2G7HA

Structure of an o6-methylguanine dna methyltransferase from methanococcus jannaschii (mj1529)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
167
structure length
167
Chain Sequence
b'MIIQIEEYFIGMIFKGNQLVRNTIPLRREEIFNFMDGEVVSNPEDEHLKVAEIILKLYFAEIDDKKVRELISYKLEVPEFTKKVLDIVKDIEFGKTLTYGDIAKKLNTSPRAVGMALKRNPLPLIIPCHRVVAKNSLGGYSYGLDKKKFILERERLNMVSFKFNKVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
publication title Structural studies of MJ1529, an O(6)-methylguanine-DNA methyltransferase
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 20
structure length 167
sequence length 167
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2006-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2g7hA02
3.30.160.460 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2g7hA01
2IW5A 1QQIA 3VODA 4LB6B 1HW1A 2EA4A 1EH6A 2K4JA 3TDZC 2KJBA 2HFHA 2M30A 1ZG5A 1SFXA 2HKOA 2RC4A 2PBIA 4OMZA 3FM5A 1TQIA 3K2ZA 4EJTA 5DD8A 1U8RA 2W25A 3HSFA 2P5KA 2DI3A 4JQFA 3CTAA 4UXNA 4N9IA 1FPQA 1O7LA 4HF0A 1H9TA 3ECOA 5DDGA 1FNNA 2ZMEA 3I53A 2IPQX 1J7KA 2A07F 1RUNA 2RQPA 1T2KA 5K5QA 4GCVA 1FY7A 4MQ9F 3ABTA 2IRFG 1LJ9A 3GFJA 5AIQA 4KIBA 1W7PA 4FX4A 1K79A 4KNYA 3N97A 3F8BA 3QRFF 2HQRA 4FT8A 2KJCA 1YS6A 4GGGA 4CGZA 1HW2A 5EEGA 3ROUA 2EB7A 3F72A 2OZUA 4HYEA 1SFUA 2UWMA 1S7OA 4G94A 3TQNA 4BYYA 5L3EA 2QZ8A 1U5TC 3DXJF 2J5OA 2VT3A 2P6SA 3ZQ7A 4MEXF 2VE8A 2QUFA 4UVBA 2CQKA 1KA8A 1TQPA 4LD5A 1R7JA 4GXOA 5KVRA 2DBBA 1ON2A 4ETSA 5H20A 4UNOA 5DCMA 4UV8A 3CLOA 2HYFA 3RKYA 1FLIA 3QOPA 3T8RA 2W57A 5D4SA 3J7AO 4LLNA 3I71A 3V7CA 4E70A 3HOSA 2MA3A 2HS5A 4G6QA 5E8GA 5ICFA 1IN6A 3R4KA 4I01A 1R22A 2IT0A 5FO5A 2NNYA 1LB2A 3HSEA 4ESFA 2NAZA 2TDXA 3VEPA 3CO6C 1T98A 3FXUA 3DF8A 1I6XA 3GX4X 1O3TA 1CGPA 4FX0A 4G7OF 1TW3A 1SD5A 1KQ9A 5CVRA 2VN2A 2FXAA 3IKTA 1XD7A 3ELKA 3KP6A 1LVAA 6PAXA 4LMYA 4L9JA 3JAMZ 4BHPA 3VB2A 1I1GA 1LDDA 4WCGA 1UHWA 2EFPA 4LK1F 2DQRA 1BI3A 2C6YA 1KU3A 4KIGA 4IRHA 1J2XA 2V79A 2UXXA 2RN7A 1K78A 1CF7B 3WTZA 2DW4A 5LBQA 1USSA 5HLGA 3E6MA 3KFWX 4HF2A 5LGTA 3JW4A 3DPLC 3GEZA 4A6EA 4BAYA 3ABUA 1JHFA 3TDUC 1HKSA 3SXYA 3FMSA 1GHCA 2DPDA 2BGCA 2RDPA 4XRFA 1YG2A 2P5LC 2O8XA 1G3TA 1ZN2A 3P9CA 3CUQB 3R0AA 2ZFWA 5J6XA 4KUMA 1BBYA 3H3UA 2V1XA 3K69A 2JRTA 3G3ZA 1TBXA 3KEOA 4BNCA 2NYXA 4HW0A 1W7PB 4WWCA 5LHHA 4QWQA 3F6OA 3H3ZA 5HVQC 3ERED 3QU6A 4WXCA 4YFXF 5DYMA 4XSXF 1RZ4A 4OU0A 2Y0MA 5FD6A 3QAHA 4PDKA 1GXQA 2DK8A 1QPMA 5IT9K 4AD9A 3Q9SA 2JPCA 2OQGA 5D6EA 1ZLKA 1HKQA 4XLPF 1B1BA 2VC1A 5D8KB 2MC3A 5LRRA 5D4RA 1A04A 2R7DA 3R6SA 5BQTA 3ZMZA 4P55A 4EVIA 3T8TA 1BJAA 1JGSA 1FWZA 3WG9A 4L5JA 3FHZA 4KDPA 5E17F 4IHTA 1KQ0A 1B4AA 2GXBA 3U1DA 2RVCA 4L0ZB 3KCCA 1XGOA 5LRSA 3N4MA 2VBXA 3BWGA 5E20A 1J5YA 4I0BA 3TKYA 5D5UB 1LQ1A 2JSCA 5HDGA 5CVVA 1QZYA 2XVCA 4I09A 1DPRA 2VBWA 1WRJA 2W85A 3WTWC 3GF2A 5BPDA 1FYMA 3SQNA 2HYGD 2JT1A 1WWXA 3KETA 1B9NA 3WGGA 2VONA 3V8LA 3WTTC 1ON1A 1P4WA 2V1DA 4HV6A 4IVNA 1YYVA 3BROA 2QBYB 4CO8A 1MJBA 3RKWA 3HOTA 2EFWA 5JI6A 4KMUX 2EFNA 4RAZA 3L7WA 2HTSA 4ENKA 5CVJA 2P7VB 2XKOA 1YFHA 2L54A 3QPTA 3C3WA 2QQAA 2HZTA 2IJLA 3IKVA 4OIPF 2OBPA 4N9HA 1YW9A 3I5UA 1R1VA 1ZG3A 3BY6A 2L3DA 3BZ6A 2NS0A 4IPAA 1I1SA 4N0BA 4IRGA 2ZKZA 4BHCA 2NRAC 4R8HA 5FB2A 4HF1A 3ZN1A 4AIHA 3JSPA 1KU9A 4M73A 5K5OA 3F3XA 4PGGA 4L9NA 2XAFA 1J9IA 1WI9A 2YR2A 1RIOH 5A2QZ 1MJAA 4TV7A 2Z99A 2JPBA 5D8LB 4RGXA 1V3FA 5EEHA 2STTA 1IF1A 4RB3C 3HIFA 5A2QK 1XGNA 3IWFA 4WK8F 3LQRA 3B02A 3R60A 3QU3A 3F8NA 4HLXA 3MFKA 3COAC 1JE8A 1KYWA 1FBQA 5ILSA 1S6LA 3TO6A 2MH9A 2LSOA 3FWEA 3OV8A 2X0LA 3WTUC 3LA7A 1ZYRF 2ADUA 4ENNA 3O2PE 3I64A 2CO5A 4ZYDA 3BDDA 2WTEA 5DUIA 2L4AA 4AIKA 1CF7A 5FFZA 3MQ0A 2E1CA 3BP8A 4LK0F 3H92A 1BOAA 5D6FA 4HBLA 1G3YA 4HX8A 4HX7A 2NNNA 2M45A 4I7HA 3R0JA 2ZO4A 5K1YA 3PQKA 3MCZA 4AIJA 3FZVA 2Z33A 3EYIA 5D5WB 1X3UA 1YW8A 2X4HA 2FRHA 3F21A 3MWMA 2YX7A 4I2OA 1IW7F 1T0FA 4A6DA 3CUQA 3RTRA 2CYYA 2GAUA 1PP8F 2BEOA 3JTGA 3RDIA 2K02A 2L01A 2L4MA 2KIMA 1R5GA 3I0TA 4A5MA 2CG4A 1ZRCA 3U2RA 3RPUA 