2G7HA

Structure of an o6-methylguanine dna methyltransferase from methanococcus jannaschii (mj1529)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
167
structure length
167
Chain Sequence
b'MIIQIEEYFIGMIFKGNQLVRNTIPLRREEIFNFMDGEVVSNPEDEHLKVAEIILKLYFAEIDDKKVRELISYKLEVPEFTKKVLDIVKDIEFGKTLTYGDIAKKLNTSPRAVGMALKRNPLPLIIPCHRVVAKNSLGGYSYGLDKKKFILERERLNMVSFKFNKVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
molecule tags Transferase
source organism Methanocaldococcus jannaschii
publication title Structural studies of MJ1529, an O(6)-methylguanine-DNA methyltransferase
pubmed doi rcsb
total genus 20
structure length 167
sequence length 167
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2006-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2g7hA02
3.30.160.460 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2g7hA01
2HOEA 3GYHX 3BP8A 2HR3A 5K5QA 1OPCA 3OOPA 3RTRA 5IT9K 1SMTA 2GZWA 1IAWA 5ICCA 1S3JA 1FPQA 2HFHA 5A2QZ 3J81Z 4Y13A 4RB1A 1TW3A 2UWMA 2P5LC 3HRMA 2XASA 1P4WA 4YFNF 2DU9A 5AIQA 1G4DA 2DBBA 3MZHA 4L9VA 1AOYA 3GEZA 1FT9A 1R7JA 5AONA 4A12A 2GAUA 5DUKA 2Z33A 3Q9SA 5H20A 2BBYA 1TNSA 3SFZA 2EV5A 3FM3A 2VBWA 4BHBA 1Z1DA 3V8JA 1P4XA 2VT3A 3TDUC 3CUQB 2RC4A 1QBJA 3SXYA 1O3RA 4R79A 4A5NA 5LHGA 3ML6A 4A0YA 5D5VB 2F2EA 1KQ0A 3KP7A 4WXCA 3FWEA 1CGPA 1YTYA 3Q9VA 4GO1A 4OINF 3DXJF 1S7OA 3KZZA 2VONA 3ZQ7A 2J5OA 3ECHA 1PUEE 1Z91A 4G94A 4ON0A 1UCRA 3KLOA 2LF7A 1FYLA 3PQJA 2CG4A 3KETA 1R5HA 5L3BA 1Z9CA 3E3VA 5LGTA 2RNJA 4AD9A 2E1CA 1Y0UA 3FXQA 3F72A 3BWGA 5DCFA 1YFHA 2V6CA 2ZXJA 4ESJA 4PDKA 5CVJA 1LDKB 2FXAA 2GXGA 2V1XA 1QNTA 4EM0B 4GYGA 3TDZC 2A6EF 1FP2A 5K5OA 5JFRA 1KQ9A 4Y17A 3EYIA 2NYXA 4EJOA 4HDUA 5FFZA 3V4GA 2XHKA 2QQAA 1O3TA 1Z6RA 4G7ZF 4RB0A 2VE8A 2DAOA 3C3WA 3K1NA 1IN8A 1UHMA 4CHUA 2QVOA 2BGCA 2EV0A 1YG2A 1YYVA 2O61A 2HZTA 4FX0A 3M8EA 1BI2A 2XAQA 2A68F 3TO6A 3CUQA 2W57A 2RKHA 3Q5FA 1FSHA 5L3GA 2QWWA 3V7RA 2R7DA 3DEUA 4RGSA 1TW2A 2EFQA 5CJ9A 3JTGA 4YFKF 1U8RA 2FSWA 4A0XA 3EUHA 3FHZA 2XV4S 3H92A 3WE3A 2KRFA 5FD6A 3WTVC 4ZYDA 4EQQA 3SQNA 2EFOA 3J80K 4IHSA 5FB2A 2QENA 5ILUA 3WGHA 3IKTA 1SD4A 2Q2EA 2STTA 1JXSA 1ZRDA 4MNUA 5FO5A 2CFXA 3RI4A 2KJBA 2COMA 3WTXC 2E7WA 4LLLA 4G7HF 1P2FA 2K02A 5J8CA 4UNOA 3JTHA 3MZYA 1BIAA 1HW2A 5HVQC 3JAMZ 3RYPA 4Z2YA 3ZMDA 1FOKA 2UXXA 5LEKA 3DV8A 3G3ZA 3WTYC 2O0YA 3ABUA 4HDVA 5IT3A 2FNPA 1OKRA 4O3MA 3LA3A 2GQQA 2DQLA 4FT8A 1YLFA 2L4AA 3I71A 3QPTA 1KU9A 4D0PA 3BPXA 3JW4A 4U0WA 4BAYA 1ZG3A 2HYFA 3GFLA 1TQPA 4BHPA 3ULQB 3I64A 2Y0MA 1GVJA 4ENKA 2L54A 1B1BA 1FC3A 1B6AA 4JK1X 1D8JA 3FX3A 2C6YA 2BE5F 3QRFF 2PMUA 2FA5A 4H0EA 1PDNC 2IA2A 2QQ9A 1R1UA 1WI9A 4KMFA 2W84A 3F6OA 4AWXB 2W25A 4HLYA 5IT9Z 4P9UA 2YSRA 4M6XA 4HAMA 5HDNA 5CVVA 1BJAA 2O8XA 1Z6TA 3MAJA 2FMYA 4RB3C 2P8TA 3R60A 4HZFA 1HSTA 1SD6A 2QM3A 2XKPA 1OR7A 1EH7A 1XCVA 2VOOA 3ZP5A 3CUQC 3V7SA 1D3YA 5LRRA 2VE9A 4ZH4F 3N97A 2MH2A 1KU3A 2EJRA 1TBXA 1YIOA 2MA3A 4OOIA 3CLOA 1G3SA 3CO6C 1ZGJA 2LF8A 5D5WB 1PP8F 2Z99A 4EV0A 5DUIA 3FXUA 2H27A 3K1MA 4L5JA 4LD5A 3C1DA 4JQFA 3R0JA 3T1BA 1LQ1A 2J5PA 3K2ZA 1FZPB 2HEOA 1J2XA 2VN2A 2MLGA 3I5UA 2XRNA 5D6FA 1ZH5A 4CZZA 2V79A 3DPTA 1TLHB 4EJTA 4YFXF 2JPBA 1HW1A 1YS6A 1ZHFA 1U6GA 5D4SA 5K5RA 3CUOA 3O6BB 5HS7A 4CICA 2A3SA 5JR3A 5DV5A 5FGMA 1T0FA 4U0VA 1NHAA 1RUOA 1ULYA 4ENJA 1OMIA 3DF8A 2DLLA 4OU0A 4HLXA 5DCMA 5E8IA 3FF5A 2RN7A 2K7LA 2NAZA 2EA4A 3IRQA 2G7HA 2Y48A 4BH9A 1R1TA 4M74A 2OD5A 5L3FA 2UXNA 4OIRF 5H6QA 2E1NA 1YQAA 5LBQA 3HIFA 2D45A 2HYGD 1K6OA 5L3EA 4ENNA 2HQRA 1MGTA 5D8KB 3BROA 1O3SA 3H3UA 1O7LA 5CVIA 5D6EA 4M9ZA 1AWCA 4ASNA 4A5MA 2MBFA 3EYYA 5JVTA 1R00A 5FD5A 1QGPA 1U2WA 1WSUA 4IRHA 3W6JB 1QQIA 2PFBA 3BDDA 1K78B 3KP4A 1FYKA 2EFWA 3T8RA 3KP6A 3FMRA 3WU1B 2CO5A 2QBYA 2QZ8A 1IF1A 3RIRA 2YX7A 2RV8A 2LKPA 1XB4A 1KU7A 2XKOA 5D5XB 1BIBA 2G7UA 4LG0B 2NS0A 5BMZA 3HHGA 2OAZA 2MD5A 3E5XA 1FNNA 4S04A 1TQMA 3E97A 4YIFA 4BXUA 4I7HA 1B9MA 4Q48A 2W85A 3GWZA 2DPUA 2K4BA 4RGXA 5ICEA 2FOKA 4XLPF 4CYDA 3BJ6A 2A6HF 5CVRA 1A04A 3O3KA 1REPC 3I58A 2HQNA 1T6SA 4HV6A 4XRFA 1W7PD 4UV9A 2L02A 2P7CB 3HSRA 1F1ZA 3BPVA 2B0LA 2O6GE 2DW4A 2NNNA 1RZ4A 4G7OF 5HDKA 4HF2A 4ESBA 3NRVA 3WTTC 3ZMZA 4B8XA 3O2PE 1GXQA 2P4WA 5K1YA 4DNCA 1G3YA 2HKXA 4P9FA 1KA8A 1U5TA 1HSJA 2E7XA 2EV6A 4LGWA 4WF2A 2ESHA 1HW5A 2F5FA 1TNTA 4PCQA 4WCGA 1IN4A 5DYMA 3I54A 2QLZA 1J7KA 4GCVA 1J5YA 4XLNF 3WG9A 2ACJA 1I1SA 4ZZLA 2BV6A 2FEZA 3CJNA 1FBSA 2G9WA 2XIGA 1FLIA 5LLQA 2HKOA 1LDDA 2JSCA 1XSXA 2JT1A 4OMZA 2A5YB 1S29A 5D8LB 4I01A 3VOEA 3D5LA 1LJ9A 2FNAA 2OA4A 2DI3A 2Q0OA 2XAJA 4IJAA 5ILSA 2PBIA 4ENMA 3HYIA 3IWFA 3REOA 2XAHA 3RYRA 1FWZA 3B02A 3T0YA 2IPQX 4N0BA 3RPQA 4EM2A 3LAPA 3KEOA 3ZMTA 4KIBA 4O5VA 1J9IA 1T39A 4RGUA 5LEJA 3H3ZA 4LG0A 5E1WA 2UZKA 2M45A 1SMYF 3GO5A 3JSPA 2H94A 2XUBA 4HX7A 2VC0A 1ZRFA 1K79A 3PFIA 2NNYA 3M7GA 2L01A 1R22A 1ZLKA 3LQQA 1K78A 3F8MA 4L0ZB 3GXOA 2AXLA 1U5TB 3R6SA 1BOAA 2MLKA 4A2UA 3ZMVA 3KE2A 3V8LA 3WTWC 3E6DA 3IL2A 2PEXA 2ZMEA 3B73A 1UB9A 4MEYF 1P92A 3KZYA 1KU2A 1EH6A 5ILVA 2Z9OA 1JHFA 5LHHA 2FE3A 2ZBKA 4BNCA 2K4JA 3MWMA 1SD7A 1H9GA 5DDGA 2PQ8A 2V1DA 1FBQA 2FQ3A 2LSOA 4RAZA 2PLYA 