2G7HA

Structure of an o6-methylguanine dna methyltransferase from methanococcus jannaschii (mj1529)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
167
structure length
167
Chain Sequence
MIIQIEEYFIGMIFKGNQLVRNTIPLRREEIFNFMDGEVVSNPEDEHLKVAEIILKLYFAEIDDKKVRELISYKLEVPEFTKKVLDIVKDIEFGKTLTYGDIAKKLNTSPRAVGMALKRNPLPLIIPCHRVVAKNSLGGYSYGLDKKKFILERERLNMVSFKFNKVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
publication title Structural studies of MJ1529, an O(6)-methylguanine-DNA methyltransferase
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 20
structure length 167
sequence length 167
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2006-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2g7hA02
3.30.160.460 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2g7hA01
1FSEA 4I7HA 3KP3A 4I2OA 4WCGA 3GX4X 5AIQA 1R1TA 4NB5A 1D5VA 4L5JA 2FXAA 1EH6A 4KDPA 4M6YA 3TOAA 3SZPA 2PBIA 2HYGD 2EV5A 1L3LA 2M1BA 2O0YA 1P92A 2V6CA 2ZNYA 3TO6A 2Z99A 4I0AA 5ED4A 2PEXA 2MH9A 2QVOA 4LB6B 1USSA 5L3CA 2P6SA 3B02A 4U0YA 2P5LC 2M5WA 3BWGA 2NRAC 3DEUA 5BS6A 5HLHA 4OIOF 4ASNA 4YIFA 1R23A 2EB7A 3IKVA 3RYPA 1YW8A 2BYVE 5E18F 5AIPA 3O6BB 2WC2A 1XMKA 3HRMA 4P9FA 1J59A 4KMFA 1EH7A 1LJ9A 2GQQA 1FBQA 2HOEA 1XB4A 1FOKA 5J8FA 1ONVA 2L3DA 4PCQA 3DV8A 5LEJA 1OMIA 1BI3A 6PAXA 2A3SA 3FWEA 2D1VA 4XLNF 2D1HA 2A69F 3CLOA 1T98A 2QM3A 3M9AA 2HKOA 2FQ3A 3FXUA 1K78B 3IC7A 1F9NA 3V4GA 2YX7A 4OIRF 5FD6A 3VB2A 2KIMA 3ROUA 1LEBA 4RGXA 2V1UA 3MFKA 2Z5UA 4NHJA 1Z1DA 2DO7A 5LHIA 2HYFA 1ZARA 3WU0A 3KZZA 3D0SA 3EYIA 1S29A 4Z2YA 3K69A 4CZZA 2DLLA 2E1NA 4UUVA 3KP6A 2FNPA 5L3BA 4BNCA 1U3EM 3J80Z 4RB1A 3CDHA 5CVIA 1YIOA 4WK8F 2RN7A 3N97A 1LDJA 3U2RA 1HBXG 1ZGAA 3G3ZA 3C3WA 3F8FA 3K0LA 2FNAA 2IT0A 1KQ0A 5CYVA 2XVCA 4LK1F 1S6LA 3GEZA 2Y75A 5DCMB 3J81Z 3GVAA 1MJAA 2H94A 2KIUA 1PUEE 4U88A 2MLGA 3COAC 2MBFA 2BE5F 1FNNA 4BHPA 1BI1A 1R58A 4EM0B 2EFOA 3JSOA 2FBKA 2KKOA 2JPBA 2G7UA 3K1MA 3H92A 3BZ6A 1LEAA 1RNLA 3L09A 4P5OA 3CUQC 4HA8A 1O7FA 2DK8A 2C6YA 3V8KA 3WG9A 3E5QA 4U7DA 2DU9A 3EETA 4YFNF 5FLXK 2CG4A 4LGWA 3IL2A 2XASA 2DT5A 3F6VA 3LQRA 2H09A 4MTDA 4EGYA 5ICEA 2CQKA 2EA2A 3Q9VA 2RC4A 3RIRA 1RIOH 4ZZDA 3KLNA 1R00A 3ZMUA 1T38A 2OQGA 1K79A 2STTA 3HSRA 1RZ4A 5F6FA 3ERED 4IRIA 4L9VA 5DD8A 4HZFA 3DF8A 5K5RA 5E1XA 2Q2EA 4A0ZA 4M9ZA 2XAGA 2FOKA 5JR3A 3SHFA 5BQTA 1ZRDA 1IW7F 4WXDA 4OMYA 2RGVA 2FSWA 4BH9A 1G3TA 2VOOA 4EJOA 3LSTA 2FRHA 2OZ6A 1GHCA 2VODA 5DUKA 3WTYC 2HFHA 2E7XA 2FMYA 2ZXJA 4BQAA 5AONA 1ZG3A 4EQQA 2KRFA 1SAXA 5D8LB 4YFKF 1H0MA 1IRGA 4AIHA 4BYYA 2JTVA 2O61A 3H3UA 5E1ZB 3T8TA 2QYOA 3SXYA 2OD5A 4ENJA 3CUQA 4N9HA 1IN7A 3TO9A 1TTYA 3KFWX 1DP7P 3WE3A 1MDMA 2COMA 2P6TA 1ZG1A 1BI2A 2UWMA 3MZHA 3O3KA 2NAZA 3HTUA 2GWRA 3KP7A 4MQ9F 3JAMK 4A5NA 1XDUA 2CYYA 2P5VA 2WTEA 2G7HA 3CO6C 3O2PE 4MTEA 2QUFA 1V4RA 2JSCA 1IN4A 1BM9A 4UVCA 2A68F 1BIAA 5HOOA 2NNNA 1R1VA 1S3JA 1XN7A 3F21A 5E8GA 2Z9OA 3HSFA 3I59A 1WSUA 1P4XA 1ZRCA 4P55A 2HR3A 1EV7A 4EV0A 3PFIA 3F23A 4HX4A 5JFRA 4AVPA 3BOQA 1R7JA 4GO1A 1J2XA 5CJ9A 3TOBA 4G94A 1OYYA 2UXNA 5CVRA 5HDGA 1H9GA 2XKOA 1SMTA 5K5QA 2VBXA 2QZ8A 2QBYA 1SD4A 2VXZA 3REOA 1TW2A 4YG2F 4A6DA 1HSTA 3WGHA 5J8CA 1IRFA 2LNBA 5FO5A 1O57A 3K1PA 3FXQA 5HS9A 5F64A 1J7KA 4A0YA 4FT8A 4CYDA 3H3ZA 4ENNA 2L4MA 2IRFG 1SFUA 4O6JA 5BPDA 2Y0MA 1C0WA 1HQCA 2FA5A 1OYWA 5LEKA 4UVAA 4BHBA 1UFMA 3RTRA 5DYMA 4HYEA 1G3SA 2VT2A 5CVJA 2KJBA 3I64A 2A5YB 2P5KA 2W24A 1PP7U 4HX8A 5EEGA 3LAJA 2HQNA 5H6QA 2HDCA 3WGGA 1JHHA 3D5LA 3ZPLA 1V3FA 4KA4A 4I0BA 4HF2A 1G6NA 2JPCA 3OOPA 1SD6A 3GLXA 4EJWA 3KCCA 5K5OA 4K2EA 2RNJA 2WV0A 4HAMA 3F6OA 1USTA 4IVNA 1QPMA 5L3EA 4AIJA 2B0LA 1BIBA 4DQ2A 1WWXA 3K2ZA 2YPRA 4ZZLA 1J0RA 2LDUA 1DDNA 5LBQA 2GA2A 2WWYA 1IZ1A 2YX4A 2HEOA 2LSOA 3BPVA 3GZ6A 2JT1A 5ICCA 2Z33A 3MQ0A 1T6SA 2OBPA 4I09A 3RJPA 4CICA 4PGHA 3ECHA 3GF2A 4CGZA 1S7AA 2HQRA 1UHWA 5F1RA 4L0ZB 3MAJA 4M9SA 1GXPA 3QOPA 2IVMA 5K1YA 2ETHA 5BPIA 4MHGA 3FHZA 5FFZA 1QQIA 4FX0A 4RB0A 4IF4A 4AD9A 4ESFA 1DUXC 1UHMA 5DD4A 4Y13A 4YFXF 1TNTA 4HW0A 1QGPA 1BC8C 2DI3A 3DKWA 2ELHA 1O3TA 2EFNA 4LD5A 4LMYA 3HRSA 3EQLF 2DAOA 5DCFA 4LB5A 3ZN1A 2L01A 3E3VA 2ADUA 4L18B 4GCVA 4HV5A 4GXOA 2R7DA 2GIVA 1YO5C 3NRVA 2OU2A 2W84A 2EV0A 3GXOA 1HW1A 2VBZA 2ZMEA 4I98B 2GA1A 3ZMSA 3ABTA 5DV5A 1FYLA 1B1BA 1DPUA 4ZYHA 1HW2A 1R36A 2A6HF 3DXJF 5FLXZ 3LA2A 4U0WA 2OA4A 2DPDA 5LLQA 4LK0F 4UNOA 3CO7C 1KU3A 5J6XA 2ZNZA 2PI0A 1YTYA 3ML6A 5ICFA 3F8MA 2LKPA 5DUIA 1K6OA 4OINF 4QLCU 1IAWA 3PQJA 1BOAA 3CUOA 4A12A 5TJJA 3T5XA 4N0BA 3ISPA 1J75A 1FPQA 2O3FA 1IUYA 2ZKZA 4U0VA 2OAZA 3BY6A 4EM2A 3V7SA 1KQ9A 3L7WA 2HZTA 4HDUA 4OIQF 2O6GE 5HS7A 2ZCWA 2EA4A 4QWQA 4HBLA 4RS8A 1XMAA 3F22A 4KFCA 2Q0OA 1SFXA 1HXDA 3KLOA 3ZN0A 2O03A 3HRTA 2QQAA 4IHTA 2K4JA 4HDVA 2XGXA 5L3FA 1Z05A 3GZ5A 4WXHA 2K86A 3FX3A 3P9IA 5ILSA 3V8LA 1Y0UA 2ISZA 1ZGJA 3PQKA 1MDMB 1T2KA 3QP6A 4A0XA 3GYHX 1LB2A 3GFIA 1AWCA 1U6GA 3HUGA 3RYRA 1REPC 2QQ9A 4GYGA 1KA8A 2J5OA 1Z7UA 1R5GA 3NEUA 2E7WA 2RKHA 1QZYA 3I5UA 4RAZA 2LF7A 2L4AA 3T1BA 3EUHA 1LNWA 3HSEA 5FB2A 2EJRA 4ESBA 3BJOA 2YU3A 3I59B 3J80K 4EVIA 3J7AO 3EDPA 2EFPA 3E6BA 4IHSA 3FZVA 