5JHUA 2IP2A 1J75A 3F8MA 2P5VA 1JXSA 3IC7A 1YQAA 1ZREA 1LEAA 1ZGAA 2YSRA 1HQCA 4R1HA 3SZTA 4KA4A 1IN4A 3KLOA 1REPC 1ZG1A 1STZA 4MGRA 2Z3YA 4M9XA 3BPVA 2O61A 1I5ZA 3T0YA 2OD5A 3HSRA 4EM2A 3GWZA 1TLHB 4P9UA 1R00A 5LGUA 4LG0B 4OIOF 3WGHA 3SZPA 3KP5A 4G8XA 3V8JA 3I59B 3GFMA 4L5IA 4ENJA 3KE2A 3K1NA 4WF2A 1P2FA 3M8EA 1IRGA 2L02A 4KIFA 1O3RA 3E3VA 2DT5A 2GXGA 5H6QA 3J80Z 2QYOA 4S05A 2DTRA 3IHUA 1TQMA 3J80K 4P9FA 2PI0A 4NB5A 4HQMA 5ILUA 1R5HA 4MQVA 4LGWA 3M9AA 4ZYGA 3DEUA 4QLCU 5F64A 2ZJ2A 3G73A 2ZBKA 3ZP5A 1T6SA 2E7XA 2VOOA 2BE5F 2VBYA 1U3EM 3WU0A 5JR3A 1IRFA 4RS8A 5JFRA 2Q8KA 1Q1HA 1T38A 1P4XA 4YIIA 2H6CA 2FMLA 3B73A 3K0LA 2QBYA 1W7PD 2RV8A 3W6JB 1BI2A 1B59A 1HKTA 5DEQA 2VC0A 3EYYA 1XMKA 3IRRA 2OQRA 2XIGA 1YO5C 5ICCA 2IA0A 4PCQA 2E1NA 3F8FA 3HRTA 1D8KA 1YLFA 2H94A 2UXNA 4ZH4F 3IWZA 4IRIA 3T5XA 3Q9VA 3GVAA 2G9WA 1B9MA 3AAFA 2BV6A 4KFCA 4EV0A 3C7JA 3OOPA 1ONVA 5DV5A 3WGIA 4RAYA 2DPUA 4MTEA 4Y17A 1BI0A 1R23A 3BJ6A 3KP7A 4HV5A 3EETA 3RYRA 4Y13A 3E6BA 5TJJA 1D5VA 1FP2A 2PQ8A 2IVMA 3HRMA 2DO7A 1XB4A 5E18F 1IXSB 3L00A 1Z7UA 5LGNA 4M74A 3HUGA 4XLNF 3GW2A 2O6GE 1EH7A 3HRSA 3KP3A 2HGCA 5ED4A 1FC3A 1DDNA 3WE2A 4P5OA 4WXDA 2MBFA 2QVOA 1FX7A 2XGXA 1Y0UA 4EGZA 3ECHA 3V7SA 4HOBA 5HS7A 2Y75A 4HQEA 1WQ2A 3P9IA 3QP5A 1FYLA 1S8NA 3FM3A 2VBZA 1U5TA 5E1XA 4A5NA 5IT9Z 3RIRA 2FBHA 4A0YA 5LLQA 5ICEA 4BQAA 4OIQF 1KYZA 1T39A 4LB5A 1FP1D 3I4PA 3NQOA 1SMTA 1UFMA 1S29A 3ZMVA 4UHTA 4HZFA 4OIRF 2EV6A 2O03A 2JTVA 1G6NA 4CYDA 3P7NA 1E17A 3D5LA 4EM0B 1IAWA 1FOKA 1XCBA 1ODDA 5D5VB 3BJOA 2EFQA 4S04A 3EQLF 1HXDA 3FXQA 2V1UA 3V7RA 3ZMDA 4DNCA 3QP6A 4CDGA 3GZ5A 4U88A 4H0EA 1PP7U 1HBXG 1YW7A 5D5XB 2ZNYA 5HS8A 2EJRA 1Z6TA 3RKXA 2F2EA 2PMUA 3HHGA 2M1BA 4A12A 4LJZF 5LHGA 3L2CA 2GWRA 1F9NA 1BIAA 4G9YA 2MLGA 1DUXC 2ETHA 4JBAA 1GXPA 2GQQA 3TOBA 3ZMTA 4NQWA 4IHSA 2GIVA 1NHAA 1J59A 3V8KA 4JK1X 4A2UA 4ZYEA 1LNWA 2H09A 1HSJA 1BC7C 1XN7A 3CUQC 3W6KB 1MZBA 3E5XA 1MDMA 2P4WA 2HDCA 4L9VA 2F5EA 1XGMA 4LLGF 1XMAA 3MEXA 2COMA 4Y15A 1E2XA 2PFBA 2P6TA 3Q5FA 1IXCA 1L3LA 4HLYA 4WXHA 4LG0A 5FLXZ 1Z05A 3GFIA 3I59A 4AVPA 2VT2A 3HTUA 4EJWA 3J81K 2W84A 5FLXK 4OINF 2XROA 5BPIA 2CWEA 1F4KA 1U6GA 4CZZA 3MZYA 2Y48A 2FBIA 3LAPA 5HLIA 2MH2A 3GLXA 1ZLJA 1ZRFA 2YU3A 2DAOA 5KK1A 1W5TA 3TO7A 2D45A 4O6JA 3CJNA 5J8CA 2XAJA 3E6DA 4ZYHA 3WTYC 2YPRA 1QGPA 1RNLA 1ULYA 5FD5A 1J0RA 1EH8A 1IZ1A 5DUKA 4F7ZA 5BS6A 4GYGA 4G6DA 4O5VA 3IRQA 2D1HA 4MHGA 3LAJA 2Z9OA 3LWFA 4KICA 3DPTA 3FF5A 2CFXA 2VOPA 5IT3A 1ZH5A 2LF8A 2A3SA 1F1ZA 4L9TA 3PFIA 1L0OC 1EV7A 4B09A 2HKXA 1OYWA 1H0MA 1XDSA 2M8EA 3LA3A 4CHUA 3WODF 4Q48A 1U5TB 2HWVA 3PQJA 1K6OA 2A69F 1O7FA 2ESNA 3RPQA 1SAXA 3WE3A 2EFOA 3RI4A 2B0LA 3CUOA 3GFLA 4KN7X 3KLNA 4OOIA 1R58A 2EA2A 4I98B 2W24A 1PDNC 3RYPA 1RUOA 2QWWA 3GXOA 4B8XA 3V4GA 5CVUA 2ELHA 2V6CA 3E5QA 4U7BA 1LDKB 1LEBA 1FBSA 2FOKA 2RNJA 5K5RA 2XRNA 3NEUA 2QQ9A 4EMSA 2FSWA 4U7DA 1P92A 5ERIA 2K86A 4Q5SF 2VODA 5FFXA 2G7HA 4M72A 1XSVA 3VFZA 4PGHA 2FEZA 1YS7A 3TOAA 4M9ZA 1ZHFA 4RGRA 2D2WA 4BH9A 1AWCA 1R1TA 1IN5A 4MTDA 1PUEE 3RJPA 2A6EF 1U2WA 2BYVE 3M7GA 3WTXC 3O3KA 1F5TA 4M9SA 2FU4A 1C0WA 4K2EA 3EDPA 2DQLA 1SD6A 2ISZA 4YFNF 2VXZA 1KQ8A 3GYHX 3C18A 3LSTA 4M6XA 2FBKA 3SHFA 5F6FA 2LDUA 1MDMB 1V4RA 3LFKA 4A0ZA 3DV8A 1BN5A 5LEJA 4CICA 4UUVA 5CJ9A 1B6AA 5H6RA 3D0SA 2A68F 2CSOA 4I0AA 1TNSA 4HDVA 5AIPA 1KU2A 3KZZA 2R7FA 1O3QA 5ILVA 4P96A 2ACJA 1FYKA 2J5PA 2GA2A 1MGTA 5HLHA 3IL2A 3E6CC 5AONA 4G7HF 4G7ZF 1XSXA 1U78A 1OMIA 2M5WA 1YTYA 1OPCA 1JHHA 2QLZA 4OMYA 4ENMA 4ESBA 2LNBA 4Q47A 1P6RA 2MD5A 3E5UA 2ISYA 2IA1A 2RKHA 3LQQA 1S3JA 3O6BB 1AOYA 1ZARA 3FXRA 2XAGA 3JSOA 4DQ2A 4HX4A 1BC8C 2K4BA 4YG2F 1FSHA 4EM1A 4WX9A 3F8CA 2Z5UA 3F6VA 3U9GA 2FNAA 4FHTA 3ZN0A 3TGNA 3FX3A 2WV0A 4AWXB 3GUDA 3JTHA 1W5SA 3I54A 1BI1A 4KN4X 4EGYA 3ISPA 3WTSC 3QPHA 5TRDA 3I58A 2FA5A 4EJUA 4I02A 4RGUA 2WWYA 1LDJA 1Z91A 2HR3A 2OA4A 2F5FA 4RB0A 2QM3A 1WKMA 3MAJA 4HA8A 1XGSA 2EK5A 2GZWA 2ESHA 2BBYA 4ON0A 3DP7A 3K1MA 1K7AA 4RGSA 4RB2C 3MZHA 2OAZA 1IXRC 1ZAOA 5L3BA 3DKWA 1ZRDA 2EV0A 