1CF7B 4F7ZA 3HTUA 4UVCA 4I09A 4KIGA 4AIHA 1R1VA 3WE2A 3L09A 3BJOA 4ESFA 1IXSB 5H6RA 3TGNA 2H09A 4CXFA 3DP7A 5DCMB 2STWA 1OYWA 2V9VA 5ERIA 4I98B 3GFMA 4GYIA 1ZGAA 1BI0A 4HF1A 2DK5A 2FBHA 3HOSA 3CO7C 4CO8A 1BBYA 1XSVA 5BS6A 1P6RA 4BQAA 4L5IA 1SFEA 3FMQA 2HS5A 1MJAA 2DPDA 4ZYEA 2P5VA 4KNYA 4L18B 1SD5A 3CDHA 1ON2A 2LNBA 1G3WA 2OU2A 3LWFA 4IVNA 5DD4A 1S6LA 3IWZA 1B9NA 4G9YA 1BI3A 2M87A 4I0BA 2KIFA 4U88A 2IA1A 1KYZA 1G6NA 1MZBA 1WRJA 3F21A 2ZO4A 1YS7A 1GHCA 2ZJ2A 1PP7U 2DK8A 3QU6A 2EFNA 4UVAA 2BYVE 4IRGA 2JRTA 3QP6A 3RJPA 2ZCWA 4XSXF 1B4AA 4PGHA 1U5TC 5BPDA 5D4RA 4KIFA 1I1GA 4LLNA 3I53A 3TOBA 3PQKA 5F6FA 4BYYA 3NQOA 2RVCA 4DQ2A 4LK0F 4A6EA 3F8NA 2YR2A 1IZ1A 4Q47A 1ZYRF 2DQRA 3I59B 4LJZF 2OZ6A 1MKMA 2VBXA 3TO7A 3J80Z 1QO0D 4LLGF 1OYIA 4HA8A 3ZN1A 4AVPA 4WX9A 4MHGA 3EDPA 1XGNA 3RKXA 3V7CA 4R8HA 3J81K 3I4PA 1J0RA 4OIOF 1W4MA 1YO5C 3BY6A 5EEGA 1DPUA 5BQTA 4HX4A 3N4MA 2A69F 4KN4X 4NHJA 4N9HA 1TTYA 1W5TA 1U78A 4HV5A 3ABTA 2BEOA 2ISYA 1VTNC 2VODA 2IA0A 2MC3A 4WK8F 2EA2A 1O57A 2IP2A 1R36A 3I59A 2KKOA 5J8FA 1BM9A 1E17A 4KUMA 5E1XA 4ZYHA 1ZLJA 2ETHA 4M9XA 3WODF 3TO9A 3HRSA 4CDGA 2F5EA 2FMLA 2QYOA 4OIQF 3L7WA 4IXAA 2M30A 3WU0A 1IRGA 3KP2A 1B59A 2Q8KA 2CQKA 5E1ZB 1R5GA 2LDUA 4HQEA 2EFPA 2ESNA 2O3FA 2KJCA 2D2WA 3SZTA 1ZN2A 2YU3A 1STZA 1OYYA 2KIUA 3VODA 3LSTA 1BN5A 1X3UA 3LA7A 3WTZA 1F9NA 3V8KA 2Z5UA 3RKWA 4TV7A 3GFIA 2JPCA 4RAYA 3GUDA 1V4RA 3U9GA 4YG2F 1F4KA 2OZUA 3ZMUA 1FYMA 2PMHA 5F64A 1IN6A 3RKYA 2RDPA 2FF4A 3HSEA 4EMSA 3TKYA 4RB2C 3E6CC 4HW0A 4O6JA 2YX4A 1I6XA 3FXRA 4IPAA 3MCZA 4KT5C 4U7DA 2OBPA 3F8FA 2M8EA 3KP3A 5HS9A 3TOAA 1ON1A 2MH9A 1XDUA 4S05A 2O03A 3QOPA 4NQWA 2L3DA 3FM5A 4KDPA 4HQMA 1YW7A 1HKQA 5E8GA 3MQ0A 4LB5A 1BC7C 1DPRA 3HOTA 2ZKZA 1FX7A 2VBYA 2XGXA 5KVRA 2WC2A 3I0TA 5HOOA 2VXZA 1ZG1A 4Q5SF 3VFZA 4IF4A 4MTEA 3OV8A 2HDCA 1U3EM 3EETA 4RS8A 4JBAA 4P55A 4M71A 1XGSA 4CGZA 4A0ZA 3P9KA 2XROA 3JSOA 3L9FA 1XN7A 2XAFA 2WTEA 2DFIA 3QPHA 1EV7A 4AIJA 3MFKA 5E18F 4IRIA 1HKTA 2IRFG 2HTJA 2X0LA 1T38A 2EK5A 4P96A 5A2QK 5FLXZ 2R3SA 1Q1HA 1G3TA 3E5UA 2PJPA 2D1VA 2A61A 4EJUA 3WTUC 1XDSA 1HQCA 1IXCA 3S2WA 1QZYA 2FBIA 2F5DA 3QAHA 5CVUA 4RGRA 3RDIA 3BJAA 2GXBA 1MDMA 3R0AA 3HRTA 3MEXA 1WQ2A 2JTVA 3GW2A 1IN5A 4IHTA 4L9JA 1KQ8A 5D5UB 4MQVA 2VBZA 3KEQA 4E70A 4A6DA 4UHTA 5LRSA 3RPUA 3GVAA 3E5QA 1RNLA 4U0YA 1QZZA 3F23A 2L4MA 2DO7A 3DQVC 3VB2A 4K2EA 5E17F 1DP7P 2FRHA 1J75A 4UXNA 2WV0A 5L3CA 3COAC 4MQ9F 1ZREA 4KFCA 1E2XA 5HLIA 4ZYGA 1IXRC 2JZYA 4EGYA 2WWYA 2R7FA 2W24A 4MEXF 3VEPA 1ZRCA 2PG4A 4G8XA 4WXDA 4WWCA 1XGMA 1V3FA 3T5XA 3T8TA 4WXHA 5TJJA 3ECOA 2XVCA 3U1DA 1UFMA 1K7AA 1I5ZA 3HTSB 2M1BA 4N9IA 4P5OA 3K0LA 1RI7A 1GXPA 1HXDA 3IC7A 3HRUA 4KYWA 4EGZA 1D8KA 1S7AA 1L0OC 5FFXA 1ZG5A 4PZJA 1IRFA 2IW5A 3WGGA 5HLHA 2HGCA 4LK1F 5HLGA 5ED4A 2P6SA 3FMSA 2KIMA 2AS5F 4HBLA 2GIVA 1DDNA 3KLNA 2HWVA 4R1HA 3P7NA 4KN7X 5KK1A 3F6VA 3L00A 3HHHA 4EM1A 4Q4ZF 2NRAC 3LAJA 2ZFWA 3ERED 2P5KA 1HKSA 5CYVA 2IJLA 3QU3A 4FHTA 1ZARA 3GLXA 4LMYA 4UUVA 1FSEA 1EH8A 3K1PA 1TQIA 1Z7UA 2QUFA 2TDXA 4FX4A 3M8FA 1Z05A 3GFJA 1XGOA 4I0AA 2RGVA 1USSA 1ZAOA 4XSZF 3TQNA 2DTRA 4I02A 4EJVA 3D0SA 1RIOH 2F5CA 2CSOA 2GA1A 4Y15A 1LB2A 1F5TA 5LGNA 5TRDA 2ZNYA 1JE8A 4OMYA 2H6BA 2GWRA 3NEUA 1YW8A 4MGRA 3ROUA 6PAXA 1LEBA 5DD8A 1SAXA 3HUGA 4GGGA 1QPMA 1S8NA 3E6MA 4L0YB 2ELHA 1FY7A 2M5WA 4L9NA 4KMUX 3GX4X 1I27A 1MJ9A 4YIIA 4ZZDA 4M6YA 3M1EA 1MD0A 2K27A 4G6QA 3HSFA 2Y75A 1LEAA 3ZMSA 5CLSA 3IHUA 5L3DA 1XMAA 3GF2A 2VOPA 2ISZA 1P4AA 2OQRA 1JHHA 4L9TA 3W6KB 1CF7A 1IN7A 3R4KA 4HOBA 1XSDA 4KICA 4B09A 4EVIA 1O7FA 2CGPA 1O3QA 5FLXK 5DEQA 2QQBA 3ISPA 2P7VB 4KA4A 3F22A 4I2OA 2H6CA 1MJBA 4UVBA 5EEHA 2EB7A 1LDJA 2GA2A 2ZNZA 3AAFA 2FBKA 1LVAA 3DPLC 1W7PA 2IT0A 1W7PB 3LFKA 5ICGA 2EWNA 4G6DA 2K86A 3C7JA 1ONVA 4UV8A 3EQLF 2A07F 1XCBA 3IRRA 2P6TA 1T98A 4EJWA 1KGSA 1HBXG 3CTAA 4GXOA 1W5SA 3GZ5A 4HF0A 1USTA 1FP1D 2V1UA 4U7BA 5LGUA 4QLCU 1J59A 4AIKA 3R61A 1L3LA 3ELKA 4XBFA 5BOXA 3SZPA 4M9SA 3BZ6A 3F3XA 1SFUA 2OQGA 2D1HA 5HDGA 2XAGA 3L2CA 3FZVA 2HTSA 3JAMK 1R58A 5E20A 2FU4A 5F1RA 1SFXA 2Z3YA 1C0WA 4PGGA 3KCCA 3QP5A 2VC1A 1FBUA 3SHFA 4LFUA 3E6BA 5ICFA 5HS8A 1BI1A 2PI0A 1IW7F 2PN6A 1D5VA 2RQPA 3LA2A 4NB5A 1LNWA 1MDMB 5J6XA 3F8BA 3WTSC 3DFGA 2ZMEB 2CW0F 3J7AO 3BOQA 2IVMA 1XD7A 3WGIA 3DKWA 1JGSA 1WWXA 1WKMA 1YW9A 3M9AA 3K9TA 2QBYB 2CYYA 1KYWA 1R23A 1T2KA 3ZN0A 1H9TA 5AIPA 3G73A 2ADUA 4ETSA 5JI6A 4HX8A 1UHWA 3U2RA 3K69A 1BC8C 1XMKA 2YPRA 2X4HA 2DT5A 3GZ6A 4M73A 5BPIA 2VT2A 3F8CA 5JHUA 5LHIA 4HYEA 2CWEA 3P9CA 3KP5A 3ZPLA 3IKVA 4MTDA 3C18A 4M72A 4BHCA 3LQRA 1H0MA 1DUXC 4QWQA 1IUYA 4OIPF 3KFWX 1ODDA 3P9IA 1RUNA 4LB6B
chains in the Genus database with same CATH superfamily