1U5TC 1K78A 4E70A 2MH2A 2X0LA 3VOEA 2XRNA 3HRUA 4MGRA 1IXCA 3P7NA 3ZP5A 1S7OA 4ZYGA 3DPTA 4XLPF 1MJBA 3JAMZ 1F1ZA 3HHHA 2VE9A 4KICA 2PQ8A 1MJ9A 2QBYB 4L9JA 1KQ8A 2Z3YA 3P9KA 2ZBKA 2ACJA 5IT9K 3TDZC 2XUBA 3QP5A 3IKTA 1VTNC 5D5VB 1ZRFA 5ILUA 3T8RA 2PJPA 3ELKA 3RI4A 3JW4A 1O3RA 1A04A 5L3DA 4WF2A 3LWFA 1YFHA 1ZG5A 3WODF 2HTJA 1XGMA 1TBXA 2XV4S 2HGCA 3KP2A 4EGZA 3SZTA 2NNYA 2MA3A 1T39A 2RV8A 2L54A 4KIBA 1F4KA 5LRSA 1P2FA 2QLZA 1FWZA 4HLXA 2AXLA 3R60A 3I4PA 2HWVA 5D5UB 5IT3A 1O7LA 3ZQ7A 2FE3A 3TQNA 3MZYA 3E6CC 4G6QA 3TKYA 4B8XA 3RDIA 3V7CA 5LHHA 3KZYA 4ZYEA 1H9TA 4ENMA 1PP8F 1PDNC 4L9NA 1SFEA 2J5PA 2M30A 2TDXA 1U5TA 2P4WA 5H20A 4WX9A 2PG4A 2FU4A 1ZAOA 4G7HF 1B6AA 1IXSB 1OPCA 2XROA 3I58A 4MEXF 1S8NA 1D8JA 3ZMTA 2IW5A 4G7ZF 3FMQA 4EJUA 1ODDA 4EJVA 2JRTA 4P96A 5JVTA 3W6JB 2IJLA 4RGSA 3VODA 4IRHA 4CDGA 4YIIA 1ON1A 2IA0A 2V9VA 4WWCA 1FC3A 3KP4A 2PLYA 3JTGA 1W7PA 2EFWA 1XGSA 3I0TA 4ON0A 3FF5A 1ZLKA 1XSDA 4M73A 4L9TA 5E17F 1D3YA 2CFXA 1WI9A 1XGOA 2V1DA 5JI6A 1G4DA 2ZFWA 4XSXF 1SD5A 1KU2A 2OZUA 2EFQA 1TNSA 1WRJA 1IN5A 2H27A 1ZH5A 1TQIA 3MWMA 5BMZA 2R3SA 3LQQA 1O3QA 4EJTA 1UCRA 2EWNA 2UZKA 2M8EA 3TGNA 1OYIA 1LQ1A 1JHFA 1JE8A 1KGSA 4HV6A 2FMLA 4HQEA 1HKQA 3WTUC 4LLLA 5DEQA 4M6XA 1LDDA 1ZLJA 3MEXA 1OKRA 3HYIA 5BOXA 1Z91A 3F8CA 3FMSA 2PMHA 1IN8A 2H6CA 4ETSA 1STZA 4HQMA 3AAFA 4EM1A 2ZMEB 3G73A 4M74A 2P7VB 4NQWA 4LLNA 5D5XB 4MQVA 1YQAA 5HLIA 4MNUA 3LFKA 2BBYA 1P6RA 1FP1D 3ECOA 2VE8A 1F5TA 2K27A 4L0YB 3I71A 4N9IA 2BEOA 1D8KA 2MC3A 2DFIA 4F7ZA 2ZJ2A 2CO5A 1MGTA 1HKSA 1EH8A 2A61A 3L00A 2YSRA 3BP8A 5CVUA 4UV9A 3LA7A 1U2WA 1X3UA 1ZHFA 1FBUA 2ISYA 3GFLA 5E8IA 1J9IA 2F5CA 2QWWA 5D6EA 1B9NA 2M45A 4KN7X 5DDGA 4KYWA 2GZWA 3BDDA 3F3XA 4LG0A 4M9XA 2BGCA 4ZYDA 2OQRA 3FMRA 3OV8A 1R1UA 3RKWA 2CW0F 5LGNA 4R79A 2P7CB 1G3WA 1CF7A 1JGSA 2UXXA 2X4HA 2P8TA 2VBYA 1SD7A 1YYVA 4P9UA 2GXBA 1IN6A 3R4KA 3T0YA 2VT3A 3R61A 4I01A 3R6SA 3F72A 5HDNA 2F2EA 5A2QK 4PGGA 4G7OF 1E2XA 3TDUC 5ICGA 4UV8A 2XHKA 4JK1X 1TQMA 4EMSA 5E1WA 4KT5C 4IPAA 1FP2A 5ERIA 1KU7A 3CJNA 2RVCA 2VBWA 1I1GA 4G6DA 4Q4ZF 1XGNA 2XAHA 3HOSA 3M1EA 5TRDA 2GAUA 4D0PA 2L02A 3I54A 3GUDA 1I27A 3KETA 4KUMA 2DK5A 5L3GA 4G8XA 2RQPA 3GFJA 1YW9A 2DQRA 3DP7A 2VC1A 3E6DA 2DW4A 5D4SA 4M71A 3KEOA 1R5HA 2DBBA 3HOTA 3BPXA 1AOYA 2HKXA 2K02A 3JSPA 1KYWA 1B9MA 5HLGA 1FSHA 5LGUA 2K7LA 1MKMA 3E6MA 3ULQB 1XSXA 1OR7A 2DTRA 3VFZA 4S05A 4AWXB 1BBYA 4BHCA 1K7AA 1YW7A 4S04A 3QAHA 3KE2A 4Q47A 1XCVA 2W85A 2XAJA 4HF1A 4FX4A 2CGPA 2Q8KA 3IRRA 3QU6A 1FY7A 3WTZA 3I53A 3CUQB 4RGRA 4CHUA 2GXGA 5HVQC 4OU0A 4IJAA 3QRFF 5IT9Z 4KIFA 4A2UA 2VONA 2G9WA 3WTSC 4ESJA 2RDPA 2VC0A 3HHGA 2H6BA 3WTXC 5D4RA 1KYZA 4M72A 2IPQX 2KJCA 3M8FA 5FFXA 1XD7A 2QENA 4UHTA 5FD5A 5HDKA 1IF1A 4UXNA 2NS0A 1XCBA 2EV6A 4GYIA 3FM5A 3U9GA 5D5WB 1YS7A 2XIGA 4OMZA 2STWA 3F8NA 5HS8A 5CVVA 4I02A 1U5TB 1FYMA 2F5DA 5H6RA 1ULYA 3M7GA 2PMUA 1FLIA 1I1SA 4XRFA 4RB3C 1U78A 2K4BA 3J81K 2KIFA 1HKTA 3HIFA 1ZYRF 4IXAA 3SFZA 2MD5A 2HS5A 2DPUA 2VN2A 1BI0A 3IHUA 2PN6A 1U8RA 1HSJA 1TW3A 3W6KB 5KK1A 1FT9A 1ZREA 5LRRA 4Y17A 2EK5A 3E5XA 3NQOA 1E17A 2ESHA 1W7PB 2NYXA 4GGGA 1NHAA 4A6EA 4CXFA 5E20A 4ZH4F 5DCMA 3ZMVA 1W4MA 1BN5A 4HOBA 4KMUX 1MZBA 1LVAA 3HTSB 4B09A 4U7BA 2D2WA 5ILVA 4BAYA 2HTSA 3L9FA 5LHGA 1BJAA 1I5ZA 2IA2A 3ZMZA 1ON2A 4A5MA 1W5TA 4DNCA 2W57A 4R8HA 2JZYA 4PZJA 4AIKA 4HLYA 1QBJA 3K1NA 4XSZF 3BJ6A 3RKYA 1IXRC 3EYYA 2XKPA 1QNTA 1LDKB 3U1DA 4KIGA 2VOPA 5EEHA 2YR2A 2E1CA 1Z6TA 2V1XA 1QZZA 4BXUA 1ZN2A 4Y15A 3DQVC 2ZO4A 1FYKA 4ENKA 3DFGA 3MCZA 2FEZA 4JQFA 2ESNA 4O3MA 3WTTC 4Q5SF 1W5SA 1FZPB 5JHUA 1YG2A 5CLSA 3IWFA 3M8EA 4IRGA 3WE2A 1B59A 3P9CA 1RUNA 1SMYF 4RAYA 3WTVC 1R22A 1RUOA 4O5VA 1DPRA 2PFBA 1WKMA 4XBFA 3FM3A 1J5YA 1O3SA 4HX7A 5D6FA 3DPLC 3RPQA 5FGMA 4LFUA 1BC7C 1Q1HA 3GW2A 1I6XA 2DQLA 1KU9A 3K9TA 2FBIA 4MEYF 4LG0B 5D8KB 1YLFA 3Q9SA 3BROA 3QPTA 2F5EA 1JXSA 2FBHA 3GWZA 2V79A 1T0FA 4OIPF 1CF7B 2CSOA 3N4MA 1HW5A 3V8JA 2R7FA 3RKXA 3WTWC 3F8BA 3E97A 3B73A 4KN4X 4HF0A 5LGTA 4LJZF 4WXCA 3Q5FA 5KVRA 3LAPA 2XAFA 3V7RA 3R0AA 1GVJA 4KNYA 1Z9CA 4TV7A 3C18A 3VEPA 4JBAA 2A6EF 2M87A 2BV6A 3JTHA 3IRQA 1G3YA 4UVBA 3E5UA 3RPUA 4L5IA 3GO5A 4LLGF 3GFMA 4FHTA 1L0OC 3KP5A 1UB9A 4R1HA 1RI7A 2MLKA 2LF8A 1Z6RA 3C7JA 2A07F 2W25A 1FBSA 3LA3A 3SQNA 3QPHA 2QQBA 4G9YA 3R0JA 1QO0D 2Y48A 5A2QZ 3L2CA 3WU1B 3WGIA 2D45A 3KEQA 3ABUA 4RB2C 2IA1A 3BJAA 2O8XA 1B4AA 2AS5F 1TQPA 1WQ2A 1XDSA 2XAQA 3ZMDA 1MD0A 4H0EA 2CWEA 3FXRA 4PDKA 3S2WA 1TLHB 1P4AA 3QU3A 2FF4A 1XSVA 4RGUA 1YS6A 3C1DA 1W7PD 2F5FA 1CGPA 1FX7A 3TO7A 4Q48A 3CTAA 1P4WA 1GXQA 2IP2A 4CO8A 3IWZA 4OOIA
chains in the Genus database with same CATH superfamily