1IN7A 4UVAA 4KMFA 4O3MA 1FZPB 2XV4S 2JZYA 3JAMK 1G3WA 5J8FA 2XAQA 5ICGA 2HEOA 2PJPA 2A6HF 3REOA 1MD0A 2O0YA 5L3CA 2HOEA 2F5CA 2QENA 2K7LA 4PZJA 1R36A 3F23A 1OKRA 1UCRA 3VOEA 2D1VA 3HYIA 2ZMEB 3BOQA 1OYYA 2P8TA 1QNTA 1YIOA 3KP2A 4IF4A 1O3SA 4ASNA 4L0YB 3WU1B 2FQ3A 1RI7A 2F5DA 1H9GA 1KU7A 1IUYA 2A5YB 3M8FA 2KKOA 2YX4A 4ZZDA 5F1RA 2XHKA 3R61A 3CO7C 3L09A 1DP7P 4A0XA 3HTSB 3P9KA 4MEYF 4M71A 3F22A 2VE9A 1WSUA 3SFZA 4BHBA 2H27A 2FNPA 2OU2A 2PG4A 3KEQA 2PMHA 5L3DA 4BXUA 3T1BA 2XUBA 4XBFA 1GVJA 5BOXA 1BIBA 4Q4ZF 4U0WA 2MLKA 2G7UA 1FSEA 1XSDA 3FMRA 4GO1A 2ZXJA 5L3FA 3M1EA 2LKPA 5E1WA 1SFEA 2DLLA 4U0VA 2EV5A 4HDUA 5HS9A 3WTVC 3ZMUA 4CXFA 2P7CB 4HAMA 1Z9CA 3EUHA 3S2WA 4RB1A 1FT9A 1QO0D 1MKMA 3GO5A 4MNUA 2Q2EA 1O57A 4R79A 1P4AA 2PN6A 2STWA 4U0YA 2QQBA 5DCMB 2WC2A 5DCFA 1IN8A 2FF4A 2Q0OA 4M6YA 1G3SA 1HW5A 2XAHA 3K1PA 4ZZLA 2PLYA 2CW0F 1FBUA 3E97A 2DU9A 3NRVA 1OYIA 2IA2A 1TTYA 2PEXA 2XASA 1KGSA 3GZ6A 1I27A 2FE3A 5HOOA 5CLSA 2KIFA 2HTJA 1SD7A 3K9TA 4YIFA 2CGPA 2LF7A 3ULQB 3C1DA 2R3SA 1S7AA 5E8IA 1BM9A 1QZZA 5BMZA 4YFKF 5HDNA 3J81Z 5JVTA 4KT5C 2KRFA 1D3YA 2FMYA 3BJAA 1QBJA 1UHMA 1MJ9A 4IXAA 3HHHA 2HQNA 1TNTA 2H6BA 5CVIA 4UV9A 4NHJA 2EWNA 2E7WA 2KIUA 2DK5A 2RGVA 2AS5F 3LA2A 2O3FA 4IJAA 2GA1A 5LEKA 2AXLA 5LHIA 3DFGA 2ZNZA 4KYWA 1HSTA 2V9VA 2A61A 1SMYF 1UB9A 1K78B 1Z6RA 3TO9A 1D8JA 1DPUA 4EJOA 1TW2A 1ZGJA 3ML6A 1USTA 5DD4A 3L9FA 4XSZF 5CYVA 2ZCWA 1G4DA 3DQVC 4LFUA 2UZKA 1XDUA 4EJVA 3HRUA 5FGMA 1XCVA 3ZMSA 2DFIA 4EQQA 3KZYA 1VTNC 4ESJA 1SD4A 2K27A 3CDHA 1OR7A 1W4MA 4UVCA 5HDKA 2OZ6A 3KP4A 5L3GA 1Z1DA 4L18B 3ZPLA 4Z2YA 1R1UA 2M87A 2XKPA 4GYIA 3FMQA 5E1ZB 4D0PA 4LLLA 3BPXA
chains in the Genus database with same CATH superfamily
2HI3A 3AG3H 1WFXA 1VQ4I 2KPMA 2KDZA 2Q8UA 4B3AA 2IW5A 2VLAA 1QQIA 4J19A 2JRMA 1E3PA 3VODA 2YPNA 1WH5A 4LB6B 2KRHA 2EN3A 3DKYA 1YI2I 1B69A 1HW1A 2QCOA 2EA4A 3DEWA 1EH6A 2K4JA 1R4NB 4DV2E 4XLAA 3UNGC 2HVSA 4JX5A 4BL0B 2EPUA 2BZTA 3ABKH 3TDZC 2M1SA 4UB8C 2HVQA 2KJBA 3CJQB 2HFHA 3ZQFA 2M30A 4E4HA 3S3NA 3ZQCA 4IOAF 1DU6A 1ZG5A 3IH3A 2B9SA 1SFXA 2HKOA 4WSPA 3HKZN 2RC4A 2PBIA 2MC4A 4JYKA 4OMZA 3FM5A 1TQIA 3IAS2 2X6YA 3PO3J 3KIOA 2LO3A 5AC5A 3K2ZA 4EJTA 2VPRA 5DD8A 3AG1H 1U8RA 2EOFA 1QHGA 5AE3A 3JRBA 4CA0A 2W25A 3HSFA 1AKHA 2P5KA 1SFOJ 1B72B 3VSKA 3DLLF 3TMOA 2DI3A 4JQFA 3CTAA 2DTZA 4UXNA 4N9IA 1I39A 1FPQA 1IBME 1O7LA 4HF0A 1H9TA 3ECOA 5DDGA 4F52A 2ECBA 2PMZN 1FNNA 3CCMI 4DR4E 2FD5A 2LP0A 1X49A 4XORA 2ZMEA 3ONQA 4DYQA 3I53A 2IPQX 2K85A 2M9HA 3BLYA 3K4MA 2E1MA 4XLCA 1J7KA 4DR7E 2Q2EB 2A07F 1FOXA 4IKFA 3ESWB 1RUNA 2YZTA 2DSYA 1MNDA 2RQPA 2YTPA 1T2KA 3QOEA 1VQ9I 4JOMA 5K5QA 2R5YA 4GCVA 1FY7A 4MQ9F 3HB9A 3ABTA 2IRFG 2CH0A 1LJ9A 3GFJA 5AIQA 2AXTC 4DJAA 1GTKA 4KIBA 3P1XA 1J5EE 1T8IA 1W7PA 1NEIA 2LT7A 2DOEA 1X1PA 4IHXA 4FX4A 1K79A 4KNYA 3OYFA 4A3EJ 4M30A 2XSDC 3N97A 4RLFA 2LTRA 3BBGA 3F8BA 1YZ9A 1MNMC 3CCLI 3GTMJ 3QRFF 2LVHA 3HEFA 3VYYA 2HQRA 3K10A 2LC2A 4BBSJ 4BS9A 4ZJZA 3I4NJ 4FT8A 2KJCA 1YS6A 4NDLA 4GGGA 3CMEI 2XF7A 1HW2A 2TRTA 4CGZA 4R2DA 3TW6A 3FK6A 4M3DA 1A31A 5EEGA 3ROUA 2EB7A 3F72A 3ZQIA 2OZUA 2EM2A 2V1NA 2KT0A 3BZCA 3CF2A 3OYEA 4HYEA 1SFUA 2UWMA 3FXLA 2X51A 2CPNA 4WSGA 1S7OA 3GMEA 4G94A 3TQNA 2YTQA 3CCVI 2KDOA 4BYYA 5A6BA 5L3EA 5EDNA 4PFOA 2BY3A 2VKEA 4JI3E 3BT9A 1FTZA 2L9RA 4WPYA 2YTJA 2QZ8A 3BG7A 1U5TC 3HPZA 5DNYA 3DXJF 3O8HA 1OFCX 1S5LC 3D5RC 3QPLA 4UUTA 2J5OA 4A93J 3H9GA 2EOEA 2VJJA 2IEKA 3G4SI 4I6ZA 2ICWG 2VT3A 2P6SA 3VPRA 1VZ0A 3ZQ7A 1LUJB 2EL6A 2MD0A 4MEXF 4DV4E 2V88A 2LR8A 1X1AA 3BG5A 5HLTA 2MYSA 2AO9A 1MMDA 2EMXA 2VE8A 2XF5A 5C4XJ 3E7LA 4JI0E 2QUFA 4UVBA 5FKOA 1MBGA 1KA8A 2CQKA 2L6MA 2K5CA 2BB8A 1TQPA 2HZDA 4LD5A 5IT9C 1R7JA 1Y1VJ 1RMDA 4OX9E 4DR3E 2UXCE 4GXOA 5KVRA 2ZJPF 1BR1A 2UUCE 1BW5A 2DBBA 2EE8A 1ON2A 4ETSA 5H20A 1RC9A 3OY9A 3KYDB 4UNOA 5DCMA 2BY1A 2VUMJ 5JVGF 4UV8A 3CLOA 2M34A 2HYFA 3RKYA 1SAUA 4F93B 3QOPA 1JKRC 1FLIA 3T8RA 2W57A 2HDDA 5D4SA 3J7AO 4LLNA 3VYTB 3LL7A 3A01A 3I71A 2L5QA 1G2HA 4O24A 2DDBA 1Y56A 3V7CA 3IUOA 3ERMA 