1QPMA 4K0KE 1HNZE 2D45A 5KK1A 3AUZA 4U88A 1B59A 3WTUC 2NYXA 1F5TA 1FOKA 4L9TA 3ROUA 3TQNA 2L4MA 1KA8A 3QRFF 3C7JA 3HUGA 1EH6A 2K4JA 2Q8KA 4M6YA 5DYMA 2YU3A 2VQEE 1C0WA 2DQLA 4DV1E 4KT5C 4OINF 3DEUA 4P7DA 3L7WA 1QZYA 1DUXC 3F72A 3TOAA 4XLNF 4S05A 3ZMUA 5D5WB 4AVPA 1IXCA 4ASNA 5CVRA 4R79A 3MWMA 2ODRC 5LLQA 1ODDA 4RB3C 1QGPA 5CLSA 1IN5A 4MGRA 4KZSA 4MNUA 3MZYA 5FFXA 3F8NA 1TQMA 5HLIA 3E3VA 2FTXB 5K5RA 3DJWA 5CVIA 2BEOA 3RMPA 1IRFA 4MEXF 3ELKA 4HDUA 4WF2A 2DQRA 1JHHA 1FY7A 3GZ5A 5BOXA 2M4IA 1Z91A 2OA4A 2GXGA 4WPYA 2FSWA 4B09A 2E7XA 2KONA 3NRVA 3FIGA 3TDZC 4Q4ZF 1FC3A 2HYFA 5A2QZ 1PP8F 4RB1A 2ODRD 4ZYHA 2GWRA 1YYVA 1TBXA 4JI8E 1RIOH 2ZNZA 3I64A 3RTRA 3BP8A 3HHGA 2PLYA 2JVAA 3QAHA 2NUEA 3QP6A 4FHTA 4HF2A 1B4AA 4UVCA 2HS5A 3LQRA 4CYDA 3T1BA 2OZ6A 2M30A 3GO5A 2BYVE 4O5VA 4RAZA 4IRGA 2KHXA 1U5TB 2FBKA 4OIQF 4JI1E 2UXNA 4M9ZA 2WC2A 3F8CA 3HSRA 4A0YA 1FBSA 4WSPA 4F9CB 2V85A 1W7PD 2L3CA 4KYWA 4HF0A 5BPIA 3MQ0A 5F6FA 1I1GA 3GF2A 3QPHA 4XSZF 3GFMA 1IBME 1R7JA 1P2FA 2MLKA 2DW4A 3VB2A 1FKAE 2W57A 5JR3A 3V7RA 4U7DA 5H6RA 3FM5A 4MQVA 4WYQB 1HSJA 4P9FA 5LRRA 4NXME 1IRGA 4GYGA 1HNXE 4CZZA 4R8HA 1SFXA 2MC3A 2ISZA 2LF7A 2FA5A 1P92A 1CF7B 2HR3A 5EEHA 4DR5E 2DT5A 1T4NA 1IN4A 2EA4A 3F8MA 2EFOA 1G3SA 3D0SA 4KN7X 4B3TE 2EFPA 3WU1B 3H92A 1D5VA 2F4VE 2LMZA 4TUIA 1W5TA 1LVAA 1YFHA 2DIXA 4WFTA 1U8RA 4L18B 4MHGA 4XLPF 1YO5C 2V6CA 4YY3E 2K02A 3WTYC 2STTA 4LFAE 1XCVA 1ZBQA 2JOXA 4JK1X 2B3TB 2XKPA 3DXJF 3BWGA 4MQ9F 1O3TA 3CUQC 2KOUA 1U2WA 2EZ6A 4AIHA 4LF6E 5IWAE 3RPUA 1YS7A 1TQIA 2Z9OA 1WWXA 1ZG3A 1W7PA 3J81K 4CHUA 5L3DA 3KP6A 3SZTA 3E5XA 4OIPF 2XGXA 4G9YA 1X48A 3F23A 3ZMZA 2V1XA 2NS0A 2LRSA 4NHJA 4DV5E 1IF1A 5L3FA 3VYXA 2YT4A 4B3ME 4Q48A 5BS6A 2QBYA 3WTWC 2DFIA 1SD5A 5HLHA 2F8BA 2NRAC 2QBYB 4JI7E 4BC9A 3KCCA 3GX4X 5DD8A 2LTSA 2F5DA 3CJNA 3KEOA 5AONA 3KE2A 4X64E 3N4MA 2B9DA 1RC7A 5JVTA 3L2CA 1PDNC 5BMZA 2H6BA 1YW9A 2W85A 3G73A 1MJBA 1GXQA 4DR1E 2EFNA 3GFJA 3ULQB 3DFGA 1H9GA 1UILA 3I54A 5FD6A 1FNNA 2AXLA 2BGCA 2RC4A 4G8XA 1XDUA 1IZ1A 3TO7A 4KHPE 2V1UA 4RGRA 3WTVC 5ED4A 4G7ZF 5DEQA 1WXRA 2Z99A 3HRUA 2H94A 3GYHX 