1FSEA 4I7HA 4A69C 3KP3A 5A6AA 2LRSA 2GOMA 1WJCA 4I2OA 4WCGA 3ZRGA 1OCRH 3JRIA 3GX4X 5AIQA 1X58A 1R1TA 4M3DA 4NB5A 4B3ME 2CT1A 1D5VA 4L5JA 5KL6A 4XRSG 2FXAA 1EH6A 2VQCA 3OOUA 4KDPA 2E2HJ 1UN6B 4M6YA 3TOAA 3SZPA 2IS1A 4E6KG 3CZ6A 1JUPA 2PBIA 4MFDA 1Y1WJ 5FRMA 2HYGD 3FXLA 5AE3A 3AV0A 2EV5A 1L3LA 2M1BA 2O0YA 3SDBA 3H09A 1P92A 1MNDA 3AKZA 2CUFA 3CESA 2V6CA 1K4TA 2ZNYA 3GTPJ 3TO6A 1IO2A 3A1YA 2Z99A 4I0AA 4PFOA 2X51A 5ED4A 2PEXA 3DPUA 2MH9A 2QVOA 4LB6B 1USSA 3BZCA 2P6SA 3B02A 5L3CA 4U0YA 5AE1A 5KL4A 4DOZA 2P5LC 3F6HA 2EM3A 1QHHD 2FX0A 2M5WA 1TWAJ 3BWGA 1ZKGA 3MKLA 2NRAC 2JVGA 3DEUA 4DYRA 3BG5A 1KONA 2R7VA 1BB8A 5JHFA 2LBFA 5BS6A 2M7BA 5HLHA 2EQ0A 1BR1A 5DM6F 4OIOF 2AHQA 1T8IA 1N33E 2ZJQF 1AKHA 4PJNA 4ASNA 4YIFA 1R23A 3TEDA 2EB7A 5EG0B 2IS4A 3IKVA 3RYPA 1E3PA 2EH3A 1YW8A 3HC7A 2VIXA 3AG1H 2BYVE 3E1SA 3HKZA 3HOUJ 5E18F 5AIPA 3O6BB 5K7FA 3CCSI 5C4XJ 4EEFG 2WC2A 3PIOF 2UUBE 4YEJA 1MW7A 1XMKA 2CQXA 4F3QA 2F4MB 3HRMA 2YTDA 4O43A 1ETKA 4P9FA 1J59A 4KMFA 3DBLB 2DFEA 3S93A 1EH7A 1LJ9A 2GQQA 1S7EA 4DUYE 1FBQA 3EPZA 3GTLJ 2HOEA 2X48A 1XB4A 3MD2A 1FOKA 1P7JA 5J8FA 1ONVA 2L3DA 2M34A 2RAEA 4PCQA 2EMWA 1J5EE 2PX9A 2M4KA 5F1JA 3DV8A 5LEJA 1OMIA 2B63J 1BI3A 1IBME 6PAXA 1ZTRA 3LL7A 5KL5A 2A3SA 3FWEA 2D1VA 4AIDA 4XLNF 2X6OA 1PDAA 2YTIA 3S17J 2D1HA 2R7RA 2ZSIB 2J7JA 2A69F 3CLOA 1T98A 2QM3A 3M9AA 1YYKA 1TC3C 2HKOA 2FQ3A 3EUHC 1ETYA 3FXUA 3IC7A 1K78B 1AH5A 2YTGA 1F9NA 4R2DA 2NUFA 3V4GA 2KFDA 2YX7A 4OIRF 3OYKA 1RKWA 4I76A 4UUSB 3H0DA 5FD6A 3VB2A 2KIMA 3ROUA 1LEBA 4RGXA 2V1UA 3MFKA 2Z5UA 4NHJA 1A6QA 2WY8Q 1Z1DA 1OCTC 2DO7A 1DU0A 5LHIA 1DQUA 3WG7H 2HYFA 1ZARA 4X0GA 2EM6A 3WU0A 2BW3B 2BY1A 3S3NA 1VFCA 3KZZA 2DGCA 3CJRB 2M3AA 3DKXA 2DFFA 3D0SA 1DGWY 2WA0A 3EYIA 1S29A 1P7IA 4Z2YA 3RCOA 2FGGA 3K69A 4CZZA 1GZ6A 1A1HA 3V42A 1A1JA 5CPRB 2UU9E 2DLLA 2E1NA 2FQ4A 3H9QA 4UUVA 3KP6A 2B9SA 4OAZA 2FNPA 5L3BA 4BNCA 1U3EM 2CJJA 3CCUI 2EN8A 3J80Z 3JAMC 4RB1A 3CDHA 2L92A 5M3MJ 5CVIA 3JU0A 1YIOA 3ONQA 5A6KA 3OYBA 2LTSA 4WK8F 2RN7A 3N97A 1LDJA 3U2RA 1HBXG 1ZGAA 3G3ZA 5F0FA 4LF4E 1X1DA 3F6GA 1AHDP 3BQZA 3C3WA 3F8FA 3K0LA 1B69A 3OYGA 2LUQA 2FNAA 2YTFA 2EZKA 2IT0A 2DA2A 2VKDA 3BR2A 5EEAA 5A69A 3S14J 2E72A 1HDPA 1KQ0A 5CYVA 3CCJI 1GQEA 2LR8A 2XVCA 2EMFA 4LK1F 5J1UA 1A1GA 1T95A 1S6LA 3GEZA 2Y75A 5DCMB 3J81Z 3GVAA 3JRHA 1DI2A 2XGEA 3IH4A 2DLQA 4X64E 4HEIA 1MJAA 2EMHA 3OSFA 2H94A 2KIUA 2R7ZJ 1PUEE 4U88A 2MLGA 3COAC 1V5GA 5AC5A 2MBFA 2ELKA 2BE5F 4MLQA 2MABA 1WGXA 1FNNA 4BHPA 1BI1A 1R58A 4EM0B 2EFOA 1FMVA 2RQLA 4IQ4A 1RESA 3JSOA 3ZR8X 2FBKA 2JJ7A 2KKOA 2MYSA 2JPBA 2G7UA 2L7FP 3K1MA 3H92A 4RAGA 4X6AJ 2LP0A 4PUSA 3BZ6A 4D7NA 1LEAA 3VDXA 1RNLA 3L09A 1SFOJ 4D7MA 3JRAA 3CC7I 4P5OA 3CUQC 4HA8A 2VI6A 1O7FA 2DK8A 3TBIA 3GZNB 2NS7A 3V8KA 2C6YA 3WG9A 1ZBTA 4IO9F 5IY5H 2EPLX 3E5QA 4U7DA 2DU9A 2CTDA 2K9MA 3EETA 4YFNF 5B3SH 5FLXK 2CG4A 4LGWA 4KJZA 3IL2A 2DDBA 1X6FA 2EMLA 3OYEA 2OV7A 1A31A 2XASA 2ZFUA 4XN0A 1GDTA 2CSHA 4W1UA 2ODRC 2DT5A 3F6VA 3LQRA 1T4LB 1JKOC 4A3GJ 2H09A 2V7FA 4MTDA 4EGYA 5ICEA 3Q0UA 2CQKA 3ZQQA 4DR3E 2EA2A 3Q9VA 4XL9A 2RC4A 3OYLA 4CYCB 3W3CA 3RIRA 1RIOH 4ZZDA 3KLNA 1HCRA 1R00A 3ZMUA 2M2EA 3Q0VA 4B3XA 1T38A 5GAHJ 5GTIC 1VQ7I 2NVTJ 1D1BA 5KAIC 4GEQB 3A03A 2OQGA 1K79A 2JY9A 2ENCA 3TL4X 2VPLA 2STTA 1PVEA 1IQOA 3HSRA 2DN0A 1RZ4A 2Y0SN 4X8WA 1UZCA 3MHHC 2O5RA 1LFPA 2V9KA 1TWFJ 5F6FA 3ERED 4IRIA 4L9VA 5DD8A 3IWCA 2B7TA 2ZXIA 2JK3A 4HZFA 4NDLA 1D5YA 2HXIA 2GHFA 3DF8A 1XMXA 3BR5A 2L0KA 3G1MA 5K5RA 2EMGA 3LMLA 2JXPA 1QPIA 5E1XA 2AXTC 2Q2EA 1I3AA 4A0ZA 1QVTA 3A02A 1TWGJ 4M9ZA 3KX2A 1X48A 2NXNB 2E1OA 2XAGA 2FOKA 3QQAA 2JPAA 1VF9A 2H8WA 3MN2A 5JR3A 3M3YJ 3JRFA 3SHFA 5DTDA 5B66C 3ZQCA 1GT0C 5BQTA 1ZRDA 1Z77A 1UHZA 1WH5A 1IW7F 4WXDA 4OMYA 2RGVA 3MHSC 2FSWA 5FLXC 4X66E 4BH9A 1G3TA 2VOOA 4EJOA 5KAFC 3LSTA 5IV8B 2WBTA 2FRHA 2OZ6A 1GHCA 3KIOA 3M99B 2HJJA 4A3BJ 1ETXA 2B7VA 2VODA 1HOMA 3J7Yp 5DUKA 3WTYC 3OYDA 1A1IA 1Z0XA 1Z67A 2HFHA 2E7XA 3DU5A 4BY1J 2FMYA 2ZXJA 3F9KA 5FKKA 1B72A 2VE7C 5AC4A 2HXOA 2EPRA 4NNJA 1R9TJ 4XLEA 4CZCA 2EQRA 1HLVA 1YPNA 4BQAA 2JN6A 2MKDA 5AONA 2EINH 5FJ8J 1WJBA 1ZG3A 3LSHA 2KRFA 4EQQA 2MDGA 1SAXA 3Q0WA 5KCMA 1FKAE 1SAUA 5F04A 2JSPA 2V83A 4GKKE 5D8LB 2EZHA 2E60A 3HM5A 4YFKF 1H0MA 1IRGA 1UG2A 4U87A 4AIHA 2A25A 2QKLB 3SYTA 3ZXSA 4BYYA 2XF6A 4PK4A 2JTVA 3CMMA 2O61A 2HDWA 2M9AA 4AC0A 3H3UA 5E1ZB 4V2FA 3T8TA 4GDFA 2Y9ZA 2QYOA 4RM3A 5E3NA 2RS6A 2I9IA 3SXYA 4NBQA 4K0KE 3G1LA 2OD5A 4ENJA 3BTCA 4PSXA 4JI2E 4GZNC 1LE8B 3CUQA 2B3TB 3BR0A 1X49A 2VRDA 3BTLA 4N9HA 1IN7A 3TO9A 1TTYA 3KFWX 1R6RA 5IYBJ 1DP7P 4DJAA 3WE3A 1MDMA 2COMA 2W00A 2P6TA 1ZG1A 1BI2A 3G2BA 4XICA 2UWMA 3MZHA 3ADLA 1JUSA 3WHCA 1ZBQA 3O3KA 2NAZA 3HTUA 4RH8A 2IGNA 2GWRA 3KP7A 4MQ9F 2HI3A 3JAMK 4A5NA 2YUSA 1XDUA 2CYYA 2P5VA 2WTEA 3MKZA 2QSGX 3J7AY 1V54H 1FMWA 1VQLI 2YZTA 2G7HA 1JTXA 3CO6C 3O2PE 3RQIA 2Y30A 4MTEA 2QUFA 1KZHA 1V4RA 3BIDA 2JSCA 1IN4A 1BM9A 4UVCA 4B3SE 3W2AA 2A68F 3HPZA 2NUEA 2K7IA 2MSYA 1BIAA 5HOOA 4BQNA 2NNNA 1R1VA 1S3JA 1XN7A 3H5RA 3F21A 4NQWB 5E8GA 2Z9OA 3HSFA 3I59A 4BGDA 1WSUA 1JKPC 4G12A 1P4XA 5FKOA 1E3HA 2WV1A 4OWRB 3RZOJ 2AO9A 3C2GA 1ZRCA 4P55A 2HR3A 3ADIA 1EV7A 4EV0A 3PFIA 3F23A 3BG7A 1AAYA 4HNTA 1IRXA 3CMYA 4HX4A 4J00A 2WBMA 5JFRA 1R5ID 1PKPA 4AVPA 2OCCH 2EIJH 3HTXA 4BCAA 5FRNA 4BBSJ 3BOQA 2D9HA 2EN2A 1R7JA 2OPTA 4GO1A 2D5VA 3ZGKA 1J2XA 5CJ9A 3TOBA 4BACA 4G94A 1OYYA 2UXNA 2BHYA 3ASNH 2VQHA 3L2VA 5CVRA 2DT7B 2I13A 1ZGWA 4AUXA 4OOGC 3A4CA 4X1EA 3L1PA 5HDGA 2CFOA 1H9GA 4C2TA 2UXDE 2O8KA 3NARA 2EP3A 2V8QB 1WFXA 2XKOA 2XF5A 1SMTA 5K5QA 1OFCX 5BR8E 2VBXA 4DMIA 2QZ8A 1A1KA 2QBYA 1LKXA 1SD4A 2VXZA 