4E70A 1ETXA 3HOSA 1ZGWA 5KL5A 2KQRA 2DMPA 3CCSI 2MA3A 2HS5A 1V5EA 2EMBA 2EPFA 4G6QA 5E8GA 4FK5C 4E7KA 1OISA 5ICFA 2QKMB 2M0MA 1IN6A 2EZIA 3R4KA 1A1KA 2R7VA 4I01A 1WI3A 3H9QA 1R22A 4KZSA 2IT0A 5FO5A 1HNXE 2NNYA 1LB2A 3HSEA 2M3AA 4ESFA 2NAZA 1E3OC 3C4BA 2TDXA 3VEPA 2OUMA 1JT6A 4BE2A 3CO6C 1T98A 3FXUA 3DF8A 2JR1A 1X1CA 5J1YA 2JN6A 2NABA 1I6XA 1DP3A 3EUHC 1HDDC 4CH7A 3SDGA 1PVEA 3GX4X 2Y30A 2K9MA 4DR2E 4D1QA 2R5ZA 3AKZA 1TN9A 1O3TA 1K4SA 3ZCOA 1CGPA 2DA4A 4E7HA 4FX0A 2OF7A 4G7OF 2F4MB 2E35A 1YITI 1TW3A 2DMQA 1SD5A 3E0JB 3ECRA 1KQ9A 4J01A 2HQ5A 3M07A 3CCRI 2D5VA 5CVRA 3IWDA 2VN2A 4F6NA 3B6AA 2FXAA 3IKTA 1XD7A 1ETQA 3ELKA 1UELB 1QU6A 1QA6A 3KP6A 2K4VA 1XNQE 1LVAA 6PAXA 2WB1N 3K70C 2IGNA 2R7RA 2I9IA 4JI2E 4LMYA 1YIJI 4A3KJ 4L9JA 3JAMZ 4F92B 2MC5A 4BHPA 3VB2A 1ENHA 3OYMA 1BB8A 2DRPA 3GCMA 3EPKA 1ZKGA 1I1GA 3HPHA 4XLEA 1LDDA 2JA8J 1G59A 4WCGA 2VI6A 2EPPA 1WHUA 1LLMC 2NVXJ 3RCOA 3DTKA 4F2JC 1P7JA 1UHWA 2EFPA 4LK1F 2DQRA 1BI3A 1ETWA 2C6YA 1KU3A 4KIGA 3LSMA 4IRHA 4X66E 1J2XA 4R2PA 3OYJA 2V79A 2EZLA 2UXXA 2LMDA 2OV7A 1B8IB 2RN7A 1K78A 1CF7B 4NXNE 3WTZA 2DW4A 3PUFA 5LBQA 1JGGA 3FIGA 1P47A 2IGMA 3FKIJ 1USSA 4C2UA 5HLGA 2L9VA 5J47A 2EN2A 3E6MA 3KFWX 3WU2C 2O9LA 4HF2A 4GKJE 4MLVA 3HC7A 5LGTA 4GEQB 3JW4A 3RMPA 2JUGA 2MDGA 3DPLC 3FIWA 5M5XJ 2LH9A 3GEZA 4A6EA 4BAYA 4X1EA 3ABUA 1JHFA 1PUFA 2CMPA 3BTIA 3A0HC 2EM5A 4NZVA 3K4KA 3TDUC 1HKSA 2NVUB 4A3BJ 3SXYA 1A6QA 1GZ6A 2LV2A 4R2QA 4EEFG 4AQYE 4QIWN 4XN0A 1FMWA 3QYBA 5J4YA 3FMSA 3MKWB 1GHCA 2DPDA 4ZTFA 2VKHA 2BGCA 2RDPA 4XRFA 2EMFA 2LBFA 1YG2A 3HXLA 2LLKA 1ZR4A 4DV5E 1HNZE 2P5LC 2O8XA 1G3TA 1ZN2A 3P9CA 1MW7A 3CUQB 1EKZA 3R0AA 2ZFWA 5J6XA 1I3QJ 4IHYA 4MIMA 2IGKA 4AM3A 4KUMA 1BBYA 3H3UA 2V1XA 3FISA 4DV0E 3HG9A 3K69A 5KL4A 2JRTA 2L3CA 3C4TA 3G3ZA 2HXOA 1TC3C 1TBXA 3HKZA 2R5YB 2EN1A 1BJZA 3BGHA 1HNWE 3KEOA 4O43A 1YRNB 4FASD 3CC7I 4BNCA 1PJQA 3SYTA 2NYXA 2W48A 5DM7F 3PM1A 1MBEA 2OC6A 4HW0A 3Q0UA 1W7PB 4WWCA 1HLVA 5LHHA 4QWQA 3F6OA 2HDWA 1WVRA 3H3ZA 5HVQC 3ERED 2LKSA 2CRGA 3QU6A 4WXCA 1NG6A 4YFXF 3HL2A 2PMZA 3BCAA 5DYMA 4XSXF 2W4SA 1RZ4A 1YPNA 4OU0A 2Y0MA 5FD6A 2EM8A 4PUSA 3QAHA 3ABLH 4PDKA 5TISC 3NWTA 2DXIA 4IS1C 1GXQA 2DK8A 1YX5A 4BQQA 1QPMA 5IT9K 4AD9A 3Q9SA 1IO2A 5A2QC 1OCRH 5CPRB 2JPCA 5B5EC 2OQGA 4Y33A 5D6EA 1R5ID 3OOUA 3BR3A 5GPCA 1ZLKA 2YT4A 1DQUA 1RETA 1HKQA 3QODA 4CCOA 4XLPF 1B1BA 2VC1A 1YJNI 2L2NA 3THNA 5D8KB 1OR7C 3W2VA 2DFFA 2MC3A 5LRRA 2ID3A 5D4RA 1NK2P 3ADGA 3ZQLA 1A04A 3AL0C 2R0QC 2R7DA 3R6SA 2DA2A 4B48A 5BQTA 3ZMZA 4W97A 1RQ0A 4P55A 2F4VE 4EVIA 3K6GA 2BOLA 5KL3A 3T8TA 4L8NA 1BJAA 3BZKA 1FTTA 4ZC3A 1JGSA 1FWZA 2BW3B 2DA3A 2E34A 3CZ6A 3PSFA 4UUSB 3WG9A 4L5JA 3FHZA 4KDPA 1GUUA 2M7AA 3S32A 2DJIA 2Z16A 5E17F 3BR2A 4IHWA 3WHCA 4IHTA 2IS6A 2B3TB 1KQ0A 2EIJH 1B4AA 2MSYA 1UMQA 1N77A 5EZGA 2GXBA 2Y69H 4LFAE 3E1SA 3U1DA 2R76A 1AAYA 1MSFC 2RVCA 4L0ZB 1AU7A 2MFZA 3KCCA 1XGOA 5LRSA 3N4MA 4O5GA 2VBXA 3BWGA 2BXZA 5E20A 1J5YA 4UY8I 4JI4E 1IUFA 2JY9A 4I0BA 3DF6A 3TKYA 3JRGA 5D5UB 1LQ1A 2JSCA 2CJJA 3OMYA 5CVVA 1QZYA 5HDGA 4Y7NJ 2XVCA 4AVZA 2A05A 3BCBA 2EOIA 2LCEA 4DKKA 1SVOA 2X85A 3JRDA 1X3WB 4I09A 3WG7H 2EOQA 4E7LA 1DPRA 2VBWA 4CCKA 1Y8QB 1WRJA 1P9QC 1W36D 2W85A 4IQJA 3WTWC 4NUBA 3GF2A 5BPDA 1FYMA 5TGTA 1IGNA 3SQNA 4BDYA 2DN0A 2HYGD 2JT1A 1WWXA 3KETA 1B9NA 3WGGA 2IS4A 3MZ8A 4LF4E 2VONA 3GTQJ 1XMOE 3BQZA 1A36A 2HGHA 3V8LA 3WTTC 2ZMEC 4RBOA 2N8GA 1FEXA 4M3FA 2LY1A 1ON1A 1P4WA 2V1DA 4HV6A 4IVNA 2E1MC 1YYVA 3BROA 5IPAA 2QBYB 2DOAA 2JA7J 4P78A 4CO8A 1LFBA 1QHHD 1MJBA 2R5ZB 4ZDOA 4ZDPA 3RKWA 2BHYA 3LOCA 3HOTA 2EFWA 5JI6A 2A5WA 4BU2A 4KMUX 2ELZA 2WADA 4KT6A 2EFNA 1QRYA 4RAZA 2GHFA 3L7WA 3CD6I 3Q0WA 2HTSA 2M7BA 2EMKA 4ENKA 4OWRB 5CVJA 2P7VB 2XKOA 1Z1BA 1YFHA 2FOWA 2L54A 5GAGJ 5F0HA 2VQGA 1XC5A 3QPTA 2L7FP 4DYRA 3C3WA 3OIPA 1N25A 2QQAA 2HZTA 2IJLA 2L7ZA 3IKVA 3JCUC 4ZYAA 4OIPF 2OBPA 4FETA 2VJIA 4N9HA 5A6KA 4XMYA 1YW9A 2K40A 2E72A 5M5WJ 3QYFA 1RPWA 3I5UA 5EZHA 1WJAA 1BOBA 2K9LA 1W5CC 1R1VA 1ZG3A 4HEA2 3BY6A 2L3DA 3BZ6A 2NS0A 4IPAA 