2VJ4A 3FXLA 4XL9A 3ZQHA 4EATA 2HOEA 3GYHX 3BP8A 2HR3A 5FLMJ 5K5QA 3BTLA 1OPCA 3OOPA 5IP9J 3RTRA 3MHSC 5A6BD 1VQPI 1ZKGA 1V5EA 3PNTA 3CMYA 1JI8A 4DR1E 2RNGA 5EEAA 5IT9K 1SMTA 5FLVA 3RMPA 1MIJA 3GTMJ 2ME0A 2GZWA 5E3LA 3CCSI 1IAWA 1I6HJ 2KMUA 2X51A 3FDYA 5ICCA 2LUPB 4NC7A 1S3JA 3CF2A 1FPQA 2WY8Q 3WG7H 1P47A 2LY2A 3ECRA 2HFHA 1E3OC 5A2QZ 3J81Z 1AH5A 4Y13A 2EOHA 4DUYE 4RB1A 3S1NJ 1TW3A 2X6XA 4EEFG 3LMMA 2UWMA 5GTHC 2P5LC 3ASOH 2L7KA 3HRMA 2B7TA 1UG2A 1JUSA 3HQ1A 2UUCE 1OISA 3O8HA 2LRDA 2XASA 5M5WJ 1P4WA 4YFNF 2BHYA 3U1KA 2DU9A 4RAFA 5AIQA 1YYOA 2AO9A 2R5YB 1QPIA 2VRDA 3LSJA 3TBIA 2VJ5A 3DEEA 3ADLA 3G1OA 1QA6A 4CCNA 1UELB 4R2CA 5FKLA 1G4DA 2JUGA 4BQOA 2DBBA 2BY3A 3H5NA 1Z3XA 3MZHA 3OTOE 2EZLA 4YRVA 4L9VA 3LSHA 1AOYA 1UHSA 3GEZA 3OIQA 2GBYA 2FTXB 1JTXA 1FT9A 2EPRA 4GKJE 1A1HA 3JU0A 4BJ6C 1WZ2A 1UN6B 1R7JA 4DUZE 5AONA 4A12A 1IC8A 2GAUA 3VPRA 3S1MJ 5DUKA 2LLKA 3BBGA 2Z33A 1O4XA 1XMOE 2V7FA 3SDBA 3Q9SA 3AG1H 4JYKA 5F3WA 2R4GA 5H20A 2YRHA 2BBYA 1YRNB 3I56I 1TNSA 3SFZA 1APLC 4E6KG 5M3MJ 2EV5A 3FXJA 3FM3A 2VI6A 3AG2H 2VBWA 4BHBA 1Z1DA 4PK4A 1P4XA 3V8JA 2VT3A 3TDUC 2MSYA 4YELA 3LSPA 3CUQB 2MDGA 4A3IJ 1TC3C 2DA3A 3SXYA 1O3RA 1QBJA 4R79A 4A5NA 5LHGA 1ZQ3P 1FIAA 4MFEA 2BXYA 3ML6A 4A0YA 5D5VB 1IDZA 5EG0B 2F2EA 2DJIA 3PM1A 1KQ0A 3BR2A 1HDPA 3KP7A 2EMLA 4WXCA 2LV2A 3FWEA 2DOAA 4QSHA 1CGPA 1SVLA 1WJFA 3Q9VA 4GO1A 4BQNA 1YTYA 3OMYA 5H2FC 3CJTB 2R7UA 2QEXI 4KZSA 4OINF 4XORA 3DXJF 1IDYA 2D9HA 2K7IA 1W36D 4ITVA 2P0WA 4FISA 1S7OA 3PIPF 1OCOH 1IQOA 2LCEA 3KZZA 2VONA 2KDOA 2B63J 3ZQ7A 2E60A 2EIKH 2J5OA 1MMAA 3ECHA 1PUEE 5IOZA 1FMWA 1HNXE 1Z91A 1X1CA 2OPTA 2YU5A 2YRMA 1VQ6I 2EPCA 4G94A 4ON0A 2EPLX 1UCRA 3KLOA 2LF7A 1FYLA 1VQ8I 3PQJA 4C3JJ 2CG4A 3HOZJ 2M7QA 3KETA 4NNJA 4JP0A 1R5HA 3NWTA 5L3BA 1Z9CA 3E3VA 5LGTA 2AQEA 2RNJA 2B9DA 4B3RE 2JOBA 1WI3A 4D7NA 4AD9A 1BL0A 3PFYA 2E1CA 2L9RA 3K4JA 1VQ7I 1Y0UA 2EN6A 2I5UA 1RR8C 1ZBQA 1VQNI 4QPQA 3ZOQB 5LFAA 3FXQA 2L7MP 3F72A 3FKIJ 3BWGA 4L8NA 5DCFA 1UMQA 4O5GA 1YFHA 1SVMA 3HPZA 2V6CA 2ZXJA 2CW7A 4ESJA 3OS2A 1JK1A 4PDKA 2EPKX 3T1YE 4A3BJ 3CCYA 4H4KC 3L2UA 3S3OA 4DR5E 1U9NA 3ZQIA 1JK2A 2LT7A 5CVJA 1LDKB 4HPQA 2FXAA 2GXGA 2V1XA 1QNTA 4EM0B 2L9VA 4GYGA 3WU2C 5IT9C 3DLLF 2WBUA 2JA2A 1U9OA 4MFDA 3TDZC 1JKPC 4HG2A 3ZQLA 2EBIA 2A6EF 1FP2A 2L2NA 5K5OA 3CQZJ 5JFRA 1KQ9A 2MYSA 2DA4A 1EKEA 3DBHB 3H35A 4LF6E 4Y17A 3EYIA 2NYXA 2VQEE 2WBSA 4EJOA 4HDUA 4M6VA 5FFZA 1TN9A 3W2VA 3V4GA 3ZRGA 2XHKA 2RAEA 2QQAA 2NVUB 1O3TA 4IQJA 1Z6RA 1SFKA 2GLIA 4G7ZF 3IWCA 1ENHA 2VE8A 2DAOA 4RB0A 3C3WA 3K1NA 1IN8A 1UHMA 2WAFA 2X1CA 5C4JJ 4HEIA 2XGEA 4CHUA 2L9NA 4BE2A 2JRMA 2BZTA 2QVOA 2BGCA 1HNWE 2EV0A 2Z16A 4XLEA 1YG2A 1X19A 1YYVA 2CRGA 4KITB 5IYCJ 1AHDP 2O61A 5J1UA 2HZTA 4FX0A 2EZHA 3M8EA 2Z2SB 3A4CA 1DGRM 3S93A 1PJSA 4AYBA 4J00A 2H1KA 1HCRA 1BI2A 1ETYA 2XAQA 5M5YJ 2EPXA 4BACA 2A68F 3TO6A 3OL4A 2IEKA 3CUQA 2W57A 2LMZA 2KHMA 2CS3A 1WHUA 2RKHA 3Q5FA 1FSHA 5E79C 3BQYA 1YJ9I 4J01A 5L3GA 2EOSA 1OR7C 2QWWA 2X85A 4NUBA 3S3NA 3W3CA 2DXIA 4F93B 2UXBE 3E7LA 4X0GA 3V7RA 2R7DA 3DEUA 4BDYA 4RGSA 1SVOA 3EPHA 1TW2A 2EFQA 1A1IA 4BY7J 5J4YA 1JKQC 3J7Yp 2E1MB 5CJ9A 3JTGA 4YFKF 1U8RA 2VQGA 2FSWA 4A0XA 1JJ6C 2Y2ZA 2UUZA 3EUHA 3FHZA 2KT0A 2XV4S 3H92A 3WE3A 2KRFA 5FD6A 2YWQA 5IV8B 3WTVC 3OYBA 2X9DA 2DRPA 5K7FA 2ELJA 3M4OJ 4ZYDA 3OYLA 4RH8A 4EQQA 3SQNA 2EFOA 2XDVA 3J80K 2XSJC 3LSKA 4BY1J 2BY0A 4IHSA 2F8BA 5FB2A 2QENA 5ILUA 2WADA 1TT0A 4WFTA 3WGHA 2EN7A 2VL8A 4PFPA 3H9JA 1SD4A 3IKTA 2L6MA 1WJPA 4DYQA 2KPMA 2QCOA 2NOGA 2Q2EA 3A03A 2STTA 1JXSA 2E36A 4IEJA 2QSGX 1KYQA 4B44A 1ZRDA 1X47A 4MNUA 1RKTA 5FO5A 3RZDJ 2CFXA 2OUMA 4JI3E 3RI4A 2KJBA 4JX6A 2R5ZB 2COMA 1UILA 2O5RA 3A1YA 2Y69H 3WTXC 2CJJA 2E7WA 4LLLA 3K4KA 4G7HF 1P2FA 2K02A 5J8CA 2KRCA 4DBQA 3JREA 2RSIA 4UNOA 3JTHA 3MZYA 3K4BA 2EQ1A 1BIAA 1HW2A 5HVQC 1U0JA 4LF9E 1A36A 3JAMZ 3RYPA 2M2EA 4KISA 1ETKA 4Z2YA 3ZMDA 4B3XA 3OYEA 1FOKA 1AKHA 2UXXA 3BZKA 1X58A 5FKOA 5LEKA 2Y9YA 1VQ5I 1FTTA 3DV8A 3G3ZA 2IGKA 4ZDPA 3WTYC 4IS1C 2O0YA 4QPOA 3CCQI 3ABUA 4HDVA 2EOZA 5IT3A 3UKGA 2YU9J 2FNPA 1OKRA 4O3MA 1A35A 2R7VA 5F0FA 3LA3A 2GQQA 2DQLA 3MKLA 1VZ0A 1AAYA 2HDWA 1DU0A 4B3SE 4FT8A 4IHWA 1XS9A 2DA2A 2NS7A 2DDBA 5IWAE 1JKRC 1YLFA 2DCEA 3F9KA 5B1BH 4DZPA 2L4AA 1SR9A 3I71A 3QPTA 1KU9A 4D0PA 3GTLJ 2M4IA 2PJRB 1N77A 3BPXA 2LMDA 4IKFA 3ASNH 3JW4A 3MD2A 4PJJA 4XMYA 3HB9A 2IBDA 4U0WA 3TW7A 4DR6E 4X65E 1ZG3A 3GFLA 2HYFA 4BAYA 2E19A 3OYCA 3VWBA 1TQPA 5DM7F 2QQ8A 1BBGA 5GPAA 4BHPA 4Q28A 2L7ZA 1SANA 1QVUA 2HZDA 3ULQB 5HODA 2CTDA 3I64A 2Y0MA 1GVJA 2L0KA 2MDRA 4ENKA 1ZR9A 2W4SA 2L54A 1B1BA 1FC3A 1B6AA 2X6WA 4JK1X 1D8JA 3LSGA 2VJJA 1B72B 3FX3A 2C6YA 4A3JJ 2DSYA 1L4SA 4XICA 2BE5F 3QRFF 2L7FP 5A6AA 1J09A 1TT5B 2PMUA 3JR9A 1WVRA 2FA5A 3KZIC 2EE8A 4GRIA 2BB8A 4H0EA 1PDNC 2IA2A 2QQ9A 1N3GA 1R1UA 4DR4E 1WI9A 1FTZA 2VQLA 4KMFA 1NG7A 2B9SA 4F52A 1I94E 4V2FA 2WAEA 4ZYAA 2W84A 3F6OA 4AWXB 4F9BB 2W25A 2JQ7A 5GPCA 4HLYA 5IT9Z 2BY2A 4J8ZA 2KP6A 1ETXA 4P9UA 3KYDB 1SAUA 2YSRA 4M6XA 3DBLB 4HAMA 5HDNA 2DMTA 5CVVA 1BJAA 2O8XA 2BHZA 1LFBA 1Z6TA 5EGOA 3MAJA 1HNZE 3RSNA 3DU6A 2FMYA 4XQFA 4RB3C 2N3GA 4HRIA 2WB1N 2P8TA 3R60A 4XIDA 1O0WA 4HZFA 4DBRA 4HEA2 3LL7A 1HSTA 1F36A 3JRBA 1M1EB 1SD6A 4IOAF 2M0MA 2QM3A 4HNTA 1OCZH 1UBDC 2CQ7A 2XKPA 2HVSA 2LRSA 4OX9E 1OR7A 2V9PA 1VQMI 3K70D 2LKXA 2ME6A 1Z67A 1EH7A 1XCVA 3OIPA 2VOOA 3HGYA 2NOJB 2OTLI 1WCMJ 3ZP5A 3CUQC 4Y7NJ 2Y0SA 3V7SA 1D1CA 1K61A 4GFBA 3FBNB 2R7WA 1D3YA 5LRRA 2DTZA 1JJ8C 5IXMB 2WA0A 3KWRA 2VE9A 3OYNA 4ZH4F 3PIOF 3N97A 3S2HJ 2MH2A 2HXIA 4IX7A 4JI0E 2EPFA 1KU3A 2EJRA 1PJRA 1TBXA 1YIOA 