2P81A 1TW2A 4PJJA 3REOA 4YG2F 2LD5A 1ZR2A 1WHNA 4O24A 4A6DA 1HSTA 2VQLA 4BBRJ 2CW8A 3WGHA 5J4VA 3H9JA 5J8CA 2L3CA 4BL0B 1PJTA 3HZJA 3QPSA 4B44A 3B6CA 1IRFA 2LNBA 3OIPA 4R2AA 3ERMA 1Y8QB 5FO5A 1O57A 4XM3A 3CC4I 3K1PA 2Q8UA 5ADZA 3FXQA 5HS9A 1MSFC 2DMYA 4AYBA 3BBGA 2KIQA 5F64A 3I4MJ 2FV4B 3HPGA 1J7KA 1X1BA 4A0YA 2EM0A 2EOSA 4TUIA 4FT8A 3CP8A 1MIJA 2M7AA 2HC5A 2ME0A 4CYDA 3H3ZA 2XB5A 2L4MA 4ENNA 2L33A 4O5GA 4HSTA 3KWRA 1APLC 2IRFG 4LTYA 1YI2I 4FETA 1SFUA 4O6JA 5BPDA 1VZ0A 4BKXA 2Y0MA 1ORKA 2JWOA 1RC7A 1YJ9I 5EYRA 2E1MA 1C0WA 4JI3E 1HQCA 2E5ZA 2FA5A 3JRCA 1OYWA 4DR4E 2YTJA 2EZ6A 2LY2A 2LRDA 3CCVI 2EL4A 4B3AA 2LBFB 5LEKA 1A5JA 4RBOA 1MMDA 4L5NC 3HOWJ 1WZ2A 2QSHX 4A3DJ 4A93J 4UVAA 2VJ4A 4BHBA 1UFMA 3RTRA 1AKHB 2M0MA 1JTYA 2GPIA 5DYMA 2W48A 2NVUB 3SEQA 1KJKA 3OL4A 4HYEA 3THOB 1G3SA 2LV2A 1Z7LA 2VT2A 2W4SA 4BQQA 4FASD 5IPAA 2OJED 5CVJA 2KJBA 2QEXI 4QPOA 4BJ5C 3I64A 2A5YB 2P5KA 2CUZA 5EF6A 4GFBA 2EMCA 2KHXA 4E4HA 1R4NB 2W24A 4HX8A 5M5XJ 1PP7U 3VWBA 3PO2J 5EEGA 3BC8A 2HQNA 3LAJA 5H6QA 3QODA 2E71A 2HDCA 3WGGA 1JHHA 4XK4A 5FLMJ 1TL8A 3D5LA 5F27A 3ZPLA 4HNVA 1SVLA 1V3FA 4HNUA 2VB6A 4KA4A 2EMIA 1X19A 4I0BA 3K70D 4M0VA 4I99C 4HF2A 1X3CA 1G6NA 5KL7A 2WB1N 1XPXA 2JPCA 3OOPA 3HOZJ 3UK3C 3PNTA 1YSAC 1SD6A 3HPSA 2ZB9A 3GLXA 4EJWA 3KCCA 3QPLA 5K5OA 1TF6A 2HVSA 2ZMEC 5E79C 4K2EA 1IMUA 2RNJA 4E7SA 4II3A 3DJWA 1YX3A 1LFUP 2WV0A 4HAMA 1UHSA 3F6OA 4DV3E 1USTA 4NC8A 3FXJA 3WHBA 3MZ8A 4IVNA 3G4SI 1QPMA 5L3EA 4AIJA 4XRMA 1F2IG 1OCZH 2DSYA 1BBOA 4ANJA 2IXSA 2H1LA 2L7ZA 4J8ZA 2B0LA 1BIBA 5J40A 3HB9A 4DQ2A 1WWXA 3K2ZA 1R71A 2CV2A 2YPRA 2CPNA 3P5JA 3THNA 4R2PA 2OF7A 4DV1E 2K9SA 2XAUA 4ZZLA 1J0RA 2LDUA 2V4JC 1DDNA 5KNLA 3LMMA 5LBQA 3S1QJ 4E7LA 1YRNA 2GA2A 2WWYA 4MO7A 3PFYA 1IZ1A 2IBDA 3EQ1A 3FXKA 2YX4A 4AU7A 2HEOA 2LSOA 2Y69H 3BPVA 3GZ6A 5TISC 1BOBA 1UJ8A 2JT1A 2EIKH 5ICCA 2DLKA 2EOEA 2MFZA 2K9QA 2Z33A 1YHQI 3MQ0A 1T6SA 2OBPA 1G8XA 4JX5A 4R8OA 3OYNA 2YTEA 1MH3A 2EPUA 4I09A 2EPOA 1R4MB 3M07A 3RJPA 2MDRA 4CICA 4G6TB 4PGHA 4XOPA 2RPCA 3ECHA 3QWLA 4B47A 2DA6A 1XTAA 1MBGA 2IGMA 1FEXA 4MIMA 5HLTA 3GF2A 4CGZA 4Y7NJ 1S7AA 3HKZN 2HQRA 1UHWA 3UKGA 3EUKL 5F1RA 3EPHA 4L0ZB 4R2QA 3MAJA 2HOTA 2EPCA 1XNQE 3OMLA 4M9SA 3GTMJ 2DJNA 4JI8E 1GXPA 3QOPA 2IVMA 5K1YA 2ETHA 5BPIA 2VKHA 2E2IJ 2N3HA 1RC9A 4MHGA 3RPUD 2NOJB 3FHZA 4XLHA 2EOJA 5FFZA 4C30A 1JT0A 1N75A 1QQIA 2V87A 2RQQA 4FX0A 4RB0A 4CCJA 2DB2A 4IF4A 4AD9A 4AVZA 4ESFA 2YTNA 4CCLA 1DUXC 1T4OA 1UHMA 4N4RB 3TMOA 5DD4A 4Y13A 2KQRA 1YZ9A 4YFXF 1N3GA 3ZQIA 1TNTA 3I55I 4HW0A 1QGPA 3RKQA 1BC8C 2DI3A 3UNGC 3DKWA 1BR2A 1P9QC 2ELHA 1VQ4I 3S3MA 3HOVJ 4E7HA 1RRJA 2EFNA 4LD5A 4LMYA 1O3TA 2UXBE 3M1CA 3HRSA 5GAGJ 2RNGA 2XDVA 1X1CA 3EQLF 2YTQA 2DAOA 5DCFA 4DBQA 4LB5A 1R49A 1M1EB 3ZOQB 3ZN1A 1VQ8I 1T33A 4DV7E 2L01A 1FOYA 3E3VA 2X9DA 2ADUA 2DMUA 2VQGA 4JOMA 4L18B 4GCVA 4BU2A 1SEUA 1BA5A 3VSLA 3IUOA 4XLCA 4HV5A 4GXOA 5HNHA 2R7DA 4HTGA 1QA6A 2Q1ZB 2LREA 1K6YA 2GIVA 3LSIA 1YO5C 1IC8A 3NRVA 2OU2A 2W84A 2EV0A 3FHNA 3BZKA 2KZGA 3GXOA 3IAS2 4OAYA 3S3OA 2EOFA 2ZXWH 1HW1A 2VBZA 2ZMEA 5EZHA 2BY3A 2K9LA 1ETOA 4I98B 2KDOA 1RPWA 1RR7A 2GA1A 3S2DJ 3VYTB 3BTIA 3ZMSA 3ABTA 2DMIA 5DV5A 2N8GA 1FYLA 1IDYA 3ASOH 3UR3C 1B1BA 5A6BD 3X2QH 1DPUA 3SFIA 1JUMA 4ZYHA 1HW2A 1R36A 2EMAA 3VSKA 2A6HF 3DXJF 5FLXZ 3BCAA 2Q2EB 3LA2A 2NA2A 1EKZA 4U0WA 4LF5E 2OA4A 4TUGA 4RMNA 2DPDA 4XNFA 5LLQA 4LK0F 4UNOA 3CO7C 2VLAA 1B8IB 4V2GA 1KU3A 2R4GA 5J6XA 2ZNZA 2PI0A 1YTYA 3ML6A 5ICFA 3F8MA 1JJ6C 2LKPA 4IHVA 1NTCA 5DUIA 1K6OA 4OINF 4QLCU 3OYJA 1QZEA 1IAWA 3DBRB 3LNQA 3PQJA 3CLQA 1BOAA 4DBRA 4P7DA 4B4CA 4X9JA 3CUOA 4A12A 2GLOA 5TJJA 2DMPA 3ABKH 3T5XA 2EPZA 3FIWA 3HOYJ 5J4YA 2PJRA 2O9LA 4N0BA 3ISPA 1FTTA 5EDNA 3LSGA 4DR6E 1J75A 2VQEE 1FPQA 3K6GA 5F08A 2O3FA 3JCUC 2ZKZA 4U0VA 2IS2A 1IUYA 2EPXA 4LF8E 2OAZA 5DS9A 3ADGA 2R5YB 3BY6A 2HU9A 4EM2A 2B7EA 3V7SA 2ME6A 2LG4A 1KQ9A 2CW7A 3L7WA 2EL6A 2HZTA 4IHXA 5DNYA 1W1WE 1GVDA 4HDUA 5TGTA 4DGWB 1I6HJ 1LLMC 4OIQF 2F4VE 2O6GE 5HS7A 1IBLE 2ZCWA 3BG6A 2EA4A 2HQ5A 3OMYA 4QWQA 4HBLA 4RM2A 4RS8A 1XMAA 2KPMA 3F22A 2Q0OA 1GV5A 1SFXA 4QTRA 4KFCA 2JA5J 4IKFA 5LL6R 4M9VC 1HXDA 3DLAA 3SZGA 3KLOA 3ZN0A 2O03A 3JR9A 1YYWA 3PNVA 2L8TA 1N77A 2X1EA 3HRTA 2QKMB 2RSIA 2QQAA 1ZAAC 4IHTA 5M5YJ 1IV8A 2K4JA 4HDVA 4Y52J 2AQEA 3TP0A 3ZQGA 2XGXA 3C4TA 2EE8A 5L3FA 1Z05A 2R7QA 3QOEA 3GZ5A 2R76A 4WXHA 2A05A 2K86A 4A3FJ 3FX3A 3P9IA 1ETWA 1JI8A 5ILSA 2PMZA 3V8LA 4MLVA 2GM4A 1Y0UA 4YY3E 2W1OA 4BE0A 2ISZA 2LO3A 1ZGJA 2RTXA 3PQKA 1MDMB 1T2KA 3QP6A 5EGOA 4A0XA 3GYHX 1LB2A 1MBEA 1JT6A 3GFIA 3VYSB 5AASA 3EPLA 3DTIA 1AWCA 2F4IA 2JYAA 2EMZA 1U6GA 3HUGA 4A3KJ 5IWAE 3RYRA 1REPC 1ZELA 2QQ9A 4GYGA 1G2FC 1KA8A 2J5OA 4BXXJ 4F9AB 4P78A 1H8AC 1Z7UA 1R5GA 3NEUA 3J7AG 1TWHJ 3BLYA 1X2MA 1VQ6I 4NZVA 2E7WA 2RKHA 3DWLE 2UXCE 1QZYA 1D0ZA 3I5UA 2CQNA 2LF7A 4RAZA 3U21A 1MEYC 1FJGE 4BE2A 3LFUA 2L4AA 3T1BA 1TT5B 3EUHA 4IOCF 1LNWA 3HSEA 4JI0E 3FXOA 5FB2A 2L5QA 2EJRA 2XGCA 3OS0A 3I4NJ 3LLHA 1Y56A 4ESBA 3BJOA 2YU3A 3I59B 3J80K 1D0YA 2DA3A 2K9NA 4EVIA 2EM4A 1JJ8C 4UB8C 3J7AO 3EDPA 3K4BA 2EFPA 3E6BA 4IHSA 3FZVA 2HPIA 2XC7A 1U5TC 1K78A 4E70A 2EN1A 2MH2A 