2WY8Q 5ADZA 1I1SA 2UV1A 1JK2A 1LFUP 4N0BA 1IRZA 5TSEA 3KPHA 3GTPJ 3DJWA 4IRGA 2ZKZA 4HNVA 4BHCA 4XKWA 2NRAC 4E7SA 3ZQQA 4R8HA 5FB2A 4Y3OA 4HF1A 3JRFA 4LG3A 2Y2ZA 3ZN1A 4AIHA 2EM0A 3JSPA 4NC7A 2MC6A 1KU9A 4D7NA 4M73A 5K5OA 3F3XA 1S7EA 2OPTA 2E5LE 2CSHA 2WB1A 2K3FA 4PGGA 5EGOB 3ZOQB 4OOGC 4I76A 4F9BB 4L9NA 5HNHA 3CQZJ 4LF7E 4U87A 2XAFA 4C3JJ 1J9IA 1WI9A 3C2BA 2I5UA 3G1OA 2YR2A 1RIOH 2ODRD 1T4OA 1X19A 1MJAA 1W1WE 5A2QZ 4BKXA 1S9HA 1X48A 2IBDA 4TV7A 2DA7A 2Z99A 3HUGB 3Q0VA 2JPBA 2WAQA 2EQ0A 2JVAA 5D8LB 4QSHA 4RGXA 2P0WA 1APLC 1V3FA 4BBRJ 2KONA 2XB0X 2YU9J 3OMLA 5EEHA 4J00A 5LD2C 1IF1A 2STTA 4RB3C 3HIFA 2L92A 5A2QK 1T33A 3P5JA 1D1AA 3CCEI 5DS9A 2MDRA 4DUZE 1XGNA 3IWFA 4WK8F 3AG4H 2GLIA 3T1YE 3LQRA 3B02A 4DMIA 3TP3A 3R60A 1X47A 3H5RA 3QU3A 2L3JA 3BG6A 3FXJA 3F8NA 1MH3A 4HLXA 2XC7A 2GIZA 4JX6A 3PJRA 3MFKA 3J80C 3COAC 1JE8A 3CMAI 1KYWA 1FBQA 5ILSA 1S6LA 5F04A 3TO6A 2MH9A 4HSTA 2BVMA 4FQGA 2LSOA 1A1GA 3FWEA 3OV8A 4B3TE 4DR5E 3RZDJ 2PX9A 3CMYA 1A1LA 5F1JA 2DOFA 2X0LA 3WTUC 3LA7A 5B1BH 1ZYRF 3CC2I 2F8BA 2ADUA 3BG9A 4ENNA 1OJLA 3O2PE 3I64A 2CO5A 4ZYDA 4A3GJ 3BDDA 2VL8A 2RQLA 4DR1E 1Z7LA 4V19K 2WV1A 2OCEA 2WTEA 3H5AA 5DUIA 1PJTA 5KAIC 3S1NJ 1YYOA 2W00A 2EZHA 4LOCA 2DA6A 4XKVA 1JKQC 2L4AA 4AIKA 4QPQA 1B8IA 2YTOA 1CF7A 4A3CJ 5FFZA 3H9JA 3MQ0A 2E1CA 2OTJI 2EJ4A 4NHRA 2RAEA 4BQNA 1OCZH 1EF4A 2EPLX 3BP8A 4LK0F 3H92A 2LJUA 4C9YA 5K7HA 1ZELA 1WJPA 1BOAA 5D6FA 4HBLA 2VRDA 5M3FJ 1AA7A 3OR2C 1G3YA 4M9VC 2R7QA 3OYDA 3HGGA 4HX8A 4HX7A 2NNNA 2R93J 2M45A 4I7HA 3R0JA 2ZO4A 5K1YA 2EP3A 1IV8A 1X1BA 2VASA 3PQKA 3MCZA 5A6JA 4AIJA 2L9NA 3RKQA 3FZVA 2Z33A 3EYIA 3SZGA 5D5WB 2EPZA 1X3UA 2CQXA 1ORKA 1YW8A 3ZQGA 2DIXA 2XRLA 2X4HA 2AHQA 2FRHA 3F21A 3MWMA 2YX7A 4I2OA 1IW7F 2EN7A 1WHNA 4JX4A 1T0FA 4A6DA 2XPVA 2ZXIA 3CUQA 4PJJA 1VI0A 3RTRA 2M4KA 4BDZA 4XNFA 3OYKA 2CYYA 1V54H 5F3WA 2GAUA 5IV8B 1PP8F 4DBRA 4X62E 2BEOA 2VQHA 3JTGA 2EM7A 3RDIA 2K02A 3I4MJ 3OL3A 1JJ8C 2KHXA 2L01A 3LSIA 2L4MA 2KIMA 5FROA 1YRNA 1R5GA 1GQEA 1TT5B 3PL8A 3I0TA 1ZBTA 4A5MA 2EZ6A 2CG4A 1YHQI 1ZRCA 4DZPA 1D5YA 3U2RA 2LY9A 3RPUA 2Y9ZA 2WZOA 1Z3YA 2J7JA 5JHUA 2IP2A 1J75A 3F8MA 2P5VA 1JXSA 3IC7A 1YQAA 1D1CA 2ME0A 3L2RA 1OCOH 1ZREA 3MSWA 1LEAA 2L2OA 5E3OA 2UUBE 3KX2A 4RHBB 3LSHA 2X1CA 2EINH 1ZGAA 2YSRA 4NQWB 1HQCA 4XKBA 3TP0A 1IC8A 4GDFA 4R1HA 3H0GJ 2UUAE 3SZTA 4KA4A 1IN4A 3KLOA 3Q3SA 1REPC 2EBIA 1W36C 2FGGA 3DPUA 1A1JA 1QPIA 1FKAE 1VQ7I 1ZTRA 1ZG1A 1STZA 1WH7A 2X6WA 1BBGA 2EMWA 3FBIB 1RESA 2XPUA 4D5CA 2EOOA 1MBHA 4L5NC 4MGRA 3BG3A 2HJJA 2HYJA 2Z3YA 2L9SA 3K2AA 1I3AA 4M9XA 4FISA 1LE8B 4Q28A 2UXBE 3BPVA 3OYIA 2O61A 1I5ZA 5JLWA 3T0YA 4M3EA 2OD5A 4BQOA 4HG2A 2YTNA 3HSRA 4CCMA 5E3MA 4EM2A 3AV0A 2WY7Q 3CP2A 3GWZA 4II3A 4A3JJ 4R03A 1TLHB 4P9UA 1R00A 3JRHA 5AC4A 2MABA 4CCLA 1A1HA 2BW3A 5LGUA 4LG0B 4OIOF 5LL6R 2YS9A 3WGHA 4UUSA 3SZPA 2V87A 3KP5A 4G8XA 3V8JA 3I59B 2L8TA 5EEAA 1TF3A 5KAFC 2HU9A 2VQEE 3GFMA 1NH3A 4L5IA 4ENJA 2LVSA 3KE2A 3K1NA 3K4JA 4WF2A 1P2FA 3CJTB 3M8EA 3GTLJ 2EOXA 1IRGA 2L02A 4PFPA 3QG5C 4KIFA 4XK4A 1O3RA 2F4OB 3E3VA 2DT5A 2GXGA 5H6QA 3J80Z 5H2FC 1N32E 3K4NA 4XL9A 2QYOA 1VQPI 4S05A 2DTRA 2NA2A 3IHUA 4CCNA 3OIOA 1POGA 2EQRA 4XKCA 5IP7J 5KL7A 2YTDA 4YRVA 3MN2A 3NWSA 5F27A 1TQMA 3J80K 4P9FA 2PI0A 2JQ7A 3S2HJ 2O7OA 4NB5A 4HQMA 1ETOA 4HRIA 3BF2A 4BCAA 4RMNA 2UXDE 1F2IG 5ILUA 1R5HA 2B7TA 4MQVA 2JA6J 1QU3A 2LTSA 4LGWA 4PSWA 3OYHA 3M9AA 4ZYGA 1V55H 3BR1A 3DEUA 4QLCU 3S1MJ 5F64A 2EPKX 2FTXB 2ZJ2A 1NCSA 3S1RJ 2MG4A 3G73A 1ZU1A 2ZC2A 2ZBKA 3ZP5A 1MH4A 3K4CA 1T6SA 4TUIA 5M3MJ 2CQNA 2E7XA 1OLTA 2GOXB 2VOOA 2BE5F 2RNGA 2VBYA 4LIVA 1U3EM 2QSHX 3WU0A 5IOYA 5JR3A 1IRFA 2X1EA 4RS8A 3PSIA 1JUSA 5JFRA 2Q8KA 1Q1HA 2E71A 4DUYE 1T38A 1QVUA 3ABMH 1P4XA 4YIIA 3GTOJ 2H6CA 3K4LA 2FMLA 1IDZA 2ODRC 3B73A 3K0LA 2QBYA 3TQMA 4KITB 1W7PD 2RV8A 1ZQ3P 3NAUA 3W6JB 1BI2A 1B59A 4HTGA 4ITVA 1F36A 2VQLA 1TF6A 3CJRB 5IY5H 1HKTA 4X6AJ 2EM9A 3H35A 5DEQA 1KONA 2VC0A 1XMKA 3EYYA 3IRRA 1BW6A 2K7IA 4JI5E 2OQRA 2XIGA 1YO5C 5ICCA 2IA0A 4PCQA 1MNEA 2IXSA 