2MA3A 1VQOI 4HNVA 4OOIA 3CLOA 1N75A 1G3SA 3CO6C 1ZGJA 2LF8A 5D5WB 1PP8F 1PKPA 2VQFE 2Z99A 4EV0A 5DUIA 4CZCA 3FXUA 2H27A 2KQRA 3G1MA 2OCEA 3K1MA 3OYDA 4L5JA 5B66C 2IS2A 4LD5A 4F2JC 4U87A 1AKHB 3C1DA 3J80C 4JQFA 1R49A 4ZDOA 3R0JA 5IYDJ 4OAZA 3I55I 4NQWB 4A69C 4N4RB 2EPOA 1Y8QB 3T1BA 5CQEA 4A3GJ 3DKXA 1LQ1A 3OYIA 1BB8A 2J5PA 4KWYA 1AA7A 3ESWB 3K2ZA 4M30A 1Y8RB 1FZPB 3DU5A 4B4CA 1X6HA 3L2QA 4BEHB 1N25A 2HEOA 1Y39A 1J2XA 4R2PA 2VN2A 2MLGA 2R7OA 2Y30A 2JXPA 3I5UA 2XRNA 3CMMA 1FJLA 5D6FA 2DMNA 1ZH5A 2CPNA 1ZK8A 4CZZA 3LLHA 2V79A 1X1DA 5JLXA 2RQQA 4LF8E 3DPTA 3MN2A 1TLHB 2DMUA 4EJTA 1X4OA 4YFXF 1WXRA 2EPPA 4MLQA 2MFZA 3GZNB 2JPBA 4FE4A 2LC2A 4C2MJ 1HW1A 2HPIA 4KT6A 1YS6A 1ZHFA 2F6CA 4BC9A 1U6GA 5D4SA 5K5RA 2CMPA 3CUOA 3O6BB 2MC6A 4NC8A 2ZSIB 3G71I 5HS7A 4CICA 2A3SA 5JR3A 5DV5A 1Y1VJ 2X6OA 3CMEI 5FGMA 5KAIC 1VQLI 5A69A 1T0FA 4U0VA 2EL6A 1NHAA 2LTPA 4WYQB 1RUOA 4JYAE 4K0KE 2O8KA 1ULYA 4JI4E 4XONA 4ENJA 1OMIA 1IQSA 3DF8A 2M0CA 2DLLA 3HUGB 4OU0A 3DCFA 4HLXA 1GLNA 5DCMA 3KYLA 2I13A 5E8IA 1MSFC 4M2ZA 2ENAA 1SEUA 1ERDA 4RBOA 1DQ3A 3FF5A 2RN7A 3JRHA 2K7LA 2DA6A 1ORKA 4A3EJ 2NAZA 2EA4A 3IRQA 2G7HA 3HG9A 2LE2A 3KYCB 2Y48A 4BH9A 1R1TA 4M74A 3G1LA 2OD5A 5L3FA 2UXNA 3DTEA 4OIRF 5H6QA 2E1NA 1YX5A 2CSHA 1YQAA 2DOEA 3CCRI 2YTGA 5LBQA 3GTJJ 1Y56A 3HBLA 3HIFA 2D45A 2HYGD 3JRAA 1IUFA 1RESA 4F9AB 2ZJPF 5L3EA 1K6OA 3TMOA 1GQEA 2ADRA 2EPAA 4ENNA 4OOGC 2HQRA 5KL2A 2NUGA 1ZTRA 1MGTA 5D8KB 4RDUA 3BROA 1YITI 1O3SA 3H3UA 1O7LA 3OSFA 5CVIA 5D6EA 2QSHX 4M9ZA 1FOXA 2LO3A 1AWCA 4ASNA 3PUFA 2MKDA 4A5MA 2MBFA 3QPLA 2OC6A 3EYYA 5KL5A 5JVTA 1R00A 1QZEA 1QGPA 5FD5A 3EPLA 1XPXA 1Z1BA 1U2WA 1WSUA 3PO2J 4IRHA 3W6JB 3OYAA 5EZHA 4D5CA 1QQIA 2PFBA 2UXCE 3BDDA 1K78B 1G2FC 3KP4A 1X6FA 3DLAA 1FYKA 2EFWA 3T8RA 3FISA 2DLQA 1ETWA 3KP6A 2ODRD 2EN8A 1DGCA 3CC2I 1T8IA 1MBGA 3K4CA 3FMRA 5AE3A 2ICWG 4F3QA 3WU1B 2CO5A 2HOAA 2QBYA 2V85A 3FBIB 2QZ8A 1IF1A 4V19K 3RIRA 2YX7A 1A1JA 2RV8A 3SFIA 1V54H 3BR3A 2VKDA 2W48A 1ZR4A 4CH7A 2LKPA 1XB4A 1KU7A 4AC0A 2XKOA 9ANTA 5FROA 2WZOA 1VNDA 3K4LA 5D5XB 1BIBA 2G7UA 4Y33A 2YSPA 1BR4A 4E7ZA 3OYKA 4LG0B 4DV2E 3GLLA 1KZHA 2NS0A 3IH2A 4IZZA 3GTOJ 4UB8C 2LREA 2QGUA 5BMZA 2DB2A 3HHGA 3FXMA 2H1LA 2OAZA 2MD5A 1LE8A 3E5XA 1FNNA 4S04A 2ZJRF 4O43A 1FIPA 1TQMA 3E97A 2NVXJ 4YIFA 4BXUA 1Z0XA 3JCUC 4DR7E 4I7HA 3DJWA 1B9MA 3VYXA 3OR2C 3A2KA 1E3PA 2MG4A 2VKVA 2W85A 4Q48A 2HDDA 3GWZA 2DPUA 3CCEI 2K4BA 4RGXA 5ICEA 3PNVA 2R5YA 1X48A 2FOKA 1UAAA 2NA2A 4XLPF 4O24A 1R6RA 3H36A 2W00A 3BJ6A 4CYDA 3Q0UA 3A01B 1N36E 2K9SA 2FD5A 2EM7A 2A6HF 5CVRA 1F2IG 1A04A 1J26A 2X1DA 3O8GA 2A05A 2XPUA 3D5SC 3O3KA 1REPC 3I58A 1WHNA 3CP8A 4DOZA 4IHYA 1A6IA 2HQNA 1T6SA 4HV6A 5FKMA 4XRFA 3IH4A 5TISC 3WHCA 1W7PD 5KCMA 4F9CB 4UV9A 2A25A 2L02A 2EMXA 1TWGJ 3THNA 2P7CB 2LUQA 2XF5A 3HSRA 1F1ZA 3BPVA 2YTOA 3BG7A 2B0LA 2O6GE 2DW4A 2NNNA 2EZ6A 4RAGA 1RZ4A 3SDGA 2K3FA 1OLTA 1QHHD 4G7OF 1JUMA 5HDKA 2LVHA 1W5CC 2CQQA 4HF2A 4ESBA 4C9YA 1GUUA 3NRVA 4BXFA 2A5WA 1YI2I 3WTTC 3ZMZA 3H0GJ 3BF2A 2E71A 4B48A 2EQ3A 2R7TA 4B8XA 2M9AA 5CQGA 3O2PE 1GXQA 2P4WA 5K1YA 4DNCA 4A3FJ 1G3YA 2GIZA 2HKXA 4P9FA 2LBSB 1K4TA 2WAQA 3F6GA 1KA8A 1YE9A 2VQCA 3KPHA 1T4LB 1U5TA 3ABKH 4BL0B 1FEXA 1HSJA 1NG6A 2QA4I 2E7XA 2EMFA 2EN4A 3M99B 2EV6A 1Z7LA 4NXME 4LGWA 4FK5C 4WF2A 1WH5A 2HU9A 3S15J 3JRDA 2UV1A 1ZELA 2ESHA 2CQNA 1HW5A 4ZTJA 2F5FA 2DODA 2LBFB 1TNTA 4BC7A 2F4VE 2EOJA 1YUJA 2W1OA 4PCQA 4WCGA 1IN4A 4AUXA 2E35A 2EZIA 5DYMA 2YPNA 1MSEC 5FRMA 1IRXA 2X6YA 2EPNA 3RPUD 1EF4A 4XKBA 3I54A 2QLZA 1J7KA 4GCVA 3OS1A 1J5YA 2EM8A 3MSWA 4XLNF 2KISA 3WG9A 2ACJA 1I1SA 4GZNC 1JUPA 4ZZLA 2BV6A 1QU6A 3GTKJ 3BTIA 4DV7E 2FEZA 4WPYA 3CJNA 1FBSA 2G9WA 4L5EA 3UK3C 4BUPA 2ECBA 2XIGA 2L8TA 1FLIA 5LLQA 2HKOA 2YTIA 1LDDA 2JSCA 3ABMH 5GTIC 4YIRX 5A6BA 5CPRB 2XPVA 2RS6A 1XSXA 2JT1A 4OMZA 2A5YB 2ZM6E 1S29A 2RPCA 5D8LB 2WB1A 4I01A 3VOEA 5B5EC 3D5LA 2LTRA 4F54A 1LJ9A 2FNAA 2CW8A 2OA4A 2VASA 2E2JJ 4D7MA 3S1RJ 2DI3A 2Q0OA 2XAJA 4IJAA 4LIVA 5ILSA 4LFBE 2EILH 4IQ4A 2EM3A 2DMIA 2PBIA 2GOMA 3I3LA 4ENMA 2E72A 1TWHJ 3HYIA 3IWFA 1SC7A 1PJQA 5GADJ 3REOA 3EPJA 2XAHA 3OIOA 3RYRA 1LE8B 3OYMA 3MKWB 2YTPA 1FWZA 3B02A 4DIQA 1G2DC 3T0YA 3SYTA 3QYBA 1T08B 2IPQX 4N0BA 3RCOA 3RPQA 3KEOA 3ZMTA 4KIBA 4O5VA 1JTYA 4EM2A 3LAPA 4J19A 1WJCA 1T39A 4RGUA 2H8RA 1S72I 3J7AY 1J9IA 5LEJA 3H3ZA 4LG0A 5E1WA 5M5XJ 4B3AA 2UZKA 5AE2A 2M45A 1SMYF 1J5EE 1N34E 3Q0VA 4XRSG 4FTHA 2LK2A 3GO5A 1WJDA 4UUSB 2EM2A 3JSPA 2H94A 2K4VA 2XUBA 4HX7A 1QHGA 2VC0A 1ZRFA 1T33A 1K79A 4XR6A 4A3KJ 2BW3B 4E7SA 3PFIA 2NNYA 3UNGC 5CKTA 3M7GA 5C4XJ 1YYWA 3GMEA 3PNYA 2L01A 1NK2P 1X6EA 2KRHA 2QF7A 1R22A 1ZLKA 1JT0A 2VKHA 1K6YA 2M3AA 3RQIA 3HPGA 3J7ZI 3LQQA 3CDLA 5EYRA 5EG0A 5DNYA 2AXTC 1PVEA 4V2GA 1XNRE 1K78A 3QYEA 4C2TA 1A6QA 2KHXA 2N3HA 3F8MA 4L0ZB 3GXOA 2AXLA 1U5TB 1VQ4I 1WHQA 3R6SA 1BOAA 2MLKA 5IYBJ 4A2UA 4F91B 5IY5H 3ZMVA 3KE2A 1KONA 4Y3OA 3V8LA 3WTWC 1HLVA 3H3VK 2EM9A 1X49A 5DTDA 3E6DA 3IL2A 1VQ9I 1ZBTA 2V9KA 3BQZA 3M07A 3NAUA 2KLOA 4LTYA 2PEXA 2IXSA 2ZMEA 3B73A 1UB9A 4MEYF 1P92A 3KZYA 1KU2A 1EH6A 3OYFA 3THOB 5ILVA 2MC4A 2Z9OA 1JHFA 5LHHA 2FE3A 1MBJA 4B1RA 2ZBKA 4BNCA 2K4JA 