2LBSB 2X0LA 3VOEA 4QIWN 3HJEA 4JI4E 4BS9A 2XRNA 4HG2A 3PSFA 1MH4A 3HRUA 3PM1A 4MGRA 3G1OA 1IXCA 2WAFA 2MG4A 3BR3A 3P7NA 2KT0A 3ZP5A 1S7OA 2EMKA 4ZYGA 2EOMA 3DPTA 4XLPF 2R5ZB 2CV1A 1MJBA 3JAMZ 1RQ0A 4BJ6C 2DOEA 2KRCA 1F1ZA 3HHHA 2VE9A 4KICA 3L2QA 1OCCH 2PQ8A 3OL3A 4I6ZA 2YTOA 1MJ9A 2X6WA 3GBGA 2DA4A 2QBYB 3RZDJ 4L9JA 1KQ8A 5FKNA 3ECRA 1BL0A 2Z3YA 5GADJ 4ZJZA 3P9KA 3GTKJ 4DV6E 2GOXB 1F43A 2DMNA 4J01A 1XS9A 2JP9A 1DP3A 2EILH 3D1NI 5CQGA 2ZBKA 2FOWA 2ACJA 5FLVA 5IT9K 4FE4A 1TN9A 1WH7A 3TDZC 5IYCJ 3VHTB 1A1LA 3GCMA 2XUBA 4D5CA 5E3OA 3C2HA 1S5LC 3QP5A 3KYLA 4WSPA 1YUIA 1NK3P 2K3PA 4XIDA 3MKWB 3IKTA 1WXRA 4B3RE 1VTNC 2HGHA 3HEFA 3TW7A 5D5VB 3VYYA 1ZRFA 5ILUA 2ECCA 4MLOA 3T8RA 4B3TE 1NG6A 3ELKA 3TP3A 3RI4A 3CDLA 2PJPA 1WPKA 4UB6C 2E35A 4X65E 4BEHA 1IJWC 3JW4A 1O3RA 1A04A 5L3DA 2H1KA 4WF2A 3LWFA 2R7TA 1T0FC 1YFHA 1ZG5A 3WODF 2HTJA 4BC7A 1ETQA 1XGMA 2E1MB 1UELB 2TRTA 4NXNE 2RS7A 2IHR1 1TBXA 3OYIA 5LMUE 2XV4S 1QRYA 1PUFA 2HGCA 4S0HB 2K85A 3QG5C 1HF0A 3KP2A 4EGZA 1HC8A 1VI0A 3SZTA 3S32A 1X1PA 2NNYA 2MA3A 2LTPA 5E3MA 1W5CC 3OWTA 4CCMA 1SR9A 2EN3A 1U8BA 5CKTA 2EWLA 1N34E 1T39A 4LF6E 4BY7J 3H5AA 2BXYA 2RV8A 4F52A 2ELYA 2L9VA 2HDDA 2XB0X 2BVMA 1Z21A 2L54A 1RMDA 4KIBA 1H88C 3ESWB 1F4KA 5LRSA 5DM7F 2HZDA 1P2FA 2QLZA 1FWZA 4HLXA 1OCPA 3AG3H 2AXLA 2NVYJ 3LOCA 3R60A 3I4PA 5J1YA 3IV5A 2HWVA 5D5UB 1V55H 4F92B 5IT3A 1O7LA 3ADJA 3GTOJ 2COBA 3ZQ7A 5J1RA 2FE3A 4W97A 2LTRA 3DEWA 2YWQA 4Z6YA 3TQNA 5IT9C 3MZYA 1L4SA 4PJMA 3E6CC 4G6QA 5A6JA 1YJWI 1U9NA 2NUGA 3FBNB 2L9NA 3K4LA 4LITA 3TKYA 2BXZA 2ZXHA 4B8XA 4FK5C 3RDIA 3V7CA 1AA7A 5LHHA 3KZYA 3OYAA 3KYCB 3MMYB 4HRIA 4ZYEA 5GAEJ 1H9TA 3DU6A 3FDYA 1JKRC 2XPVA 2JVAA 1YUJA 2KOUA 2X6XA 2WBSA 4A3MJ 2ID6A 3FKJA 4ENMA 1PP8F 2EQ3A 5K7HA 1FOWA 2EPNA 1PDNC 1TZLA 4L9NA 3K6QA 4IS1C 2EOQA 3PJRA 1T08B 1T4NA 1SFEA 3BF2A 1RETA 2J5PA 2M30A 1X1AA 2TDXA 3CP2A 3OY9A 2DRPA 1U5TA 1WJ5A 4JYKA 2P4WA 3M8JA 3KZIC 5H20A 4WX9A 4LF9E 4A3EJ 2PG4A 4Q28A 5J3LA 1GV2A 2FU4A 1ZAOA 4G7HF 1B6AA 1IXSB 2JA6J 1OPCA 2XROA 1EF4A 3I58A 4MEXF 2AQFA 1IV6A 1S8NA 2P0WA 4IJDA 4R03A 1D8JA 1F36A 4XKBA 4D1QA 3CCRI 2MC5A 3ZMTA 1MNEA 2IW5A 1FOXA 4G7ZF 2ID3A 3FMQA 1VQNI 1W36D 4NUBA 4AYBN 3W2WA 4EJUA 2QF7A 1PYVA 2E2JJ 1ODDA 4EJVA 3C2BA 4V19K 5JVGF 2JRTA 2CU7A 3VPRA 1K83J 2HOAA 4P96A 3W6JB 3FKIJ 5JVTA 2JRMA 1NG7A 1VQPI 2IJLA 4RGSA 3VODA 4IL6C 2BVLA 1GLNA 2CUJA 5IP9J 4IRHA 4CDGA 2V88A 1CQTA 2YSPA 4YIIA 4KHPE 1ON1A 2V6EA 4JI6E 2V89A 2IA0A 1UILA 2V9VA 4WWCA 1FC3A 3KP4A 5F3WA 2PLYA 2LE2A 4ZC3A 2F48A 1X5WA 2L3JA 3JTGA 3IWBA 4QPQA 1W7PA 2KHMA 4H4KC 1PJSA 4J19A 3PIPF 2DFHA 2NOGA 2EFWA 2UUCE 1XGSA 1ZR4A 4A3CJ 4RDUA 3I0TA 4ON0A 3HL2A 1WJAA 3FF5A 4ZTJA 1ZLKA 1PJRA 4DV4E 1OQYA 1XSDA 4M73A 3A01A 1DU6A 4L9TA 5E17F 1D3YA 4Y4RA 1I94E 2VUMJ 3VK6A 2CFXA 1WI9A 2CV0A 1XGOA 4JYAE 2V1DA 3DEEA 1VQKI 2ODRD 4RA2A 5JI6A 1G4DA 2ZFWA 4LG3A 4XSXF 1SD5A 3AL0B 1KU2A 2OZUA 2EFQA 4R2RA 1TNSA 1WRJA 2MKNA 1OLTA 1IN5A 2H27A 1ZH5A 1TQIA 1TF3A 1Y0NA 2IGOA 3MWMA 1A6IA 2IGKA 5BMZA 1JGGA 4IZZA 2R3SA 3LQQA 1O3QA 1ITYA 1N32E 4E7IA 4C9YA 2JR1A 4EJTA 1UCRA 2EWNA 2UUZA 1W0TA 2UZKA 3H3VK 2M8EA 4CA0A 1XMOE 3RMPA 3TGNA 1QHGA 1OYIA 1LQ1A 1JHFA 1JE8A 5T6JA 1ZK8A 4LF7E 1KGSA 4XRSA 5KL2A 4HV6A 2FMLA 1D0XA 3OIOA 4HQEA 1HKQA 3WTUC 4LLLA 5DEQA 4M6XA 1LDDA 1ZLJA 3MEXA 1OKRA 3HYIA 5IP7J 3O8GA 4DYQA 2IAIA 5BOXA 3ZQFA 2EL5A 2EOXA 1Z91A 3F8CA 3FMSA 2PMHA 2RREA 1IN8A 2H6CA 1RR8C 1OISA 4ETSA 1STZA 1LPQA 4F6NA 4HQMA 4D9JA 2ADRA 3AAFA 2EZIA 2DOFA 4EM1A 1N25A 2ZMEB 3DCFA 4YELA 3G73A 3BG3A 5LMNE 4M74A 1STUA 2P7VB 1BW6A 2WAQN 3E7LA 3BTJA 3K10A 2PRTA 2L6MA 2VPRA 4DKKA 1POGA 3E0JB 3H1CA 4XN3A 2XSDC 3FXMA 4PJLA 4NQWA 4UUTA 4LLNA 1S9HA 5D5XB 4MQVA 4YHHE 1YQAA 5HLIA 4MNUA 4YIRX 3LFKA 2BBYA 1WJEA 1P6RA 1FP1D 3ECOA 1E3OC 2V86A 2VE8A 3GTQJ 3B6AA 5C4JJ 1F5TA 2K27A 4L0YB 1G2HA 3I71A 4N9IA 3S8PA 2BEOA 3S1MJ 1D8KA 2MC3A 4DR5E 2DFIA 2HVQA 4F7ZA 2ZJ2A 2CO5A 1MGTA 1HKSA 5FROA 2F8BA 1EH8A 2A61A 3L00A 3LSKA 4F55A 2DDAA 2YSRA 3BP8A 5CVUA 5C3EJ 2WCC3 4UV9A 3LA7A 3OYFA 3ZQLA 2R0QC 1YX5A 1U2WA 2EMBA 1X4PA 1X3UA 1ZHFA 4DR2E 3CMAI 1FBUA 2ISYA 3GFLA 4JX6A 2PJRB 5E8IA 2DMTA 2KISA 4C2MJ 1J9IA 2ECBA 3A2KA 2F5CA 4DUZE 4MFEA 2QWWA 4KZSA 5D6EA 1B9NA 3H5NA 2BY2A 2M45A 5A6BA 4KN7X 5DDGA 4KYWA 2GZWA 3JRGA 2YSOA 2DOAA 2DYRH 2YU8A 2EM9A 4BE1A 3BDDA 3F3XA 4LG0A 4DW6A 1XC5A 1OR7C 4M9XA 2BGCA 2XPWA 4ZYDA 5E3LA 4XKVA 2M4GA 2OQRA 4ITVA 3FMRA 2Z2SB 3OV8A 3OS2A 1R1UA 3RKWA 9ANTA 3K7AJ 3N05A 2EM5A 2MD0A 1I3QJ 2CW0F 5LGNA 4R79A 2HVRA 2P7CB 1G3WA 1CF7A 2BY0A 1JGSA 4M3GA 4F6MA 1H89C 2UXXA 2X4HA 4F9CB 3L2RA 2P8TA 2VBYA 4L5EA 1SD7A 1WCMJ 2ZSHB 1ZQ3P 1YYVA 2X6YA 2NVXJ 1WJPA 4P9UA 2EQ1A 3T1HE 1ZU1A 2R92J 2QQ8A 2GXBA 1HA8A 2LVSA 3FK6A 1IN6A 2UV1A 3R4KA 3T0YA 2VT3A 4R2CA 2B9DA 3R61A 4I01A 3R6SA 3F72A 5HDNA 2F2EA 5A2QK 4M2ZA 4PGGA 4C2UA 4G7OF 1E2XA 3TDUC 5ICGA 3EPJA 3BT9A 4UV8A 2DTZA 2LLKA 2XHKA 4JK1X 1TQMA 3A0BC 2OTJI 4EMSA 1WHUA 4KT5C 5E1WA 4IPAA 3A0HC 3J7YJ 1WHQA 1MBHA 4KT6A 5EGOB 2ELJA 1FP2A 1G2DC 2XSJC 5ERIA 1KU7A 2K5CA 3QYBA 3CJNA 2DCEA 4BXFA 2IEKA 2VASA 3HUGB 4ZDPA 1YJNI 3TQMA 2RVCA 4Y33A 1X2NA 2VBWA 4IEJA 