1J09A 2E1NA 1V5FA 3PNVA 3F8FA 4JI1E 3HRTA 1D8KA 1YLFA 3IWCA 3A2KA 2H94A 2UXNA 4ZH4F 3K6QA 3IWZA 4IRIA 3T5XA 3FXKA 1X1DA 3IH4A 3CLQA 3Q9VA 2M8GX 3DTEA 2CUZA 3GVAA 2G9WA 4YY3E 1B9MA 3AAFA 2EPCA 2BV6A 2L2KB 1AH5A 3LMLA 4YIRX 5M5YJ 4KFCA 4EV0A 3OYNA 1X2NA 1Y6IA 3HOXJ 5A6BD 2WAQN 5AE2A 5J40A 2F5VA 3U21A 4CYCB 2EOSA 3C7JA 5A69A 3OOPA 1RRJA 2H36X 2YTEA 1ONVA 3S8PA 2NUFA 4QPOA 2HVRA 5DV5A 4E7ZA 3LSRA 1I6HJ 3WGIA 1VQ6I 2EL4A 3TBIA 2YTGA 1DGRM 4RAYA 2DPUA 4MTEA 4J8ZA 4Y17A 4XQFA 4LF9E 1BI0A 1R23A 1IQOA 1PJRA 3BJ6A 3NARA 2L7KA 2DA5A 3KP7A 4HV5A 2EPAA 2BXYA 3V42A 2ENHA 2LY2A 3EETA 3RYRA 2LRSA 1U0JA 2HHHE 4Y13A 3E6BA 5EGOA 1NTCA 5TJJA 1ZAAC 2ZSIB 3I3LA 1D5VA 3W2WA 1G2DC 1FP2A 2BY0A 2PQ8A 2TCTA 2IVMA 3AG2H 3HRMA 2DO7A 1XB4A 1IXSB 3L00A 5LGNA 1Z7UA 5E18F 4OAZA 2NVTJ 4M74A 4DW6A 1TWGJ 4B3ME 2XDVA 2L2MA 3H3VK 3HUGA 5C4JJ 2HOSA 3A02A 4XLNF 3H09A 5KL2A 1XNRE 2LUPB 3GW2A 2EM6A 3J81C 1ZBQA 2O6GE 5FLXC 1QVTA 3QPSA 2YSOA 1EH7A 1DU0A 4YHHE 3OS0A 4GKKE 3GZNB 3HRSA 1O4XA 3AUZA 3KP3A 2HGCA 5EJCA 5ED4A 1FC3A 1DDNA 3WE2A 3RQ4A 4P5OA 2EM3A 3J7AY 4WXDA 5E3NA 2VE7C 1A1IA 2MBFA 2QVOA 1FX7A 2XGXA 1Y0UA 3H5NA 4EGZA 4RLQA 3ECHA 2FUG2 1MMNA 2LG4A 3S3OA 3EUKL 3V7SA 2MKDA 2R1FA 3OYBA 1HR0E 1JK1A 4HOBA 2M4GA 4F3QA 5HS7A 3W6VA 1UJ8A 2QGUA 4B3SE 1N33E 2Y75A 3ZRGA 2BY2A 4DYCA 4HQEA 1WQ2A 2M4IA 2LE2A 4F6MA 3A4CA 3P9IA 3I55I 3QP5A 3B6CA 1FYLA 4BY1J 1R4MB 1S8NA 3FM3A 2EMGA 2VBZA 1U5TA 4ANJA 5HNFA 5E1XA 3CMMA 4A5NA 2CQQA 2WBMA 1UILA 5IT9Z 3RIRA 1A6IA 1JUPA 4O4KA 2FBHA 4A0YA 5LLQA 5ICEA 1IDYA 4BQAA 4OIQF 1KYZA 2ELYA 1T39A 1JTYA 2AQEA 3CCYA 4LB5A 4EATA 4IX7A 1FP1D 3I4PA 3KEYA 5DM6F 3GTGJ 3DBLB 1SMTA 3NQOA 1UFMA 1S29A 4R2AA 4BUPA 4BJTA 4R2SA 3ZMVA 4UHTA 2EMIA 2HPIA 2VIXA 2ZFUA 4HZFA 2FQ4A 4OIRF 1BR4A 2RQQA 3VDXA 4MO7A 2EV6A 3DLAA 2DLQA 2O03A 5F0FA 1I94E 2JTVA 1G6NA 4CYDA 5DTDA 3P7NA 2F48A 1DGCA 1FIPA 1GV2A 1E17A 3D5LA 3ZQHA 3OYCA 4EM0B 1IAWA 3GBGA 1FOKA 3M99B 3OWTA 1XCBA 1DI2A 2QSGX 5IYBJ 1VNDA 5FKLA 2OTLI 1ODDA 1WPKA 5IYCJ 5D5VB 3BJOA 5C3EJ 2QEXI 3CC4I 2CTDA 2EFQA 3S2DJ 4KISA 4S04A 4BE1A 3EQLF 1HXDA 3OS1A 2E1OA 5CKTA 1SR9A 4LF5E 3LMMA 4B43A 3VK6A 3FXQA 2V1UA 3V7RA 3ZMDA 3J7YJ 2HOTA 2F4IA 4DNCA 3QP6A 4CDGA 3GZ5A 4U88A 4H0EA 1ZR2A 3THOB 4X65E 4JI6E 1PP7U 3C6KA 1HBXG 1IG7A 1YW7A 2JWTA 4MFEA 5D5XB 3CDLA 2ZNYA 1SVLA 4H4KC 5HS8A 4HSRA 5FRMA 4A3IJ 2EJRA 3L1PA 1Z6TA 3JRAA 3L2UA 2QA4I 3RKXA 3ZR8X 2H8RA 4LTYA 1YOVB 2KIQA 2F2EA 2PMUA 3EUAA 1X6HA 3JU0A 3G1LA 1BL0A 3HHGA 2M1BA 4A12A 3HOUJ 1VQNI 4LJZF 2EOMA 5LHGA 3L2CA 2GWRA 4IEJA 1F9NA 2R7SA 1BIAA 4NC8A 4G9YA 2MLGA 4NBQA 1DUXC 2L33A 4DV3E 1T95A 2YRKA 1JTXA 2ETHA 4JBAA 1GXPA 4RAFA 2GQQA 2W1OA 3TOBA 3K7AJ 2NVYJ 2PJRA 3ZMTA 4NQWA 4IHSA 3SDBA 3TL4X 2GIVA 3EPJA 3DBRB 4PJLA 1NHAA 1XS9A 4LITA 1J59A 4GFBA 2HNHA 2Y31A 4JK1X 3V8KA 5IP6A 3D1NI 2R7ZJ 4A2UA 3JTZA 2N8XA 4ZYEA 3I9V2 1FOYA 1LNWA 2CV0A 2H09A 4DBQA 2CV1A 2EM4A 1HSJA 1SFKA 3G2BA 2K3PA 1BC7C 1XN7A 1OQYA 1T0FC 3CUQC 3W6KB 2XGDA 1MZBA 3E5XA 2A6TA 1MDMA 2ELKA 2P4WA 2HDCA 4L9VA 2Y0SN 1LE8A 2F5EA 1XGMA 4LLGF 1XMAA 1XTAA 3MEXA 2COMA 4ZTJA 4Y15A 2IGOA 2EQ1A 1L4SA 1E2XA 3K4BA 2PFBA 2V86A 2V89A 1OCPA 2P6TA 3J7ZI 3Q5FA 2NXNB 4BJ5C 5LMUE 4B44A 1IXCA 1L3LA 4HLYA 1KYQA 1E0EA 2KISA 3QQAA 3PIPF 4WXHA 2VPLA 1D0XA 2ELJA 1P7IA 1WJBA 2DT6A 4LG0A 5FLXZ 1Z05A 3GFIA 3I59A 4RH8A 4AVPA 2EPMX 2E2HJ 2VT2A 3HTUA 2DMUA 4EJWA 2B7EA 2V9PA 1D0YA 1H88C 1F43A 3RQIA 3J81K 2IS2A 2W84A 5FLXK 3JREA 4OINF 5IP9J 4M0VA 2XROA 5BPIA 2R7XA 2CWEA 1F4KA 3C2HA 1G8XA 1U6GA 2E5ZA 1DQ3A 1LFPA 1VQLI 1YX3A 2EWLA 4CZZA 2RSMA 3KYLA 3MKLA 2KOUA 3MZYA 2Y48A 2FBIA 3LAPA 4A69C 4GZNC 5HODA 5HLIA 3O8GA 1Y8RB 2MH2A 3GLXA 1ZLJA 3ZOBA 1ZRFA 2JUCA 2YU3A 2DAOA 4ABZA 5KK1A 4A3MJ 1Z67A 1W5TA 2XF6A 3TO7A 2D45A 4O6JA 5K7FA 4MLOA 3CJNA 5J8CA 2XAJA 2VQFE 4F9CB 4PK4A 2Z1DA 3E6DA 4ZYHA 3WTYC 1WJFA 1QGPA 2YPRA 1MBFA 1RNLA 2BVLA 3VYRB 2JSPA 2KHMA 1ULYA 5FD5A 1J0RA 1EH8A 1IZ1A 2EOZA 2N3HA 2KRCA 3JRIA 5DUKA 4F7ZA 5BS6A 1X4PA 2DJNA 4GYGA 4G6DA 4O5VA 3S17J 4D7MA 3IRQA 2ID6A 