3MWMA 1LUJB 2JWTA 4CCJA 5GP9A 4CYCB 3CCLI 1B69A 3HOYJ 1SD7A 1H9GA 3SEQA 5DDGA 1OFCX 2PQ8A 2V1DA 4JX5A 1FBQA 4XRMA 2FQ3A 2JVHA 2LSOA 4RAZA 2PLYA 3EPZA 1CF7B 1MBHA 3BR6A 4F7ZA 3IWDA 3HTUA 4UVCA 5B3SH 4BGDA 4IL6C 4I09A 5JHFA 4A93J 1VFCA 1YSAC 1YUIA 4ZTFA 1NTCA 4KIGA 4AIHA 3IUOA 1R1VA 2PMZN 4P1WA 3WE2A 2YTNA 3L09A 2GOXB 3BJOA 4ESFA 4M3EA 2DGCA 1IXSB 2VF1A 2HI3A 5H6RA 4R2AA 3TGNA 2H09A 3LFUA 4CXFA 2JA8J 3DP7A 4PJ0C 5DCMB 2STWA 1OYWA 2V9VA 3DEWA 5ERIA 4I98B 2AQFA 2RQLA 3VSKA 2JPAA 4BBSJ 2IAIA 3GFMA 1IGNA 1KJKA 1TWCJ 1XTAA 2CV1A 4LF7E 4GYIA 3EPKA 4ANJA 4WSGA 1ZGAA 3BR1A 2WBTA 5KL4A 1R4MB 2XRLA 1BI0A 5F0CA 3BG5A 4HF1A 2DK5A 2FBHA 3HOSA 4DV1E 2CQXA 1XMQE 3CO7C 3ZGKA 4CO8A 2IGOA 2ELYA 1BBYA 2NVTJ 1XSVA 2QSFX 5BS6A 3C6KA 4X8WA 2JR1A 2VPLA 3K6QA 1P6RA 4DMIA 5F04A 2JWOA 4BQAA 2L5QA 1X1BA 4L5IA 1MH4A 2WV1A 2Y9ZA 3OWTA 1SFEA 2GPIA 3FMQA 3QG5C 2EN3A 2F5VA 2HS5A 1MJAA 2H36X 2DPDA 2JA7J 4ZYEA 2P5VA 4KNYA 4L18B 2LTSA 1SD5A 2EMZA 3ERMA 4JI5E 3CDHA 3MMYB 1ON2A 4BEHA 2LNBA 2CUJA 1G3WA 1T95A 2FX0A 2OU2A 3LWFA 5A6KA 3LSIA 4IVNA 5DD4A 1S6LA 1RETA 3IWZA 1B9NA 1YPNA 4G9YA 1BI3A 2M87A 3ZOBA 3UR3C 4I0BA 1XG1A 2KIFA 4U88A 4E7KA 1MMSA 3DKYA 4HSRA 3M1CA 2IA1A 4CCMA 2IS6A 1KYZA 1G6NA 1MZBA 1WRJA 1BR1A 3F21A 4JI6E 3JRFA 2CUEA 3ZR8X 2ZO4A 2JSPA 4C2UA 1PDAA 2E1MA 5KAFC 2JP9A 3C2GA 1YS7A 1GHCA 3BT9A 2ID3A 4XKVA 2ZJ2A 1E0EA 1VF9A 1H8AC 1W1WE 3FIWA 4M3BA 1PP7U 2DK8A 3QU6A 4P78A 2EFNA 4UVAA 1YIJI 3S2DJ 4A3CJ 3H5RA 2BYVE 4IRGA 2D5VA 4PFOA 2JRTA 1YJNI 2YTDA 3QP6A 3RJPA 5K7ZA 2ZCWA 2EMCA 4GDFA 3K7AJ 2EIJH 4XSXF 2NVQJ 1B4AA 2I8DA 2ZC2A 2DFEA 4PGHA 1U5TC 3ZQGA 3VHTB 5BPDA 2R93J 1QU3A 1E3HA 4CUGA 2RS7A 1W0TA 5D4RA 4KIFA 3JRCA 1IBLE 1I1GA 2EOQA 1V5GA 4LLNA 2YRKA 2HHHE 1VQKI 3I53A 4LITA 4DW6A 1DP3A 2DJNA 2OF7A 2ZXWH 3HKZA 3PQKA 3TOBA 3JRGA 5F6FA 1WPKA 2GM4A 3CESA 4BYYA 1TWAJ 2K9NA 2RVCA 3NQOA 4DQ2A 1HR0E 1RC9A 4LK0F 2NUFA 4A6EA 1HA8A 4XNFA 3F8NA 2YR2A 5JVGF 1IZ1A 4C3IJ 2YSOA 2NS8A 4Q47A 1ZYRF 2DQRA 2EMIA 3I59B 1LKXA 1WH7A 4LJZF 2NXNB 2DMPA 1YRNA 2HGHA 1RQ0A 1TZLA 2OZ6A 2M8GX 2XAUA 1MKMA 1D0ZA 3KX2A 2VBXA 4CSWA 2EN1A 3H09A 2ID6A 3TO7A 3J80Z 3G4SI 3A0HC 1QO0D 4LLGF 1OYIA 4HA8A 4ZJZA 3ZN1A 2JK3A 4YHHE 4AVPA 3HOXJ 2EOMA 1TF3A 4XN0A 4WX9A 2M1SA 4MHGA 3EDPA 1CQTA 1XGNA 2KDZA 3RKXA 3V7CA 4R8HA 2H8WA 4FQGA 2EWLA 3J81K 1HF0A 3JTZA 3I4PA 1J0RA 1YOVB 1OQYA 3K4MA 3D1NI 4OIOF 1YYKA 1W4MA 1YO5C 1IMUA 3BY6A 4E4HA 5EEGA 2OTJI 1DPUA 5BQTA 4HX4A 1H88C 2X48A 2ZSHB 3N4MA 2A69F 4KN4X 4LOCA 1GV2A 4NHJA 1ZU1A 4A3MJ 3C4BA 4XOPA 4DYCA 1WJAA 1P9QC 4N9HA 1TTYA 1MNMC 2MABA 3CJQB 3ZQCA 1W5TA 1X3WB 1B72A 1U78A 4HV5A 3ABTA 4RLQA 2BEOA 2ISYA 3NARA 4JOMA 4XM3A 1VTNC 4DR3E 2EM5A 1X1AA 3TL4X 1FMVA 4MLOA 2EMHA 2FQ4A 2DA7A 2IA0A 2VODA 3C4TA 2MC3A 2ZFUA 4WK8F 4JI7E 1IJWC 1RRJA 1V55H 2EA2A 3P5JA 1O57A 4D5FA 4O4KA 2IP2A 1R36A 3I59A 2KKOA 2JN6A 3OS0A 3ABLH 2XSDC 5J8FA 3HPHA 1BM9A 1E17A 4KUMA 5E1XA 5AC5A 4AYBN 4DV4E 4ZYHA 1BBOA 1ZLJA 2ETHA 4M9XA 3WODF 1Z77A 4E7HA 3TO9A 3X2QH 3HRSA 2VE7C 4PJLA 4II3A 4CDGA 2F5EA 3HGGA 3HL2A 2FMLA 1AU7A 4IHXA 2R5ZA 2QYOA 4LB6B 2ELZA 4BBYA 3L7WA 4IXAA 2M30A 3WU0A 2HXOA 3K4NA 4OIQF 1IRGA 4NXNE 3KP2A 1B59A 3LSRA 2Q8KA 2CQKA 5E1ZB 1D0XA 1I3QJ 3PUBA 3QQAA 1R5GA 2LDUA 1Z21A 4HQEA 2EFPA 2ESNA 1LVKA 2BVMA 2O3FA 2KJCA 2ZJQF 2DT6A 3E0JB 2D2WA 1TP4A 1BR2A 3S8PA 3SZTA 1ZN2A 3CC4I 4IOCF 4ABZA 4BMJA 5IP6A 2YU3A 3ZQFA 5BNGA 1MEYC 4DR2E 2BBGA 4LIUA 4XLAA 2V87A 4IJDA 1STZA 1OYYA 2KIUA 3VODA 4I6ZA 4XKCA 2JA5J 3LSTA 1BN5A 2ZMEC 1X3UA 2AHQA 3LA7A 1YX3A 2HNHA 2BY1A 1WJBA 3KEYA 3WTZA 1F9NA 3ZQQA 5KNLA 4JI1E 1OCPA 5GAHJ 1NK3P 2VJIA 3V8KA 2LG4A 3FK7A 5AE1A 3OOUA 2EOIA 1IBME 2Z5UA 3RKWA 1BJZA 4TV7A 2F4IA 5IOYA 3MKZA 3BG6A 2EMYA 1GZ6A 2MW8A 4W97A 4DYRA 2JPCA 3GFIA 4RAYA 3GUDA 3HJEA 1FOWA 2EM0A 4OWRB 1ITYA 1V4RA 3U9GA 3OYHA 5EF6A 4YG2F 1YZ9A 2Y0SN 1F4KA 3GTPJ 2DYSH 2R7ZJ 2OZUA 3HKZN 2EMAA 2NABA 2QKLB 2KFDA 3ZMUA 4F92B 2PMHA 5F64A 1FYMA 2DYRH 3BG9A 1IN6A 5E3OA 3RKYA 2RDPA 2MC5A 3DPUA 2FF4A 2WCC3 3HSEA 4EMSA 3HEFA 3CD6I 3TKYA 1I3AA 2HOSA 1MMNA 4LFAE 4OAYA 4RB2C 3E6CC 4HW0A 4E7IA 3A01A 4C3HJ 2V26A 4O6JA 1RKWA 1OCTC 2YX4A 2NUEA 1LFPA 1I6XA 2EIMH 2LY9A 4KJZA 5KL6A 3VYTB 1N32E 3FXRA 4C30A 2EMBA 4IPAA 2B3TB 2HQ5A 3MCZA 4KT5C 1BW5A 2DT7B 4U7DA 2XB5A 3LOCA 1UZCA 2EOEA 2OBPA 3F8FA 2M8EA 3KP3A 2YTJA 1DI2A 5HS9A 3TOAA 1ON1A 2MH9A 2HVRA 1XDUA 2NVYJ 2WY7Q 3L2VA 1T0FC 4S05A 2O03A 3QOPA 4NQWA 4CCLA 2L3DA 3FM5A 3Q3SA 4PSXA 1XC5A 3RQ4A 3K6GA 4BE0A 5K7HA 3HM5A 3QWLA 4FE7A 1X4PA 4KDPA 4HQMA 3PSFA 4AIDA 2WBMA 3FHNA 4E7LA 5FRNA 1WJEA 4RMNA 1YW7A 4N4NB 2CV0A 4NBQA 1P7JA 2YUSA 2EOYA 4DV6E 1HKQA 3AFHA 5E8GA 2DFHA 3MQ0A 4LB5A 2JA6J 1BC7C 2EM6A 1DPRA 3HOTA 2K85A 1ETOA 3CCMI 2ZKZA 4XRSA 4DZJA 1FX7A 2VBYA 3BTJA 2XGXA 4W1UA 3HOWJ 5M3FJ 4X6AJ 5KVRA 3K2AA 4GEQB 2EMGA 4CA0A 2WC2A 2VPRA 3I0TA 4QTRA 1N78A 3BCAA 5HOOA 2VXZA 1ZG1A 4IHVA 3I4NJ 4Q5SF 3VFZA 4IF4A 2FGGA 2DDAA 4X64E 1LLMC 4MTEA 3OV8A 5HLTA 2HDCA 3AL0C 2EMWA 5FLXC 4XLFA 1U3EM 2K3PA 3BG3A 3EETA 4D1QA 2QKMB 1QVTA 4RS8A 3I4MJ 4JBAA 4BJ5C 4P55A 5A2QC 4XLCA 2N8GA 4M71A 2EOXA 1XGSA 4YEJA 2JMWA 4CGZA 4LF4E 2L9SA 2M9HA 4A0ZA 3P9KA 