1I1GA 2VJJA 3DTKA 4G6DA 3J7ZI 4Q4ZF 1JK2A 2JA8J 4LIUA 2NS8A 1XGNA 3H36A 4LFCE 1NH3A 5CFFE 2XAHA 2YTPA 4F9BB 1X3ZB 3HOSA 1Z3XA 2A6TA 2Y31A 3K4MA 2GAUA 3M1EA 3L2UA 5B1AH 5TRDA 4FTHA 3H0GJ 1EJ9A 4D0PA 2CRGA 4BDZA 3OTOE 2I8DA 2V9PA 4XKCA 4LFAE 4Y3OA 2L02A 3S16J 3I54A 2LJHA 4F93B 1BR4A 4XQFA 3GUDA 1I27A 3WU2C 3KETA 4A3IJ 4IQJA 4JI7E 2F5VA 4KUMA 2LT7A 2DK5A 2EPFA 5L3GA 2Y9YA 4G8XA 2HOSA 1J26A 2RQPA 3GFJA 2JUCA 1Z3YA 1XMQE 2CS3A 2E19A 2EOZA 2KDZA 1YE9A 1X4OA 1YW9A 2DQRA 2XRLA 3DP7A 3BR1A 1WVRA 2EN6A 2WBUA 2VC1A 4X62E 4DV0E 1T56A 3MSWA 1TT0A 1TP4A 2M9HA 3H9GA 2E5NA 2HQAA 1QU6A 3E6DA 2WZOA 3HQ1A 3JRBA 3EPKA 3K4KA 2I5UA 2DIXA 2DW4A 3HGGA 5A2QC 3GLLA 5D4SA 1MBKA 3OIQA 4M71A 2R93J 1Y6IA 2EJ4A 2LMZA 4AQYE 2YRKA 4IOAF 2BOLA 3KEOA 5C44J 1R5HA 3HG9A 3K4NA 2DBBA 1FTZA 3DKYA 2DA5A 3CJTB 2HPMA 3IH2A 3HOTA 3BPXA 2K3FA 4XLFA 4R2SA 2R7OA 1AOYA 2HKXA 1A1FA 2K02A 2HYJA 3JSPA 1KYWA 3BCBA 1B9MA 4M3FA 5HLGA 1FSHA 3HGYA 4ABZA 5LGUA 1UMQA 4CCOA 2EIMH 2JWTA 3RSNA 5K7ZA 3S2HJ 2V1NA 4FE7A 4D5FA 4OX9E 1B72B 2K7LA 4C3IJ 4Q35B 2JOBA 2WADA 2KP6A 1MKMA 2GBYA 2MW8A 2LKSA 3E6MA 3HBLA 5CQEA 4DR1E 2NVQJ 2N3GA 1HNXE 3ULQB 1XSXA 2F6CA 1NK2P 1OR7A 3KYDB 4B1RA 2DTRA 3AG2H 3VFZA 1ETVA 2GIZA 2R7WA 1A35A 3ZCOA 4S05A 4LU9A 4AWXB 2VJ5A 5EZGA 2KL4A 1BBYA 4WPYA 4BHCA 1K7AA 3CJQB 2PMZN 1YW7A 4S04A 3QAHA 3KE2A 1W36C 4A3LJ 4BEHB 5B5EC 4Q47A 2YPNA 1DGRM 1XCVA 2W85A 2XAJA 4HF1A 2EMYA 4FX4A 2CGPA 1JKQC 1VQ5I 2Q8KA 3BG9A 3IRRA 1PUFB 3OR2C 3W6VA 3QU6A 1FY7A 2VKEA 3WTZA 3I53A 3CUQB 3KEYA 1Y8RB 4RGRA 3CCLI 2GXGA 4CHUA 5HVQC 4OU0A 1MMSA 1GTKA 3C6MA 2Z16A 2DJIA 2FJ1A 4IJAA 5EG0A 1S72I 1UBDC 4BQOA 2YU5A 4IHWA 2ZJRF 2EM2A 1HDDC 2XPUA 4E7KA 4FQGA 3QRFF 1MNMC 5IT9Z 3U1KA 4LOCA 4KIFA 4A2UA 2VONA 2G9WA 5H2FC 3GTJJ 4LFBE 5KHDA 3LSRA 1SANA 3JRDA 4EATA 3QYFA 4FISA 1VNDA 3WTSC 1K61A 4ESJA 2RDPA 4P1WA 1X6EA 3NWTA 2VC0A 3HHGA 3K4CA 2H6BA 2LFBA 3Q3SA 3WTXC 2BBGA 5GP9A 1KYZA 5D4RA 4M72A 2HHHE 2V26A 2IPQX 2CQ7A 2KJCA 2FD5A 3QYEA 3M8FA 5FFXA 4DR7E 2H36X 1XD7A 2QENA 1YYOA 1BJZA 4UHTA 5FD5A 1HR0E 3P1XA 4DYCA 1ERDA 5HDKA 1IF1A 4UXNA 4JX4A 1MSEC 2NS0A 4KITB 2X1CA 1XCBA 2EV6A 4GYIA 3FM5A 3U9GA 5D5WB 1LFBA 2ENHA 1YS7A 2XIGA 4OMZA 4BDYA 2OTLI 1FIAA 3SEZA 2JA2A 2STWA 3F8NA 5IP6A 3PUFA 5HS8A 5CVVA 1I50J 4BJTA 2JMWA 4CH7A 4UUSA 4O4KA 4FCYA 4I02A 1U5TB 2R7SA 4HEA2 5GPAA 3DF6A 5KL3A 4I8OA 2ZM6E 1FYMA 1IGNA 2F5DA 5H6RA 4CUGA 4ZDOA 5B1BH 2E5LE 2GXAA 1ULYA 2CH0A 2LK2A 3M7GA 2PMUA 4XONA 5GTHC 3K70C 1FLIA 1I1SA 4XRFA 4RB3C 2BW3A 2L2MA 2OC6A 3OYCA 1U78A 3PO3J 2CUEA 4C3HJ 1UG0A 3S15J 2K4BA 1WJDA 3W2VA 5F0HA 3J81K 2M4IA 1V5FA 2KIFA 1HKTA 4L8NA 1B8IA 4JI1E 3HIFA 2LVHA 2A5WA 2OUMA 1ZYRF 2F4OB 4IXAA 1X3WB 2Y0SA 3SFZA 1FJLA 2MD5A 2HS5A 2DPUA 2BB8A 2VN2A 5LD2C 1BI0A 3BQYA 3IHUA 4CCKA 5IOZA 2PN6A 4JP0A 4N4OB 2E36A 4XORA 5JLWA 2M8GX 1U8RA 1X6HA 2X85A 1HSJA 1TW3A 3W6KB 1NCSA 2JQ7A 2NABA 5KK1A 1FT9A 2IS6A 2W82A 3IH3A 1RKTA 1ZREA 1BBGA 5M5WJ 1LVKA 2ZJPF 4IX7A 4NXME 5LRRA 1YITI 4C3JJ 4Y17A 2EK5A 3E5XA 5AE2A 1SFKA 3J80C 3NQOA 1E17A 2WAEA 3C6KA 3IAM2 2ESHA 2R5YA 2O7OA 1LUJB 1W7PB 2NYXA 3EUAA 4GGGA 4DZPA 4XOTA 1NHAA 4XR6A 2K40A 4XLAA 4A6EA 4CXFA 5E20A 2VXDA 1Q1VA 4ZH4F 3I56I 3CCEI 5DCMA 3G6EI 3ZMVA 4JV5E 1W4MA 1BN5A 3ABLH 4HOBA 1ACIA 1XG1A 2LH9A 4KMUX 3A01B 2V85A 4RLFA 1KYQA 2LCEA 1ENHA 2EPMX 1MZBA 2DXIA 1LVAA 1WI3A 2KLOA 3HTSB 3IWDA 4B09A 4U7BA 3T1YE 3ABMH 2D2WA 5ILVA 3CCMI 2E1MC 4BAYA 2HTSA 3CF5F 3L9FA 4B48A 1BJAA 5LHGA 3CQZJ 1I5ZA 2IA2A 2CMPA 2EBIA 4UY8I 3J81C 2YT4A 3ZMZA 3LSMA 1OCOH 1ON2A 3ZOBA 4A5MA 5LFAA 2JVHA 2M0CA 1DQ3A 4NC6A 1N78A 3JTZA 3IP4B 5HNFA 2DT6A 1J09A 1W5TA 2EOIA 2EOOA 4DNCA 1MMGA 3OS1A 2W57A 4DV5E 2L9SA 2GLIA 4R8HA 1MBFA 2JZYA 4GKJE 4RHBB 4PZJA 4AIKA 2TCTA 3HDDA 1IBKE 4HLYA 5FKLA 1P47A 1QBJA 1GUUA 2N8XA 3K1NA 1VQOI 4XSZF 3BJ6A 2M1SA 1TWCJ 4DIQA 1BW5A 4BC9A 3RQ4A 3RKYA 1IXRC 2DYSH 3EYYA 3GMEA 4RLQA 2XKPA 1A36A 1VQ9I 1QNTA 1QU3A 2MC6A 1LDKB 3U1DA 2FUG2 4KIGA 2VOPA 4CSWA 3L2WA 4LIVA 2QA4I 4NHRA 5EEHA 4NC7A 3H35A 4ZTFA 2YR2A 2I10A 4CYCA 2E1CA 2V1XA 1Z6TA 1QZZA 2LOOA 3O8HA 1ZN2A 4Y15A 4BXUA 3G71I 3CMEI 3DQVC 2ZO4A 4F54A 4M3BA 1FYKA 4M6VA 4N4NB 2X1DA 4ENKA 3DFGA 3VYXA 3MCZA 2LY1A 3FBIB 2FEZA 1U9OA 1E0EA 4JQFA 2ESNA 4DV2E 2JUGA 4O3MA 3WTTC 3HXLA 2KZVA 3S1RJ 2EOHA 4Q5SF 3OYHA 1W5SA 2KONA 1FZPB 1IQSA 5JHUA 1YG2A 5CLSA 3IWFA 4BMJA 4RAFA 3M8EA 2ICWG 4IRGA 3OYMA 3WE2A 1B59A 3P9CA 4WSGA 3CCQI 1RUNA 2EOYA 1SMYF 4RAYA 3WTVC 1R22A 2EZLA 4PSWA 1RUOA 1YRNB 4DZJA 1YOVB 2DA1A 4O5VA 2EN7A 2L2KB 3HOXJ 2Z1DA 3D5SC 2EPAA 1DPRA 2PFBA 4JI5E 3KPHA 2YRHA 4GRIA 2OCEA 1WKMA 2EPKX 4XBFA 3FM3A 3K2AA 2L7KA 4HSRA 1J5YA 3CC2I 2R5ZA 2Y2ZA 2VJIA 4E7JA 1O3SA 1O0WA 1HNZE 1UAAA 4QSHA 1Z1BA 3C4BA 4HX7A 3CF2A 2YRMA 5D6FA 1O4XA 2RSMA 4PJ0C 2LY9A 1SC7A 2VQFE 2G0EA 3F0CA 5JLXA 2DMQA 1U0JA 2LYCA 3DPLC 3RPQA 1G59A 4A3JJ 5FGMA 3SJMA 1XX5A 4LFUA 1BC7C 1Q1HA 3GW2A 1I6XA 3ZQHA 2XF7A 2DQLA 1KU9A 3K9TA 4ZYAA 5IYDJ 3BR6A 2FBIA 2MGQA 4MEYF 4LG0B 1ZR9A 2CQQA 5D8KB 1YLFA 2EORA 2FTXB 2EM8A 2MC4A 3Q9SA 3BROA 3QPTA 1V5EA 1K4SA 1IG7A 2F5EA 1JXSA 2FBHA 3GWZA 2V79A 5J47A 2EM7A 5F0CA 2EMXA 2EPPA 1T0FA 4OIPF 1W0UA 1EKEA 