3MHHC 2D1HA 4MHGA 1JJ6C 2V8QB 3LAJA 4B3RE 3S1QJ 2Z9OA 3LWFA 4KICA 1YE9A 3DPTA 1YYWA 1X3ZB 2EOHA 2WAFA 3FF5A 3L2WA 3OSGA 1X5WA 5EF6A 2LK2A 2CFXA 4XRSA 5IT3A 1R9TJ 2VOPA 1YUIA 1ZH5A 1GT0C 2YRHA 1T4NA 2L7MP 1UHZA 5E3LA 2LF8A 2A3SA 1F1ZA 2GM4A 5EG0B 2WBSA 4L9TA 5IYDJ 4R2CA 3M3YJ 4BGDA 5FLVA 2V7FA 1EJ9A 3PFIA 1L0OC 1MBKA 1EV7A 4C2TA 4RA2A 4B09A 2HKXA 3BTCA 3OR1C 2YWQA 4BC9A 1OYWA 1H0MA 1XDSA 1RC7A 2M8EA 2EORA 4WYQB 5J3LA 1I50J 2ZB9A 3LA3A 4CHUA 3WODF 2E2IJ 4Q48A 1U5TB 2DYRH 2HWVA 1TZLA 3EPZA 3PQJA 4FE4A 2KP6A 1IBKE 1K6OA 5LMNE 2A69F 1O7FA 2KFDA 3MMYB 2ENCA 1WHQA 2ESNA 2NUEA 3RPQA 3OYAA 1SAXA 3WE3A 2EFOA 2JPAA 4PJ0C 4CUGA 3RI4A 4DR6E 2B0LA 3CUOA 3GFLA 4KN7X 4CYCA 3UK3C 4AYBN 3CF5F 5BNGA 1ZK8A 3KLNA 2ECCA 1R58A 4OOIA 1E3HA 4YELA 2EA2A 1XMQE 2NVQJ 4I98B 2W24A 1PDNC 3F9KA 1HCRA 1TP4A 3RYPA 1BBOA 2X48A 1RUOA 4NC6A 2QWWA 3GXOA 4B8XA 2V6EA 3V4GA 2BBGA 5CVUA 2ELHA 1NG7A 1TWFJ 1PKPA 2V6CA 3E5QA 4II2A 4S0HB 4U7BA 2EMAA 1LDKB 3S93A 3T1HE 4IO9F 1LEBA 1KZHA 1JKOC 3HTXA 1FBSA 1V5GA 2ME6A 2FOKA 1WJEA 2HXIA 2RNJA 2H1LA 5K5RA 2H1KA 2XRNA 5A6AA 3NEUA 5GADJ 3IWBA 2ZXWH 2B7VA 2QQ9A 4EMSA 2EMHA 2FSWA 2JOXA 4QTRA 1P92A 4U7DA 5ERIA 2K86A 1EKEA 4Q5SF 2EMCA 2E5NA 2VODA 2VKDA 4Y52J 1WJ5A 3JR9A 3S3MA 5FFXA 4W1UA 2G7HA 1Z77A 4M72A 1X6EA 1BR2A 1XSVA 3PNYA 3VFZA 1MIJA 3VWBA 3S16J 1PJSA 4PGHA 2JP9A 1Z3XA 2FEZA 1YS7A 2JMWA 4LF8E 3TOAA 4M9ZA 5BR8E 3HGYA 1ZHFA 2V9KA 2CUJA 1MMAA 4RGRA 2D2WA 2XGCA 3MKZA 2E2JJ 1N3GA 1HF0A 4DGWB 4BH9A 1AWCA 2I13A 1R1TA 1IN5A 1Z0XA 4MTDA 4Q35B 1PUEE 3RJPA 2A6EF 1U2WA 1X3CA 2BYVE 3M7GA 3GLLA 3S15J 3WTXC 1WCMJ 3BR5A 2VKVA 1VF9A 2JJ7A 4IL6C 2IHR1 4NXME 2X9DA 1T56A 1QZEA 4CSWA 2KLOA 3JAMC 5CFFE 5IWAE 1TWAJ 1IQSA 2WBTA 3AFHA 2CU7A 3LSPA 2DA1A 2R92J 2M9AA 2YUSA 3O3KA 2CV2A 4A3LJ 2I8DA 4LFCE 3X2QH 1F5TA 4RM3A 2HQAA 4M9SA 4R2EA 2PJRB 2YSPA 2FU4A 4B3XA 3BQYA 1C0WA 2NOJB 4K2EA 4RDUA 4A3DJ 3EDPA 4BC7A 2VJ4A 5IXMB 2DQLA 1SD6A 2CUEA 3HBLA 2E60A 2ISZA 2R7TA 1SVMA 4YFNF 2QQ8A 2VXZA 2EN4A 1N36E 1KQ8A 3GYHX 3C18A 3CCUI 1X4OA 3LSTA 4M6XA 1RKTA 2FBKA 3SHFA 2EILH 5F6FA 1HA8A 3PUBA 2EPOA 4XOTA 2LDUA 1MDMB 3ADLA 1V4RA 2WAEA 3LFKA 4A0ZA 4PJNA 2XB5A 1R71A 3DV8A 1FMVA 2K9QA 3OSFA 1Z21A 2IAIA 1ITYA 2GOMA 1BN5A 5J1RA 4XLHA 3D5SC 3G71I 1UN6B 3U1KA 5LEJA 1OCCH 4CICA 4UUVA 5CJ9A 1RR7A 1B6AA 2WA0A 5H6RA 3D0SA 2A68F 2CSOA 4I0AA 1TNSA 4BACA 4HDVA 5AIPA 4D9JA 2UU9E 3DWLE 4JV5E 2K9SA 1YYKA 1KU2A 3KZZA 2R7FA 2RS6A 1O3QA 4UB6C 5ILVA 2EH3A 4XICA 4P96A 3MHSC 3IV5A 4CZCA 2ACJA 1FYKA 2J5PA 1WJDA 2GA2A 1MGTA 4BXFA 4WFTA 5HLHA 3IL2A 3E6CC 5FKMA 5AONA 1W0TA 2ZJQF 4G7HF 4G7ZF 1XSXA 1LKXA 2QSFX 1U78A 1SC7A 1OMIA 4BY7J 2M5WA 1YTYA 2MKNA 1OPCA 2Y0SA 2JOBA 5JLXA 1JHHA 2QLZA 2XAUA 3CESA 4OMYA 4ENMA 2LOOA 4ESBA 1KJKA 2EOYA 5F08A 2LNBA 4Q47A 3VHTB 2ENAA 2LUQA 2RSIA 1P6RA 2MD5A 3E5UA 1GV5A 1N78A 2E36A 3UR3C 2GLOA 2ISYA 2IA1A 2XGEA 5KHDA 2RKHA 2GXAA 3LQQA 2R7WA 1S3JA 3O6BB 2JXPA 4XR6A 1AOYA 1ZARA 3FXRA 2VXDA 2XAGA 3JSOA 1A1FA 4DQ2A 4FCYA 3MD2A 4N4NB 4HX4A 2PRTA 4HNTA 2M2EA 1WGXA 2X6OA 1TL8A 2LTPA 1BC8C 2K4BA 4YG2F 2HPMA 1FSHA 1PDAA 2DMNA 4EM1A 4FTHA 1JI8A 5F0CA 2CT1A 4WX9A 3F8CA 2Z5UA 3F6VA 3VYSB 3U9GA 1XX5A 2FNAA 4DOZA 4FHTA 3ZN0A 4K0KE 3TGNA 4XLFA 3OYLA 5FKKA 3FX3A 4X0GA 2WV0A 3A03A 4AWXB 4XN3A 3GUDA 1ERDA 3JTHA 4TUGA 4BEHB 4IOCF 3HOYJ 1W5SA 2VQCA 1BI1A 3I54A 4AUXA 2R4GA 3RPUD 5B1AH 2ZSHB 1VFCA 1J26A 4X8WA 3J7AG 3FXOA 4KN4X 1YJWI 4EGYA 3ISPA 3EQ1A 2GBYA 1GLNA 3WTSC 1IMUA 3QPHA 3BR0A 3BTLA 5TRDA 3I58A 3HQ1A 2FA5A 4EJUA 2N3GA 4I02A 4D5FA 5KL6A 4RGUA 4JYAE 5GP9A 4FE7A 1TWHJ 2WWYA 5GAHJ 1LDJA 4M3GA 3W3CA 2RTXA 2JK3A 1Z91A 2HR3A 2OA4A 3DU5A 2F5FA 1TT0A 4RB0A 2QM3A 5FKNA 4XIDA 4IZZA 3AL0B 2Z2SB 1WKMA 3MAJA 4HA8A 2EQ3A 1XGSA 2EK5A 1VQ5I 2GZWA 2ESHA 2G0EA 1K61A 2BBYA 4ON0A 3OS2A 3A0BC 4I99C 3DP7A 2HC5A 4L5EA 1X58A 3K1MA 4N4OB 3L2VA 3N05A 1K7AA 4RGSA 1U9OA 3BC8A 4RB2C 1MSEC 3CDIA 3IAM2 2JYAA 3MZHA 2NUGA 2OAZA 1IXRC 4C30A 1ZAOA 5L3BA 3DKWA 2NS8A 1ZRDA 2EV0A 1IN7A 4UVAA 3MVPA 4KMFA 1N34E 1Y1WJ 4O3MA 1FZPB 4X64E 