2XROA 3JSOA 2V88A 3L9FA 1XN7A 2LR8A 2XAFA 3VDXA 2UUBE 2WTEA 2EQRA 2DFIA 3QPHA 1RPWA 1EV7A 4AIJA 3MFKA 2KONA 5E18F 5AC4A 4XN3A 4IRIA 2EMKA 1IG7A 2BVLA 1HKTA 3CDIA 5EJCA 2IHR1 2EQ0A 2IRFG 2HTJA 2MKNA 2X0LA 1T38A 1HOMA 2EK5A 1JT6A 1STUA 1DGWY 4P96A 3QOEA 1WFXA 3A0BC 3GCMA 5A2QK 5FLXZ 3J7AG 1IRZA 1GVDA 2HQAA 2EP3A 1A1KA 1NEIA 2R0QC 3ZXSA 2R3SA 5J3LA 1VI0A 1Q1HA 1G3TA 2Z1DA 5CFFE 2B7EA 1POGA 1OCRH 3E5UA 2PJPA 3TW6A 2D1VA 2V8QB 1Z3YA 3HPSA 2ZXHA 2LFBA 2A61A 3BCBA 4EJUA 2DMYA 3IWBA 2HVQA 3WTUC 1UG0A 1XDSA 1HQCA 1IXCA 3S2WA 1G8XA 1QZYA 3W6VA 3C6MA 3VYYA 2FBIA 2F5DA 2V1NA 3QAHA 4Q35B 5CVUA 1Q1VA 1X2MA 4RGRA 3RDIA 3H9QA 4D9JA 2L92A 1GDTA 3EQ1A 4P7DA 3BJAA 3Q0WA 5FKNA 3TEDA 3AUZA 5KL7A 2K9MA 4UY8I 2GXBA 5JLWA 1MDMA 3R0AA 1S7EA 3VSLA 2LH9A 3HOUJ 3HRTA 3MEXA 5J1YA 1WQ2A 4RLFA 2F4MB 2BXZA 4Y4RA 2JY9A 4MLVA 3VK6A 2JTVA 3D5RC 3GW2A 1MBKA 1IN5A 1JGGA 4IHTA 2LVSA 2Y31A 4L9JA 5E3MA 1KQ8A 1MNDA 3BZCA 3DWLE 5D5UB 3QYFA 2TCTA 2VBZA 4MQVA 3GTQJ 5KL3A 2CT1A 3KEQA 4AQYE 4E70A 4A6DA 4UHTA 4HNUA 2ENCA 5LRSA 3RPUA 3AG3H 3GVAA 3E5QA 1RNLA 2BW3A 3DBRB 5DS9A 4U0YA 2V86A 3LMLA 4BCAA 2RTXA 1QZZA 3F23A 4RM2A 1ZAAC 2L4MA 5GAGJ 4MO7A 2DO7A 3C2BA 3DQVC 1K83J 3VB2A 3FK6A 4K2EA 5E17F 2XPWA 3NWSA 1DQUA 1MBFA 1DP7P 3SJMA 2FRHA 1J75A 4UXNA 5A6JA 1S5LC 2X1EA 1NH3A 4AM3A 2WV0A 5L3CA 3COAC 2I9IA 1D5YA 2EOOA 4MQ9F 1ZREA 4KFCA 1E2XA 2E2IJ 5HLIA 4ZYGA 1IXRC 2JZYA 2FOWA 4EGYA 2WWYA 4BKXA 1NCSA 2R7FA 2W24A 4MEXF 3VEPA 1ZRCA 3HDDA 2PG4A 4G8XA 4WXDA 5BR8E 3RKQA 4WWCA 1XGMA 5FKKA 1V3FA 2EZKA 3K70C 3T5XA 3CCUI 2V6EA 2Q8UA 3T8TA 4WXHA 5TJJA 2VB6A 2IS1A 3ECOA 1IBKE 2XVCA 1LPQA 4FETA 1UFMA 3U1DA 1K7AA 1G2HA 1I5ZA 2E34A 4UB6C 3HTSB 3PO3J 4JI8E 2UUAE 2M1BA 4BJTA 1X3CA 2DIXA 2M7BA 4N9IA 4P5OA 2DA5A 3E1SA 1W0UA 1PUFA 2HPMA 4NHRA 4DGWB 3BLYA 2OV7A 1W36C 3K0LA 1RI7A 4I76A 1GXPA 1HXDA 3IC7A 3HRUA 4KYWA 4EGZA 4R03A 1D8KA 3QODA 3ONQA 2R1FA 2LJHA 2M7AA 1S7AA 1L0OC 5FFXA 2XGDA 3S1QJ 1ZG5A 4PZJA 2CV2A 1IRFA 3BGHA 3DF6A 4M9VC 1XX5A 1A31A 2EJ4A 2IW5A 3WGGA 5HLHA 2UU9E 2HGCA 4LK1F 2RREA 2GXAA 5HLGA 5ED4A 2P6SA 3FMSA 2EPZA 1FKAE 2KIMA 2PMZA 2ELKA 2AS5F 2WAQN 3M3YJ 4HBLA 2GIVA 2ZXIA 3KLNA 1DDNA 4CCOA 1D1AA 2V89A 2HWVA 4R1HA 4BE1A 3P7NA 3HTXA 4KN7X 5J1RA 5E3NA 3F0CA 2A6TA 3BR5A 5KK1A 2GLOA 4DV5E 2IGMA 4FCYA 4A3DJ 3F6VA 2IGNA 3L00A 3MHHC 3HHHA 3S32A 2PX9A 5F1JA 2EH3A 3OYJA 3CF5F 2XC7A 2L33A 4F6NA 4EM1A 4Q4ZF 1U8BA 2NRAC 2KOUA 3LAJA 2ZFWA 3W2WA 3IV5A 3ERED 2UXDE 2P5KA 3S17J 3ADJA 2XF7A 2O9LA 1UJ8A 2R92J 1HKSA 3L2RA 5CYVA 1S9HA 1P7IA 2IJLA 5J40A 2EN2A 5FJ8J 2JUCA 3QU3A 4FHTA 1ZARA 2MGQA 3GLXA 2GHFA 3BR0A 4I8OA 1BW6A 4LMYA 3MKYB 1TL8A 4NDLA 4BXXJ 5KHDA 5HNHA 4UUVA 2W7NA 1HDDC 1FSEA 1EH8A 3K1PA 1ZR2A 2V83A 3OYGA 1MNEA 2E1OA 1MMDA 1TQIA 1Z7UA 3H0DA 2EL5A 2QUFA 2TDXA 5B1AH 3HZJA 3M8FA 4FX4A 1Z05A 2L2MA 3GFJA 4X66E 3EUHC 1XGOA 4I0AA 2RGVA 1USSA 2E1MC 1ZAOA 2M34A 2COBA 1D1BA 4LG3A 4XSZF 3TQNA 4LU9A 4B43A 3PL8A 4TUGA 2ZB9A 2DTRA 3I9V2 4I02A 3OSGA 1JKOC 2K9LA 4EJVA 4R2SA 1A1FA 1MMGA 1BOBA 2TRTA 3C2HA 3D0SA 1RIOH 2F5CA 3H1CA 2DN0A 2CSOA 2GA1A 4F55A 4R2RA 1I50J 2V4JC 4Y15A 2DLKA 1LB2A 1F5TA 3IAS2 5LGNA 5TRDA 1X3ZB 4RHBB 3JAMC 2IS4A 2ZNYA 3CCJI 4ZDLA 2YS9A 1JE8A 5EDNA 3DTIA 4OMYA 2H6BA 2GWRA 3S16J 3JRIA 2LOOA 3A02A 4MIMA 2F48A 3NEUA 2ODRC 3M8JA 1SFOJ 1YW8A 1PYVA 4II2A 2EINH 3N05A 3J7YJ 1Y1WJ 3TQMA 4MGRA 4LFCE 3CC7I 3FKJA 3ROUA 2VQHA 6PAXA 2EOFA 1R71A 4UUSA 1LEBA 5DD8A 1SAXA 2YT4A 3BIDA 5AASA 1MW7A 2JVGA 3HUGA 4JV5E 4GGGA 1QPMA 1S8NA 3E6MA 4L0YB 4M3DA 2CH0A 4BS9A 2ELHA 1FY7A 2M5WA 3OL3A 5C3EJ 3FXKA 2LD5A 3ADGA 4L9NA 4KMUX 3AKZA 5TGTA 3GX4X 2P81A 1I27A 1MJ9A 4YIIA 4ZZDA 4M6YA 4B3TE 1TF6A 3M1EA 2R7QA 1MD0A 2K27A 5F27A 3RZOJ 2FJ1A 2Q1ZB 2PJRA 4WSPA 4G6QA 1IV8A 1Y0NA 4JX4A 4Z6YA 2VKEA 3HSFA 2Y75A 4JI2E 1LEAA 5F08A 2LBFA 1A5JA 3CMAI 3ZMSA 5CLSA 4BDZA 4M3GA 1ETQA 3IHUA 5L3DA 4R2DA 4PJNA 1XMAA 3GF2A 2DFFA 2VOPA 2K9QA 3HC7A 2ISZA 4X62E 4DJAA 3AL0B 1HC8A 1P4AA 2OQRA 5C44J 4BBRJ 1JHHA 1OJLA 2YTQA 4L9TA 3CJRB 2BOLA 3W6KB 2I10A 1GTKA 1FJGE 1CF7A 1IN7A 1B8IB 3R4KA 4HOBA 1XSDA 4KICA 2OJED 4L5NC 2JOXA 1XNQE 2MD0A 3L1PA 2DMQA 4B09A 4EVIA 4NZVA 1R5ID 3BTCA 2FUG2 1RR7A 4DKKA 1O7FA 2CGPA 1O3QA 5FLXK 3TP3A 5DEQA 2QQBA 3IAM2 4LF5E 3L2WA 1R9TJ 1RMDA 4RM3A 3IP4B 1PJTA 2J7JA 3ISPA 2CU7A 4I99C 3PJRA 2P7VB 1X1PA 1H89C 4KA4A 1EJ9A 2YTFA 4TUIA 3F22A 2H6CA 4I2OA 1MJBA 4IO9F 2Q2EB 4UVBA 5EEHA 2XGCA 2EB7A 4YY3E 1LDJA 2GA2A 3LNQA 3GBGA 3ADIA 1B8IA 2KZVA 3G6EI 2ZNZA 3AAFA 2FBKA 1LVAA 3DPLC 1GT0C 1RC7A 1W7PA 2IT0A 1W7PB 3PSIA 3LFKA 5ICGA 1G59A 2L3CA 3OR1C 1TWFJ 4QIWN 2XB0X 2EWNA 3LSMA 1PUFB 4G6DA 2K86A 1D0YA 3C7JA 1ONVA 2OCCH 4B3ME 2EL4A 4UV8A 1ACIA 3EQLF 4CYCA 2ENHA 4XOTA 3KIOA 5IPAA 3MZ8A 2A07F 2E2HJ 2VUMJ 3S14J 3OMLA 2L3JA 3K10A 1XCBA 3IRRA 3SEZA 1A1GA 1T4OA 1MH3A 5IP7J 5LMUE 2P6TA 2XF6A 2CUFA 1T98A 3G2BA 4E7JA 2EM4A 2CUZA 1T56A 4EJWA 1KGSA 5GAEJ 2L2KB 2KL4A 1ETVA 3CTAA 4GXOA 1HBXG 4X1EA 4M0VA 1W5SA 3GZ5A 4HF0A 1USTA 1FP1D 4DV0E 2DOFA 1GV5A 2V1UA 5EGOB 2R7XA 2LP0A 4U7BA 5LGUA 1T4NA 1EA3A 4QLCU 4AIKA 1J59A 3R61A 2HOTA 1L3LA 3ELKA 4XBFA 2E5ZA 5BOXA 3TP0A 1F43A 3SZPA 3EUAA 4M9SA 4R2QA 3BZ6A 