1R1TA 2PMHA 5L3EA 5D6EA 4RB0A 2ZNYA 2VT3A 2ESHA 4YIFA 2UXBE 2ZKZA 1QQIA 1QU6A 4FT8A 1KQ9A 2V89A 3U1DA 4P55A 1USTA 4L0ZB 4KMFA 4LFCE 2P7VB 2L33A 4AWXB 3FXUA 1ZG1A 5E17F 5LGNA 3I4PA 2UUCE 4PDKA 3COAC 1ZRCA 1U5TC 4OU0A 1I27A 3JTGA 2NUGA 4YFKF 1TW3A 4LF5E 3JU0A 3GWZA 2CO5A 3KETA 4HOBA 3FMRA 1OR7A 4WXDA 4JV5E 3DF8A 2L2NA 2VC0A 2O0YA 5HLGA 4B3RE 2DI3A 2RNJA 4GKJE 5E20A 2OZUA 1T38A 4DR6E 3JAMC 4OX9E 1IXRC 4DV7E 3E5UA 2MH2A 3H3UA 5ERIA 2HKXA 3R0AA 3ZMDA 2DSYA 3LA3A 4IVNA 3SXYA 2ZBKA 1REPC 1I5ZA 3BY6A 4JYAE 2J5OA 1I1SA 3B73A 1O7LA 4LK1F 4O3MA 2MH9A 3M8EA 5JI6A 4F54A 1YIOA 2MLGA 4M71A 1HSTA 5D8LB 2RKHA 2LF8A 2F5EA 4LD5A 4LFBE 4M2ZA 2P5LC 2PG4A 1HR0E 3BROA 2EFWA 5D6FA 2LSOA 2PN6A 3P7NA 2B7TA 4I0BA 5IT9Z 1FLIA 5A2QK 2L01A 2DAOA 3HIFA 3VOEA 3IRQA 2ZMEB 1E2XA 5LHHA 4U0VA 4Q5SF 2RGVA 2M8EA 3FF5A 4FX0A 1UHWA 1HKTA 3CUQB 2R7FA 3FZVA 1V3FA 2D2WA 1YYKA 3KP5A 4HV5A 3W6JB 5E8GA 1K79A 4BBYA 1HW1A 2XROA 3SFZA 2M1BA 1YS6A 5L3CA 3IWFA 4JBAA 2RTXA 4Q47A 2IP2A 5EEGA 2KJBA 4WK8F 4LF4E 4M73A 2WWYA 1HW5A 4HYEA 4A6DA 4Q28A 1T98A 2UXDE 3DQVC 3ZP5A 1ZN2A 2YZTA 3ZOQB 4DKKA 2FMYA 1OMIA 5AE1A 1FWZA 4JQFA 2K86A 5BQTA 3J80K 3V8LA 4OOGC 1EKZA 3JTHA 3C4TA 1Z7UA 1MGTA 2L92A 1A04A 3HSFA 2HDCA 3RDIA 1BIAA 1B9MA 2HWVA 2RS7A 4ZYEA 5DD4A 4EVIA 1ONVA 2QENA 1SAXA 1ZBTA 3KEQA 5J6XA 2ZM6E 5J8CA 5D5XB 2HKOA 1BC8C 1DI2A 4MEYF 3QOPA 1ZGJA 2HEOA 2PMUA 2GXBA 5LMUE 3R4KA 2ELHA 4RGUA 1J2XA 4OIRF 1W7PB 1U6GA 3M9AA 1Q1HA 2L3DA 1DDNA 1IUYA 3J81Z 3WTSC 4EJTA 3J7AO 2JTVA 2MD5A 2RS6A 4M9SA 4S04A 2A5YB 3LSTA 1JGSA 5E1ZB 3H09A 5LEJA 4DV2E 3L00A 1SR9A 2DK5A 1LJ9A 5HS8A 4WCGA 1S8NA 3U2RA 4H0EA 5FD5A 2RN7A 4BCAA 2KRFA 4K2EA 2EB7A 4D0PA 5FLXC 3BZ6A 4DV4E 1XGOA 2H27A 1B1BA 2JT1A 4LK0F 2OD5A 3IC7A 4RB2C 1KQ8A 1LEAA 2JPBA 2VXZA 2XV4S 4QLCU 4B8XA 4U7BA 3K2ZA 3P9KA 3ZMSA 1T4LB 5AIQA 2VQFE 1HQCA 4YHHE 3BDDA 1K78A 3RKXA 1J9IA 5HDGA 2FOKA 3F8FA 2PBIA 1GVJA 4HAMA 2A68F 2MC5A 4LFUA 1F9NA 1R58A 1BN5A 2G7HA 4N9IA 2JRTA 2G9WA 1ZYRF 1LEBA 2H6CA 2IPQX 2KKOA 5JFRA 3ECOA 1WKMA 2IA0A 3FHZA 4IHTA 1DP7P 3DKWA 2VBWA 2COMA 1FSHA 4IHSA 2MBFA 4LG0A 4JI3E 1QZZA 4OMZA