1CF7B 2CSOA 4BBYA 4YRVA 3FK7A 3N4MA 3S1NJ 2KRHA 1HW5A 3V8JA 2R7FA 3RKXA 1YIJI 3WTWC 3F8BA 3E97A 3B73A 2ZC2A 3CDIA 4KN4X 1OJLA 4HF0A 3I9V2 5LGTA 4LJZF 2M7QA 4WXCA 3Q5FA 1IRZA 4WFTA 3M4OJ 4M30A 5KVRA 4B43A 3LAPA 2YU9J 2XAFA 3AUZA 1SVMA 4KWYA 1X47A 3V7RA 1QVUA 1MMAA 2W7NA 1XNRE 4BUPA 3MVPA 3AL0C 3K4JA 1IDZA 3R0AA 1IUFA 1LE8A 1GVJA 1AU7A 2HNHA 1Z9CA 4KNYA 1MMNA 1EA3A 4TV7A 2LUPB 3C18A 3D5RC 2H8RA 4IHYA 1VQMI 2LJUA 3VEPA 4JBAA 2E34A 2A6EF 2M87A 4II2A 3PSIA 5IXMB 2BV6A 5TSEA 2LKXA 5GPCA 3FIGA 2UUAE 3JTHA 2QGUA 3IRQA 2R7UA 3AFHA 1G3YA 2VKVA 4UVBA 3GTGJ 3E5UA 3RPUA 2WY7Q 4L5IA 3SDGA 3GO5A 4LLGF 3GFMA 4FHTA 2R7XA 3NAUA 1L0OC 3KP5A 4XKWA 1UB9A 4XMYA 3BGHA 4F2JC 4R1HA 3VYRB 3PL8A 2YS9A 3LSJA 5IOYA 4KISA 2L2NA 1I39A 2L9RA 1RI7A 4CCNA 2MLKA 3DLLF 2LC2A 2JA7J 3DBHB 2LF8A 5M3FJ 5EJCA 1Z6RA 4WYQB 2BZTA 3C7JA 2A07F 2W25A 3AG4H 3HPHA 1FBSA 3PNYA 1Y39A 2R1FA 3LA3A 3SQNA 4R2EA 3QPHA 2QQBA 3TW6A 4G9YA 2LMDA 3DTEA 3I3LA 1QO0D 3R0JA 2DODA 2Y48A 2DA7A 3PUBA 5A2QZ 3LSPA 1D1AA 3WU1B 3L2CA 3WGIA 1MBJA 2D45A 3KEQA 4ZDLA 3ABUA 4PFPA 5HODA 4RB2C 2IA1A 3BJAA 2O8XA 2L7MP 1B4AA 2AS5F 1TQPA 1WQ2A 1NEIA 4AM3A 1SVOA 1XDSA 3VYUB 2VF1A 2XAQA 3ZMDA 1MD0A 3OR1C 1WJFA 2XGDA 3CD6I 3OSGA 1HNWE 4F91B 1PJQA 1Y1VJ 2VL8A 4E7ZA 2CWEA 3FXRA 4H0EA 2JOXA 4PDKA 3S2WA 1TLHB 2WB1A 2ENAA 1P4AA 3QU3A 2FF4A 1N36E 2BHZA 2QCOA 1XSVA 4RGUA 3MKYB 2ELZA 4HPQA 2QSFX 1YS6A 3C1DA 1W7PD 2F5FA 4M3EA 1JK1A 2K4VA 1CGPA 5BNGA 1FX7A 3TO7A 4Q48A 3NWSA 2EN4A 1DGCA 5FKMA 3CCYA 3CTAA 1P4WA 1GXQA 2IP2A 1FIPA 2KMUA 2L2OA 2WAQA 3FISA 3JREA 4CO8A 1D1CA 3IWZA 4OOIA
chains in the Genus database with same CATH topology
1FSEA 4I7HA 3KP3A 2LRSA 4I2OA 4WCGA 3GX4X 5AIQA 1R1TA 4B3ME 4NB5A 1D5VA 4L5JA 2FXAA 1EH6A 4KDPA 4M6YA 3TOAA 3SZPA 2PBIA 2HYGD 5AE3A 3AV0A 2EV5A 1L3LA 2M1BA 2O0YA 3H09A 1P92A 2V6CA 2ZNYA 3TO6A 2Z99A 4I0AA 5ED4A 2PEXA 2MH9A 2QVOA 4LB6B 1USSA 5L3CA 2P6SA 3B02A 4U0YA 5AE1A 2P5LC 3F6HA 2M5WA 3BWGA 2NRAC 3DEUA 5BS6A 5HLHA 4OIOF 1N33E 4ASNA 4YIFA 1R23A 2EB7A 3IKVA 3RYPA 1YW8A 2BYVE 5E18F 5AIPA 3O6BB 2WC2A 2UUBE 1XMKA 3HRMA 4P9FA 1J59A 4KMFA 1EH7A 1LJ9A 2GQQA 4DUYE 1FBQA 2HOEA 1XB4A 1FOKA 5J8FA 1ONVA 2L3DA 4PCQA 1J5EE 3DV8A 5LEJA 1OMIA 1BI3A 1IBME 6PAXA 2A3SA 3FWEA 2D1VA 4XLNF 2D1HA 2A69F 3CLOA 1T98A 2QM3A 3M9AA 1YYKA 2HKOA 2FQ3A 3FXUA 1K78B 3IC7A 1F9NA 2NUFA 3V4GA 2YX7A 4OIRF 5FD6A 3VB2A 2KIMA 3ROUA 1LEBA 4RGXA 2V1UA 3MFKA 2Z5UA 4NHJA 1Z1DA 2DO7A 5LHIA 2HYFA 1ZARA 3WU0A 3KZZA 3D0SA 3EYIA 1S29A 4Z2YA 2FGGA 3K69A 4CZZA 1GZ6A 2UU9E 2DLLA 2E1NA 4UUVA 3KP6A 2FNPA 5L3BA 4BNCA 1U3EM 3J80Z 4RB1A 3CDHA 2L92A 5CVIA 3JU0A 1YIOA 2LTSA 4WK8F 2RN7A 3N97A 1LDJA 3U2RA 1HBXG 1ZGAA 3G3ZA 4LF4E 3F6GA 3C3WA 3F8FA 3K0LA 2LUQA 2FNAA 2IT0A 1KQ0A 5CYVA 1GQEA 2XVCA 4LK1F 1S6LA 3GEZA 2Y75A 5DCMB 3J81Z 3GVAA 1DI2A 4X64E 1MJAA 2H94A 2KIUA 1PUEE 4U88A 2MLGA 3COAC 2MBFA 2BE5F 1FNNA 4BHPA 1BI1A 1R58A 4EM0B 2EFOA 3JSOA 2FBKA 2KKOA 2JPBA 2G7UA 3K1MA 3H92A 3BZ6A 1LEAA 1RNLA 3L09A 4P5OA 3CUQC 4HA8A 1O7FA 2DK8A 2C6YA 3V8KA 3WG9A 1ZBTA 3E5QA 4U7DA 2DU9A 3EETA 4YFNF 5FLXK 2CG4A 4LGWA 3IL2A 2XASA 2ODRC 2DT5A 3F6VA 3LQRA 1T4LB 2H09A 4MTDA 4EGYA 5ICEA 2CQKA 4DR3E 2EA2A 3Q9VA 2RC4A 3RIRA 1RIOH 4ZZDA 3KLNA 1R00A 3ZMUA 1T38A 4GEQB 2OQGA 1K79A 2JY9A 2STTA 3HSRA 1RZ4A 4X8WA 5F6FA 3ERED 4IRIA 4L9VA 5DD8A 3IWCA 2B7TA 4HZFA 3DF8A 5K5RA 3LMLA 5E1XA 2Q2EA 4A0ZA 4M9ZA 1X48A 2XAGA 2FOKA 5JR3A 3SHFA 5BQTA 1ZRDA 1UHZA 1IW7F 4WXDA 4OMYA 2RGVA 5FLXC 2FSWA 4X66E 4BH9A 1G3TA 2VOOA 4EJOA 3LSTA 2FRHA 2OZ6A 1GHCA 2B7VA 2VODA 3J7Yp 5DUKA 3WTYC 2HFHA 2E7XA 2FMYA 2ZXJA 2VE7C 4BQAA 5AONA 1ZG3A 4EQQA 2KRFA 1SAXA 1FKAE 2V83A 4GKKE 5D8LB 4YFKF 1H0MA 1IRGA 4AIHA 4BYYA 2JTVA 2O61A 3H3UA 5E1ZB 3T8TA 2QYOA 2RS6A 3SXYA 4K0KE 2OD5A 4ENJA 4JI2E 3CUQA 2B3TB 1X49A 4N9HA 1IN7A 3TO9A 1TTYA 3KFWX 1DP7P 3WE3A 1MDMA 2COMA 2P6TA 1ZG1A 1BI2A 2UWMA 3MZHA 3ADLA 1ZBQA 3O3KA 2NAZA 3HTUA 2GWRA 3KP7A 4MQ9F 3JAMK 4A5NA 1XDUA 2CYYA 2P5VA 2WTEA 2YZTA 2G7HA 3CO6C 3O2PE 4MTEA 2QUFA 1V4RA 2JSCA 1IN4A 1BM9A 4UVCA 4B3SE 2A68F 3HPZA 2NUEA 1BIAA 5HOOA 2NNNA 1R1VA 1S3JA 1XN7A 3F21A 5E8GA 2Z9OA 3HSFA 3I59A 1WSUA 1P4XA 1ZRCA 4P55A 2HR3A 3ADIA 1EV7A 4EV0A 3PFIA 3F23A 4HX4A 5JFRA 1PKPA 4AVPA 3HTXA 4BCAA 3BOQA 1R7JA 4GO1A 1J2XA 5CJ9A 3TOBA 4G94A 1OYYA 2UXNA 5CVRA 4OOGC 5HDGA 1H9GA 2UXDE 2V8QB 2XKOA 1SMTA 5K5QA 5BR8E 2VBXA 4DMIA 2QZ8A 2QBYA 1SD4A 2VXZA 3REOA 1TW2A 4YG2F 1WHNA 4A6DA 1HSTA 3WGHA 5J8CA 2L3CA 1IRFA 2LNBA 5FO5A 1O57A 3K1PA 5ADZA 3FXQA 5HS9A 2DMYA 5F64A 2FV4B 1J7KA 4A0YA 4TUIA 4FT8A 4CYDA 3H3ZA 4ENNA 2L4MA 2L33A 3KWRA 2IRFG 4LTYA 1SFUA 4O6JA 5BPDA 2JWOA 2Y0MA 1RC7A 2E1MA 1C0WA 4JI3E 1HQCA 2FA5A 4DR4E 1OYWA 2EZ6A 5LEKA 4L5NC 4UVAA 4BHBA 1UFMA 3RTRA 5DYMA 4HYEA 1G3SA 2VT2A 5CVJA 2KJBA 3I64A 2A5YB 2P5KA 2KHXA 2W24A 1PP7U 4HX8A 5EEGA 3LAJA 2HQNA 5H6QA 2HDCA 3WGGA 1JHHA 3D5LA 3ZPLA 1V3FA 4KA4A 4I0BA 4M0VA 4HF2A 1G6NA 2JPCA 3OOPA 1SD6A 3HPSA 3GLXA 4EJWA 3KCCA 5K5OA 4K2EA 2RNJA 3DJWA 2WV0A 4HAMA 3F6OA 4DV3E 1USTA 4IVNA 1QPMA 5L3EA 4AIJA 2DSYA 4J8ZA 2B0LA 1BIBA 4DQ2A 1WWXA 3K2ZA 2YPRA 2CPNA 4DV1E 4ZZLA 1J0RA 2LDUA 1DDNA 5LBQA 2GA2A 2WWYA 