1EKZA 5F0HA 5J4VA 3F3XA 4S0HB 2RSMA 1SFUA 4R2EA 2OQGA 1X5WA 2CFOA 4XK4A 4A3LJ 3P1XA 2PRTA 4KHPE 1LFUP 2D1HA 5HDGA 2XAGA 3L2CA 3FZVA 2HTSA 3JAMK 1R58A 5E20A 4N4OB 2LY1A 2FU4A 5F1RA 3FIGA 1A1LA 2EPMX 1SFXA 2R7RA 3V42A 2Z3YA 1C0WA 4PGGA 3KCCA 4R8OA 1YHQI 2EPUA 4M3FA 3QP5A 5EZGA 3H5AA 4B47A 2HYJA 3CCVI 4XKWA 2VC1A 4PUSA 3OY9A 2N8XA 1FBUA 3SHFA 2YZTA 3B6AA 4LFUA 3E6BA 2KZGA 5ICFA 2K40A 2LJUA 1IO2A 2DA1A 5HS8A 1WJ5A 2HC5A 2JVAA 1BI1A 5T6JA 1IW7F 1YJWI 5J47A 2PI0A 2FV4B 2PN6A 1D5VA 2B7VA 2RQPA 3LA2A 4NB5A 3CP2A 1LNWA 3CLQA 2HJJA 1I39A 3DTKA 1MDMB 4F6MA 3IH3A 5J6XA 1WGXA 2L2OA 3F8BA 4G6TB 3WTSC 2E5LE 3DFGA 3AV0A 2R76A 2ZMEB 2E5NA 2LKSA 5TSEA 2VLAA 2CW0F 3AG4H 3J7AO 4GKKE 5LL6R 3FXOA 3EUKL 1ZGWA 3BOQA 3GTGJ 4Y52J 2IVMA 1XD7A 3QPSA 3U21A 3WGIA 5LD2C 3DKWA 1XMXA 4AU7A 4DV3E 1JGSA 1WWXA 4PSWA 1WKMA 1YW9A 4FASD 1Y6IA 3B6CA 3M9AA 1K4SA 4X9JA 3K9TA 2JYAA 2QBYB 2CYYA 3VYRB 1KYWA 1UHZA 1R23A 4BQQA 1T2KA 3ZN0A 1H9TA 3ZCOA 1BA5A 5AIPA 1R4NB 2VXDA 2EORA 3G73A 2K5CA 1QRYA 2F4OB 2M4GA 4PJMA 2ADUA 4ETSA 5JI6A 3H9GA 4HX8A 2JJ7A 5HNFA 2YU8A 1UHWA 3U2RA 3K69A 2VIXA 1MBEA 1BC8C 4HSTA 3VYUB 3HXLA 1XMKA 2ECCA 2YPRA 2X4HA 2DT5A 3GZ6A 1DU6A 2W82A 4M73A 2M4KA 2YTEA 3VYSB 3MVPA 5DM6F 2G0EA 1IV6A 5BPIA 2VT2A 4UUTA 3F8CA 5JHUA 5ADZA 5LHIA 3T1HE 4BU2A 4HYEA 1N33E 3WHBA 4NC6A 4RA2A 5LMNE 4AVZA 2CWEA 1V5FA 3P9CA 4XLHA 3KP5A 4ZC3A 1X2NA 3IKVA 3ZPLA 4MTDA 4CCKA 2KIQA 3C18A 2LYCA 3J81C 4M72A 4BHCA 3SZGA 3W2AA 4HTGA 3LQRA 3HOVJ 2R7SA 3BC8A 3CZ6A 1H0MA 3F6HA 1DUXC 2O7OA 4QWQA 1IUYA 1FOYA 4OIPF 3KFWX 1ODDA 3S3MA 3P9IA 1RUNA 4G12A 1OCCH 2RC4A
chains in the Genus database with same CATH topology
2HOEA 3GYHX 3BP8A 2HR3A 5K5QA 1OPCA 3OOPA 3RTRA 4DR1E 5IT9K 1SMTA 3RMPA 2GZWA 1IAWA 5ICCA 2LUPB 1S3JA 1FPQA 2HFHA 5A2QZ 3J81Z 4Y13A 4DUYE 4RB1A 1TW3A 2UWMA 2P5LC 3HRMA 2B7TA 3HQ1A 2UUCE 2XASA 1P4WA 4YFNF 2DU9A 5AIQA 1YYOA 3ADLA 1G4DA 2DBBA 3MZHA 3OTOE 4L9VA 1AOYA 3GEZA 2FTXB 1FT9A 4GKJE 3JU0A 1R7JA 4DUZE 5AONA 4A12A 2GAUA 5DUKA 2Z33A 1XMOE 3Q9SA 5F3WA 5H20A 2BBYA 1TNSA 3SFZA 2EV5A 3FM3A 2VBWA 4BHBA 1Z1DA 3V8JA 1P4XA 2VT3A 3TDUC 3CUQB 2RC4A 1QBJA 3SXYA 1O3RA 4R79A 4A5NA 5LHGA 3ML6A 4A0YA 5D5VB 2F2EA 1KQ0A 3KP7A 4WXCA 3FWEA 1CGPA 1YTYA 3Q9VA 4GO1A 4KZSA 4OINF 3DXJF 1S7OA 3KZZA 2VONA 3ZQ7A 2J5OA 3ECHA 1PUEE 1HNXE 1Z91A 4G94A 4ON0A 1UCRA 3KLOA 2LF7A 1FYLA 3PQJA 2CG4A 3KETA 1R5HA 5L3BA 1Z9CA 3E3VA 5LGTA 2RNJA 2B9DA 4B3RE 2JOBA 4AD9A 2E1CA 1Y0UA 1ZBQA 3ZOQB 3FXQA 3F72A 3BWGA 4L8NA 5DCFA 1YFHA 3HPZA 2V6CA 2ZXJA 4ESJA 4PDKA 3T1YE 4DR5E 5CVJA 1LDKB 2FXAA 2GXGA 2V1XA 1QNTA 4EM0B 4GYGA 5IT9C 3TDZC 2A6EF 1FP2A 2L2NA 5K5OA 5JFRA 1KQ9A 4LF6E 4Y17A 3EYIA 2NYXA 2VQEE 4EJOA 4HDUA 5FFZA 3V4GA 2XHKA 2QQAA 1O3TA 1Z6RA 4G7ZF 3IWCA 4RB0A 2VE8A 2DAOA 3C3WA 3K1NA 1IN8A 1UHMA 4CHUA 2QVOA 2BGCA 1HNWE 2EV0A 1YG2A 1YYVA 2O61A 2HZTA 4FX0A 3M8EA 1BI2A 2XAQA 2A68F 3TO6A 3CUQA 2W57A 2LMZA 2RKHA 3Q5FA 1FSHA 5L3GA 2QWWA 2UXBE 3V7RA 2R7DA 3DEUA 4RGSA 1TW2A 2EFQA 3J7Yp 5CJ9A 3JTGA 4YFKF 1U8RA 2FSWA 4A0XA 3EUHA 3FHZA 2XV4S 3H92A 3WE3A 2KRFA 5FD6A 3WTVC 4ZYDA 4EQQA 3SQNA 2EFOA 3J80K 4IHSA 2F8BA 5FB2A 2QENA 5ILUA 4WFTA 3WGHA 3IKTA 1SD4A 2L6MA 2Q2EA 2STTA 1JXSA 1ZRDA 1X47A 4MNUA 5FO5A 2CFXA 4JI3E 3RI4A 2KJBA 2COMA 1UILA 3WTXC 2E7WA 4LLLA 4G7HF 1P2FA 2K02A 5J8CA 4UNOA 3JTHA 3MZYA 1BIAA 1HW2A 5HVQC 4LF9E 3JAMZ 3RYPA 4Z2YA 3ZMDA 1FOKA 2UXXA 5LEKA 3DV8A 3G3ZA 3WTYC 2O0YA 3ABUA 4HDVA 5IT3A 2FNPA 1OKRA 4O3MA 3LA3A 2GQQA 2DQLA 4B3SE 4FT8A 5IWAE 1YLFA 2L4AA 1SR9A 3I71A 3QPTA 1KU9A 4D0PA 2M4IA 3BPXA 3JW4A 4U0WA 4DR6E 4X65E 4BAYA 1ZG3A 2HYFA 3GFLA 2M7QA 4Q28A 1TQPA 4BHPA 3ULQB 3I64A 2Y0MA 1GVJA 2MDRA 4ENKA 2L54A 1B1BA 1FC3A 1B6AA 4JK1X 1D8JA 3FX3A 2C6YA 2DSYA 2BE5F 3QRFF 2PMUA 2FA5A 4H0EA 1PDNC 2IA2A 2QQ9A 1R1UA 4DR4E 1WI9A 4KMFA 1I94E 2W84A 3F6OA 4AWXB 4F9BB 2W25A 4HLYA 5IT9Z 4J8ZA 4P9UA 2YSRA 4M6XA 4HAMA 5HDNA 5CVVA 1BJAA 2O8XA 1Z6TA 3MAJA 1HNZE 2FMYA 4RB3C 2N3GA 2P8TA 3R60A 1O0WA 4HZFA 1HSTA 1SD6A 2QM3A 2XKPA 2LRSA 4OX9E 1OR7A 1EH7A 1XCVA 2VOOA 3ZP5A 3CUQC 3V7SA 1D3YA 5LRRA 3KWRA 2VE9A 4ZH4F 3N97A 2MH2A 4JI0E 1KU3A 2EJRA 1TBXA 1YIOA 2MA3A 4OOIA 3CLOA 1G3SA 3CO6C 1ZGJA 2LF8A 5D5WB 1PP8F 1PKPA 2VQFE 2Z99A 4EV0A 5DUIA 3FXUA 2H27A 3K1MA 4L5JA 4LD5A 3C1DA 3J80C 4JQFA 3R0JA 3T1BA 1LQ1A 2J5PA 3K2ZA 4M30A 1FZPB 2HEOA 1J2XA 2VN2A 2MLGA 3I5UA 2XRNA 5D6FA 1ZH5A 2CPNA 4CZZA 3LLHA 2V79A 4LF8E 3DPTA 1TLHB 4EJTA 4YFXF 1WXRA 2JPBA 1HW1A 1YS6A 1ZHFA 4BC9A 1U6GA 5D4SA 5K5RA 3CUOA 3O6BB 2MC6A 5HS7A 4CICA 2A3SA 5JR3A 5DV5A 5FGMA 1T0FA 4U0VA 1NHAA 4WYQB 4K0KE 1RUOA 4JYAE 1ULYA 4JI4E 4ENJA 1OMIA 3DF8A 2DLLA 4OU0A 4HLXA 5DCMA 4M2ZA 5E8IA 1DQ3A 3FF5A 2RN7A 2K7LA 2NAZA 2EA4A 3IRQA 2G7HA 2LE2A 2Y48A 4BH9A 1R1TA 4M74A 2OD5A 5L3FA 2UXNA 4OIRF 5H6QA 2E1NA 1YQAA 5LBQA 3HIFA 2D45A 2HYGD 4F9AB 1K6OA 5L3EA 1GQEA 4ENNA 4OOGC 2HQRA 2NUGA 1MGTA 5D8KB 3BROA 1O3SA 3H3UA 1O7LA 5CVIA 5D6EA 4M9ZA 1AWCA 4ASNA 4A5MA 2MBFA 3EYYA 5JVTA 1R00A 5FD5A 1QGPA 1U2WA 1WSUA 4IRHA 3W6JB 1QQIA 2PFBA 2UXCE 3BDDA 1K78B 3KP4A 1FYKA 2EFWA 3T8RA 3KP6A 2ODRD 3FMRA 5AE3A 3WU1B 2CO5A 2QBYA 2V85A 2QZ8A 1IF1A 3RIRA 2YX7A 2RV8A 2LKPA 1XB4A 1KU7A 2XKOA 2WZOA 5D5XB 1BIBA 2G7UA 4LG0B 4DV2E 2NS0A 5BMZA 2DB2A 3HHGA 2OAZA 2MD5A 3E5XA 1FNNA 4S04A 1TQMA 3E97A 4YIFA 4BXUA 4DR7E 4I7HA 3DJWA 1B9MA 3VYXA 4Q48A 2W85A 3GWZA 2DPUA 2K4BA 4RGXA 5ICEA 1X48A 2FOKA 2NA2A 4XLPF 4CYDA 3BJ6A 1N36E 2A6HF 5CVRA 1J26A 1A04A 3O3KA 1REPC 3I58A 1WHNA 2HQNA 1T6SA 4HV6A 4XRFA 1W7PD 4F9CB 4UV9A 2L02A 2P7CB 2LUQA 3HSRA 1F1ZA 3BPVA 2B0LA 2O6GE 2DW4A 2NNNA 2EZ6A 1RZ4A 4G7OF 5HDKA 4HF2A 4ESBA 3NRVA 3WTTC 3ZMZA 4B8XA 3O2PE 1GXQA 2P4WA 5K1YA 4DNCA 1G3YA 2HKXA 4P9FA 2LBSB 3F6GA 1KA8A 1T4LB 1U5TA 1HSJA 2E7XA 2EV6A 4NXME 4LGWA 4WF2A 2ESHA 1HW5A 2F5FA 4BC7A 1TNTA 2F4VE 4PCQA 4WCGA 1IN4A 5DYMA 3I54A 2QLZA 1J7KA 4GCVA 3MSWA 1J5YA 4XLNF 3WG9A 2ACJA 1I1SA 4ZZLA 2BV6A 1QU6A 4DV7E 2FEZA 4WPYA 3CJNA 1FBSA 2G9WA 2XIGA 2L8TA 1FLIA 5LLQA 2HKOA 1LDDA 2JSCA 2RS6A 1XSXA 2JT1A 4OMZA 2A5YB 2ZM6E 1S29A 5D8LB 4I01A 4F54A 3VOEA 2LTRA 3D5LA 1LJ9A 2FNAA 2OA4A 2DI3A 2Q0OA 2XAJA 4IJAA 5ILSA 4LFBE 2PBIA 4ENMA 3HYIA 3IWFA 3REOA 2XAHA 3RYRA 1FWZA 3B02A 3T0YA 2IPQX 4N0BA 3RPQA 4EM2A 3LAPA 3KEOA 3ZMTA 4KIBA 4O5VA 4LFAE 1J9IA 1T39A 4RGUA 5LEJA 3H3ZA 4LG0A 5E1WA 2UZKA 5AE2A 2M45A 1SMYF 1J5EE 1N34E 3GO5A 3JSPA 2H94A 2K4VA 2XUBA 4HX7A 2VC0A 1ZRFA 1K79A 3PFIA 2NNYA 3M7GA 1YYWA 2L01A 1R22A 1ZLKA 3LQQA 5DNYA 1XNRE 1K78A 2KHXA 2N3HA 3F8MA 4L0ZB 3GXOA 2AXLA 1U5TB 1WHQA 3R6SA 1BOAA 2MLKA 4A2UA 3ZMVA 3KE2A 3V8LA 3WTWC 1X49A 3E6DA 3IL2A 1ZBTA 4LTYA 2PEXA 2ZMEA 3B73A 1UB9A 4MEYF 1P92A 3KZYA 1KU2A 1EH6A 5ILVA 2Z9OA 1JHFA 5LHHA 2FE3A 2ZBKA 4BNCA 2K4JA 3MWMA 1SD7A 1H9GA 5DDGA 2PQ8A 2V1DA 1FBQA 2FQ3A 2LSOA 4RAZA 2PLYA 1CF7B 4F7ZA 3IWDA 3HTUA 4UVCA 4I09A 4KIGA 4AIHA 1R1VA 3WE2A 3L09A 3BJOA 4ESFA 1IXSB 2VF1A 5H6RA 3TGNA 2H09A 4CXFA 3DP7A 5DCMB 2STWA 1OYWA 2V9VA 5ERIA 4I98B 3GFMA 4LF7E 4GYIA 1ZGAA 1BI0A 4HF1A 2DK5A 2FBHA 3HOSA 4DV1E 1XMQE 3CO7C 4CO8A 1BBYA 1XSVA 5BS6A 4X8WA 2JR1A 3K6QA 4DMIA 1P6RA 2JWOA 4BQAA 4L5IA 1SFEA 3FMQA 2HS5A 1MJAA 2H36X 2DPDA 4ZYEA 2P5VA 4KNYA 4L18B 2LTSA 1SD5A 4JI5E 3CDHA 1ON2A 2LNBA 1G3WA 2OU2A 3LWFA 4IVNA 5DD4A 1S6LA 3IWZA 1B9NA 4G9YA 1BI3A 2M87A 4I0BA 2KIFA 4U88A 2IA1A 1KYZA 1G6NA 1MZBA 1WRJA 3F21A 4JI6E 2ZO4A 2E1MA 1YS7A 1GHCA 2ZJ2A 1PP7U 2DK8A 3QU6A 4P78A 2EFNA 4UVAA 2BYVE 4IRGA 2JRTA 3QP6A 3RJPA 2ZCWA 4XSXF 1B4AA 4PGHA 1U5TC 5BPDA 2RS7A 5D4RA 4KIFA 1IBLE 1I1GA 4LLNA 2HHHE 3I53A 3TOBA 3PQKA 5F6FA 4BYYA 3NQOA 2RVCA 4DQ2A 1HR0E 4LK0F 2NUFA 4A6EA 3F8NA 2YR2A 1IZ1A 4Q47A 1ZYRF 2DQRA 3I59B 4LJZF 1RQ0A 2OZ6A 1MKMA 3H09A 2VBXA 3TO7A 3J80Z 1QO0D 4LLGF 1OYIA 4HA8A 3ZN1A 4YHHE 4AVPA 4WX9A 2M1SA 4MHGA 3EDPA 1XGNA 3RKXA 3V7CA 4R8HA 2EWLA 3J81K 3JTZA 3I4PA 1J0RA 4OIOF 1YYKA 1W4MA 1YO5C 3BY6A 5EEGA 1DPUA 5BQTA 4HX4A 3N4MA 2A69F 4KN4X 4NHJA 3C4BA 4N9HA 1TTYA 1W5TA 1U78A 4HV5A 3ABTA 2BEOA 2ISYA 1VTNC 4DR3E 2VODA 2IA0A 3C4TA 2MC3A 4JI7E 4WK8F 2EA2A 1O57A 2IP2A 1R36A 3I59A 2KKOA 5J8FA 1BM9A 1E17A 4KUMA 5E1XA 4DV4E 4ZYHA 1ZLJA 2ETHA 4M9XA 3WODF 3TO9A 3HRSA 2VE7C 4CDGA 2F5EA 2FMLA 2QYOA 4BBYA 4OIQF 3L7WA 4IXAA 2M30A 3WU0A 1IRGA 4NXNE 3KP2A 1B59A 2Q8KA 2CQKA 5E1ZB 1R5GA 2LDUA 4HQEA 2EFPA 2ESNA 2O3FA 2KJCA 2D2WA 3SZTA 1ZN2A 4BMJA 2YU3A 4DR2E 2V87A 1STZA 1OYYA 2KIUA 3VODA 3LSTA 1BN5A 1X3UA 3LA7A 3WTZA 1F9NA 4JI1E 3V8KA 5AE1A 1IBME 2Z5UA 3RKWA 4TV7A 1GZ6A 3GFIA 2JPCA 4RAYA 3GUDA 1V4RA 3U9GA 4YG2F 1YZ9A 1F4KA 2OZUA 3ZMUA 1FYMA 2PMHA 5F64A 1IN6A 3RKYA 2RDPA 2MC5A 2FF4A 3HSEA 4EMSA 3TKYA 4RB2C 3E6CC 4HW0A 4O6JA 2YX4A 2NUEA 1I6XA 1N32E 3FXRA 4IPAA 2B3TB 3MCZA 4KT5C 4U7DA 2OBPA 3F8FA 2M8EA 3KP3A 1DI2A 5HS9A 3TOAA 1ON1A 2MH9A 1XDUA 4S05A 2O03A 3QOPA 4NQWA 2L3DA 3FM5A 4KDPA 4HQMA 1YW7A 4DV6E 1HKQA 5E8GA 3MQ0A 4LB5A 1BC7C 1DPRA 3HOTA 2ZKZA 1FX7A 2VBYA 2XGXA 5KVRA 4GEQB 2WC2A 3I0TA 5HOOA 2VXZA 1ZG1A 4Q5SF 3VFZA 4IF4A 2FGGA 4X64E 4MTEA 3OV8A 2HDCA 5FLXC 1U3EM 3EETA 4RS8A 4JBAA 5A2QC 4P55A 4M71A 1XGSA 4CGZA 4LF4E 4A0ZA 3P9KA 2XROA 3JSOA 2V88A 3L9FA 1XN7A 2XAFA 2UUBE 2WTEA 2DFIA 3QPHA 1EV7A 4AIJA 3MFKA 2KONA 5E18F 4IRIA 1HKTA 2IHR1 2IRFG 2HTJA 2X0LA 1T38A 2EK5A 1STUA 4P96A 5A2QK 3J7AG 5FLXZ 2R3SA 1Q1HA 1G3TA 5CFFE 3E5UA 2PJPA 2V8QB 2D1VA 3HPSA 2A61A 4EJUA 2DMYA 3IWBA 3WTUC 1XDSA 1HQCA 1IXCA 3S2WA 1QZYA 3VYYA 2FBIA 2F5DA 3QAHA 5CVUA 4RGRA 3RDIA 2L92A 4P7DA 3BJAA 3AUZA 2GXBA 1MDMA 3R0AA 3HRTA 3MEXA 1WQ2A 2JY9A 3VK6A 2JTVA 3GW2A 1IN5A 4IHTA 4L9JA 1KQ8A 5D5UB 4MQVA 2VBZA 3KEQA 4AQYE 4E70A 4A6DA 4UHTA 5LRSA 3RPUA 3GVAA 3E5QA 1RNLA 4U0YA 3LMLA 2V86A 4BCAA 2RTXA 1QZZA 3F23A 2L4MA 2DO7A 3DQVC 3VB2A 4K2EA 5E17F 1DP7P 2FRHA 1J75A 4UXNA 2WV0A 5L3CA 3COAC 4MQ9F 1ZREA 4KFCA 1E2XA 5HLIA 4ZYGA 1IXRC 2JZYA 4EGYA 2WWYA 2R7FA 2W24A 4MEXF 3VEPA 1ZRCA 2PG4A 4G8XA 4WXDA 5BR8E 4WWCA 1XGMA 1V3FA 3T5XA 3T8TA 4WXHA 5TJJA 3ECOA 1IBKE 2XVCA 3U1DA 1UFMA 1K7AA 1I5ZA 3HTSB 4JI8E 2UUAE 2M1BA 2DIXA 4N9IA 4P5OA 3K0LA 1RI7A 1GXPA 1HXDA 3IC7A 3HRUA 4KYWA 4EGZA 4R03A 1D8KA 2LJHA 1S7AA 1L0OC 5FFXA 1ZG5A 4PZJA 1IRFA 3DF6A 2IW5A 3WGGA 5HLHA 2UU9E 2HGCA 4LK1F 5HLGA 5ED4A 2P6SA 3FMSA 1FKAE 2KIMA 2AS5F 4HBLA 2GIVA 1DDNA 3KLNA 2V89A 2HWVA 4R1HA 3HTXA 3P7NA 4KN7X 5KK1A 4DV5E 3F6VA 3L00A 3HHHA 2L33A 4EM1A 4Q4ZF 2NRAC 2KOUA 3LAJA 2ZFWA