1IZ1A 2YX4A 2HEOA 2LSOA 3BPVA 3GZ6A 2JT1A 5ICCA 2Z33A 3MQ0A 1T6SA 2OBPA 4R8OA 4I09A 3RJPA 2MDRA 4CICA 4PGHA 3ECHA 3GF2A 4CGZA 1S7AA 2HQRA 1UHWA 5F1RA 4L0ZB 3MAJA 1XNQE 3OMLA 4M9SA 4JI8E 1GXPA 3QOPA 2IVMA 5K1YA 2ETHA 5BPIA 2N3HA 4MHGA 3FHZA 5FFZA 1QQIA 2V87A 4FX0A 4RB0A 2DB2A 4IF4A 4AD9A 4ESFA 1DUXC 1T4OA 1UHMA 5DD4A 4Y13A 1YZ9A 4YFXF 1TNTA 4HW0A 1QGPA 1BC8C 2DI3A 3DKWA 2ELHA 1O3TA 2EFNA 4LD5A 4LMYA 2UXBE 3HRSA 3EQLF 2DAOA 5DCFA 4LB5A 3ZOQB 3ZN1A 4DV7E 2L01A 3E3VA 2ADUA 4L18B 4GCVA 4HV5A 4GXOA 2R7DA 2GIVA 1YO5C 3NRVA 2OU2A 2W84A 2EV0A 3GXOA 1HW1A 2VBZA 2ZMEA 4I98B 2GA1A 3ZMSA 3ABTA 5DV5A 1FYLA 1B1BA 1DPUA 4ZYHA 1HW2A 1R36A 2A6HF 3DXJF 5FLXZ 3LA2A 2NA2A 1EKZA 4U0WA 4LF5E 2OA4A 4TUGA 2DPDA 5LLQA 4LK0F 4UNOA 3CO7C 1KU3A 5J6XA 2ZNZA 2PI0A 1YTYA 3ML6A 5ICFA 3F8MA 2LKPA 5DUIA 1K6OA 4OINF 4QLCU 1IAWA 3PQJA 1BOAA 4P7DA 3CUOA 4A12A 5TJJA 3T5XA 4N0BA 3ISPA 4DR6E 1J75A 2VQEE 1FPQA 2O3FA 1IUYA 2ZKZA 4U0VA 2OAZA 3ADGA 3BY6A 4EM2A 3V7SA 1KQ9A 3L7WA 2HZTA 5DNYA 4HDUA 4OIQF 2F4VE 2O6GE 5HS7A 1IBLE 2ZCWA 2EA4A 4QWQA 4HBLA 4RS8A 1XMAA 3F22A 4KFCA 2Q0OA 1SFXA 5LL6R 1HXDA 3KLOA 3ZN0A 2O03A 1YYWA 2L8TA 3HRTA 2QQAA 4IHTA 2K4JA 4HDVA 2XGXA 3C4TA 5L3FA 1Z05A 3GZ5A 4WXHA 2K86A 3FX3A 3P9IA 5ILSA 3V8LA 1Y0UA 4YY3E 2RTXA 2ISZA 1ZGJA 3PQKA 1MDMB 1T2KA 3QP6A 4A0XA 3GYHX 1LB2A 3GFIA 5AASA 1AWCA 1U6GA 3HUGA 5IWAE 3RYRA 1REPC 2QQ9A 4GYGA 1KA8A 2J5OA 4F9AB 4P78A 1Z7UA 1R5GA 3NEUA 3J7AG 2E7WA 2RKHA 2UXCE 1QZYA 3I5UA 1FJGE 4RAZA 2LF7A 2L4AA 3T1BA 3EUHA 1LNWA 3HSEA 4JI0E 5FB2A 2EJRA 3LLHA 4ESBA 3BJOA 2YU3A 3I59B 3J80K 4EVIA 3J7AO 3EDPA 2EFPA 3E6BA 4IHSA 3FZVA 1U5TC 1K78A 4E70A 2MH2A 2LBSB 2X0LA 3VOEA 4JI4E 4BS9A 2XRNA 3HRUA 4MGRA 1IXCA 3P7NA 3ZP5A 1S7OA 4ZYGA 3DPTA 4XLPF 1MJBA 3JAMZ 1RQ0A 1F1ZA 3HHHA 2VE9A 4KICA 2PQ8A 1MJ9A 2QBYB 4L9JA 1KQ8A 2Z3YA 3P9KA 4DV6E 2ZBKA 2ACJA 5IT9K 3TDZC 2XUBA 4WSPA 3QP5A 3IKTA 1WXRA 4B3RE 1VTNC 5D5VB 3VYYA 1ZRFA 5ILUA 4B3TE 3T8RA 2PJPA 3ELKA 3RI4A 4X65E 3JW4A 1O3RA 1A04A 5L3DA 4WF2A 3LWFA 1YFHA 1ZG5A 3WODF 2HTJA 4BC7A 1XGMA 4NXNE 2RS7A 2IHR1 1TBXA 5LMUE 2XV4S 2HGCA 3KP2A 4EGZA 3SZTA 2NNYA 2MA3A 1SR9A 2EWLA 1N34E 1T39A 4LF6E 2RV8A 2L54A 4KIBA 1F4KA 5LRSA 1P2FA 2QLZA 1FWZA 4HLXA 2AXLA 3R60A 3I4PA 2HWVA 5D5UB 5IT3A 1O7LA 3ADJA 3ZQ7A 2LTRA 2FE3A 5IT9C 3TQNA 3MZYA 3E6CC 4G6QA 2NUGA 3TKYA 4B8XA 3RDIA 3V7CA 5LHHA 3KZYA 4ZYEA 1H9TA 2JVAA 2KOUA 4ENMA 1PP8F 1PDNC 4L9NA 3K6QA 1T4NA 1SFEA 2J5PA 2M30A 2TDXA 1U5TA 2P4WA 5H20A 4WX9A 4LF9E 2PG4A 4Q28A 2FU4A 1ZAOA 4G7HF 1B6AA 1IXSB 1OPCA 2XROA 3I58A 4MEXF 1S8NA 4R03A 1D8JA 2MC5A 3ZMTA 2IW5A 4G7ZF 3FMQA 4EJUA 1ODDA 4EJVA 2JRTA 3JAMC 4P96A 5JVTA 3W6JB 2IJLA 4RGSA 3VODA 4IRHA 4CDGA 2V88A 4KHPE 4YIIA 1ON1A 4JI6E 2V89A 2IA0A 1UILA 2V9VA 4WWCA 1FC3A 3KP4A 5F3WA 2PLYA 2LE2A 2L3JA 3JTGA 3IWBA 1W7PA 2UUCE 2EFWA 1XGSA 3I0TA 4ON0A 3FF5A 1ZLKA 4DV4E 1XSDA 4M73A 4L9TA 5E17F 1D3YA 1I94E 3VK6A 2CFXA 1WI9A 1XGOA 4JYAE 2V1DA 2ODRD 5JI6A 1G4DA 2ZFWA 4XSXF 1SD5A 1KU2A 2OZUA 2EFQA 1TNSA 1WRJA 1IN5A 2H27A 1ZH5A 1TQIA 3MWMA 5BMZA 2R3SA 3LQQA 1O3QA 1N32E 2JR1A 4EJTA 1UCRA 2EWNA 2UZKA 2M8EA 1XMOE 3RMPA 3TGNA 1OYIA 1LQ1A 1JHFA 1JE8A 5T6JA 4LF7E 1KGSA 4HV6A 2FMLA 4HQEA 1HKQA 3WTUC 4LLLA 5DEQA 4M6XA 1LDDA 1ZLJA 3MEXA 1OKRA 3HYIA 5BOXA 1Z91A 3F8CA 3FMSA 2PMHA 1IN8A 2H6CA 4ETSA 1STZA 4HQMA 3AAFA 4EM1A 2ZMEB 3G73A 5LMNE 4M74A 1STUA 2P7VB 2L6MA 4DKKA 4NQWA 4LLNA 5D5XB 4MQVA 4YHHE 1YQAA 5HLIA 4MNUA 3LFKA 2BBYA 1P6RA 1FP1D 3ECOA 2V86A 2VE8A 1F5TA 2K27A 4L0YB 3I71A 4N9IA 2BEOA 1D8KA 2MC3A 4DR5E 2DFIA 4F7ZA 2ZJ2A 2CO5A 1MGTA 1HKSA 2F8BA 1EH8A 2A61A 3L00A 2YSRA 3BP8A 5CVUA 4UV9A 3LA7A 1U2WA 1X3UA 1ZHFA 4DR2E 1FBUA 2ISYA 3GFLA 5E8IA 1J9IA 2F5CA 4DUZE 2QWWA 4KZSA 5D6EA 1B9NA 2M45A 4KN7X 5DDGA 4KYWA 2GZWA 3BDDA 3F3XA 4LG0A 4M9XA 2BGCA 4ZYDA 2OQRA 3FMRA 3OV8A 1R1UA 3RKWA 2CW0F 5LGNA 4R79A 2P7CB 1G3WA 1CF7A 1JGSA 2UXXA 2X4HA 4F9CB 2P8TA 2VBYA 1SD7A 1YYVA 4P9UA 3T1HE 2GXBA 1IN6A 3R4KA 3T0YA 2VT3A 2B9DA 3R61A 4I01A 3R6SA 3F72A 5HDNA 2F2EA 5A2QK 4M2ZA 4PGGA 4G7OF 1E2XA 3TDUC 5ICGA 4UV8A 2XHKA 4JK1X 1TQMA 4EMSA 5E1WA 4KT5C 4IPAA 1WHQA 1FP2A 5ERIA 1KU7A 3CJNA 2RVCA 2VBWA 1I1GA 4G6DA 4Q4ZF 1XGNA 4LFCE 5CFFE 2XAHA 4F9BB 3HOSA 3M1EA 5TRDA 2GAUA 4D0PA 3OTOE 4LFAE 2L02A 3I54A 2LJHA 3GUDA 1I27A 3KETA 4JI7E 4KUMA 2DK5A 5L3GA 4G8XA 1J26A 2RQPA 3GFJA 1XMQE 1YW9A 2DQRA 3DP7A 4DV0E 2VC1A 4X62E 3MSWA 1QU6A 3E6DA 2WZOA 3HQ1A 2DIXA 2DW4A 5A2QC 5D4SA 4M71A 2LMZA 4AQYE 3KEOA 1R5HA 2DBBA 3HOTA 3BPXA 1AOYA 2HKXA 2K02A 3JSPA 1KYWA 1B9MA 5HLGA 1FSHA 5LGUA 4OX9E 2K7LA 2JOBA 1MKMA 3E6MA 4DR1E 2N3GA 1HNXE 3ULQB 1XSXA 1OR7A 2DTRA 3VFZA 4S05A 4LU9A 4AWXB 1BBYA 4WPYA 4BHCA 1K7AA 1YW7A 4S04A 3QAHA 3KE2A 4Q47A 1XCVA 2W85A 2XAJA 4HF1A 4FX4A 2CGPA 2Q8KA 3IRRA 3QU6A 1FY7A 3WTZA 3I53A 3CUQB 4RGRA 4CHUA 4LF8E 2GXGA 5HVQC 4OU0A 4IJAA 3QRFF 5IT9Z 4KIFA 4A2UA 2VONA 2G9WA 4LFBE 3WTSC 4ESJA 2RDPA 2VC0A 3HHGA 2H6BA 3WTXC 5D4RA 1KYZA 4M72A 2HHHE 2IPQX 2KJCA 3M8FA 5FFXA 4DR7E 2H36X 1XD7A 2QENA 1YYOA 4UHTA 5FD5A 1HR0E 3P1XA 5HDKA 1IF1A 4UXNA 2NS0A 1XCBA 2EV6A 4GYIA 3FM5A 3U9GA 5D5WB 1YS7A 2XIGA 4OMZA 2STWA 3F8NA 5HS8A 5CVVA