5CQEA 2XV4S 5KCMA 2JZYA 1UG0A 2BHZA 2LKXA 3JAMK 3VYUB 3SEZA 3L2QA 3I56I 4IJDA 3FXMA 5KNLA 2KZGA 2EPNA 3H1CA 1G3WA 2JA2A 5GTHC 1X2MA 4PSXA 3OTOE 4RM2A 3ZGKA 2LD5A 5J8FA 2EMZA 3OL4A 2ZM6E 2XAQA 3IP4B 5EYRA 3JRCA 1ETVA 5ICGA 2HEOA 4XOPA 1XPXA 3DKXA 2PJPA 2A6HF 1ETYA 4JP0A 4BJ6C 3REOA 1MD0A 5GTIC 5FJ8J 2O0YA 4AYBA 5L3CA 2HOAA 1SEUA 2KMUA 2R7OA 1OCTC 1YUJA 2ADRA 2HOEA 1A35A 4MFDA 1AKHB 2F5CA 5E79C 2QENA 2MW8A 2K7LA 4IQ4A 2M0CA 4PZJA 1R36A 3F23A 2EIMH 1OKRA 5B66C 5EG0A 3QYEA 4Y4RA 2EOJA 3EPHA 4C3HJ 1N75A 1UCRA 3VOEA 1XMXA 4IHVA 1MEYC 2D1VA 3HYIA 2ZMEB 4GRIA 3BOQA 1FOWA 1OYYA 2P8TA 2EZKA 3ASOH 1X6FA 2E1MB 2Y9YA 4AIDA 1QNTA 1YIOA 3KP2A 4IF4A 2D9HA 1O3SA 4ASNA 2X1DA 1IV6A 4L0YB 3WU1B 2EN8A 2CW8A 2FQ3A 1RI7A 2CQ7A 3RSNA 4BMJA 3HOVJ 1VQOI 2A25A 2YTIA 2F5DA 1H9GA 1VQ8I 3PNTA 3SFIA 1KU7A 4B1RA 5FLMJ 1IUYA 3LFUA 4C2MJ 2A5YB 3F0CA 3M8FA 2KKOA 2OJED 2CS3A 2YX4A 4ZZDA 3UKGA 5F1RA 2L0KA 2FV4B 2XHKA 2O5RA 3SJMA 2RREA 3R61A 2DMYA 2H8WA 1ZR9A 3CO7C 3L09A 1DP7P 5J4VA 4A0XA 3PIOF 1R49A 3HTSB 5FRNA 3G1MA 3P9KA 1AHDP 9ANTA 4MEYF 3HDDA 3BIDA 4M71A 3F22A 2VE9A 2VF1A 3HOWJ 5GPAA 1WSUA 3SFZA 4BHBA 2H27A 2FNPA 1H8AC 3CCQI 3PFYA 2OU2A 5LFAA 5JHFA 1PYVA 2PG4A 4V2GA 1DGWY 3KEQA 2FX0A 2PMHA 1H89C 3BTJA 5L3DA 4V2FA 4BXUA 3KZIC 3T1BA 2XUBA 4XBFA 1GVJA 2V4JC 1UZCA 1BIBA 5BOXA 1WZ2A 4Q4ZF 3MKYB 4U0WA 2MLKA 2G7UA 1FSEA 4DIQA 1XSDA 3FMRA 4R2RA 1HDPA 4GO1A 2B9DA 2YTFA 2ZXJA 1S72I 1TWCJ 1W0UA 5L3FA 4Z6YA 1CQTA 4M6VA 3M1EA 5T6JA 1STUA 2CUFA 2LKPA 5E1WA 1SFEA 2DLLA 2KL4A 2ZXHA 1B72A 3GTJJ 2DDAA 2Q1ZB 2LFBA 4U0VA 2B63J 5J1UA 2EV5A 2P81A 3F6GA 3GTKJ 3J7Yp 3LSKA 3KYCB 4HDUA 5HS9A 2EMYA 3WTVC 1A5JA 3ZMUA 4B4CA 1IBLE 4CXFA 4DV1E 2V26A 1XG1A 2P7CB 4HAMA 4F91B 3ASNH 4HEIA 1Z9CA 3EUHA 1HOMA 1K83J 3S2WA 4RB1A 1FT9A 1QO0D 1MKMA 3QWLA 2K9NA 3GO5A 4G12A 4MNUA 2Q2EA 3WHBA 1O57A 4R79A 1VQMI 1P4AA 4JI7E 3M1CA 3ZXSA 1M1EB 2PN6A 4CCJA 2RPCA 2STWA 4U0YA 4LIUA 2QQBA 3DEEA 1MMSA 5DCMB 2W7NA 2FJ1A 2EL5A 4DZJA 2WC2A 2DT7B 2RS7A 1IN8A 2FF4A 2Q0OA 4M6YA 5DCFA 1G3SA 5K7ZA 1HW5A 2XAHA 1LPQA 4A3FJ 2EPXA 4E7JA 3K1PA 4ZZLA 3A01B 2PLYA 4M3BA 3FBNB 2CW0F 2QF7A 3H36A 1FBUA 3E97A 1RR8C 2DU9A 2VJ5A 3NRVA 4B47A 1OYIA 3M4OJ 2JWOA 1FJGE 2IA2A 2EMLA 4LF6E 1UAAA 1TTYA 2PEXA 2XASA 1YJ9I 1VQKI 1HC8A 1KGSA 4XRMA 4RAGA 3GZ6A 1I27A 2FE3A 5GAEJ 3LLHA 5HOOA 4PJMA 4LFBE 4BXXJ 1T08B 2JVHA 5CLSA 4X9JA 4P7DA 2KIFA 3FK7A 2HTJA 4AC0A 3VYXA 1SD7A 3CP8A 3K9TA 2LYCA 4YIFA 3C2GA 2CGPA 2LF7A 3ULQB 3TEDA 1YSAC 5CQGA 1ACIA 4XM3A 3G6EI 3C1DA 3C6MA 2UUZA 1FJLA 2R3SA 1S7AA 5E8IA 2NOGA 2XSJC 1BM9A 1QZZA 5BMZA 4XRSG 2LMZA 4KJZA 4YFKF 5HDNA 3J81Z 4AU7A 4BBYA 5JVTA 3ADJA 4F9AB 4KT5C 1BA5A 2KRFA 1D3YA 2FMYA 3HM5A 1IJWC 3BJAA 1EA3A 1QBJA 1SANA 1UHMA 3FHNA 1MJ9A 3M8JA 4IXAA 3HJEA 3HHHA 3RZOJ 2AQFA 2HQNA 3H0DA 5IOZA 1TNTA 2DMTA 2H6BA 2DB2A 5CVIA 2ZJRF 1D0ZA 4NNJA 1MBJA 3HZJA 1D1BA 3LSGA 4UV9A 4NHJA 3LNQA 2EN6A 2JVGA 1GVDA 1U8BA 2DFEA 1U9NA 3IH2A 3HPSA 3SEQA 2I10A 3EPLA 2EWNA 2DGCA 2E7WA 2KIUA 2DK5A 2RGVA 3HOZJ 2AS5F 3OYGA 3LA2A 2O3FA 2V83A 4MLQA 4IJAA 4LU9A 2GA1A 3LSJA 2WCC3 5LEKA 4M2ZA 2AXLA 5LHIA 3DCFA 4ZDLA 3DBHB 3DFGA 2ZNZA 3DTIA 2DLKA 1T4LB 1K6YA 1UBDC 2XPWA 4F54A 2WBUA 4BE0A 4KYWA 2YRMA 2LRDA 2V85A 1Y0NA 1HSTA 2GPIA 2NS7A 4HNUA 3KWRA 2V9VA 2A61A 1SMYF 2W82A 5B3SH 1O0WA 3ADIA 1UB9A 1K78B 2M7QA 2DCEA 1R6RA 1RKWA 3TW7A 1NK3P 3OIQA 2JA5J 1Z6RA 3TO9A 3VSLA 1K4TA 1D8JA 2KZVA 2X6XA 3BR6A 1DPUA 4EJOA 3CCJI 1TW2A 2YU8A 1ZGJA 3ML6A 2DYSH 1USTA 2IS1A 2OCCH 5DD4A 2LBSB 2CW7A 3PO2J 1JT0A 4XSZF 2LJHA 1ETKA 1PUFB 1JKPC 4E7IA 1WXRA 1LVKA 5CYVA 1UG2A 2ZCWA 3DU6A 1G2FC 4P1WA 1G4DA 3DQVC 4LFUA 2UZKA 1UHSA 1XDUA 4EJVA 3HRUA 4E6KG 4BEHA 5FGMA 2YU5A 3W2AA 1Y39A 1XCVA 3FDYA 3ZMSA 4N4RB 5AASA 4KWYA 4XONA 2EPRA 4F55A 2LBFB 2DFIA 2DODA 4EQQA 1WJCA 2VB6A 3KZYA 1VTNC 1IRXA 4ESJA 1SD4A 2K27A 1MMGA 3CDHA 2COBA 4DV7E 1OR7A 1W4MA 3S14J 4HPQA 2MGQA 5AE1A 4UVCA 5HDKA 3A1YA 2DFHA 4YEJA 1GDTA 2OZ6A 3KP4A 5L3GA 1Z1DA 3K70D 4L18B 2R7UA 2CFOA 2O8KA 3ZPLA 2QKLB 4Z2YA 4KHPE 4OAYA 1R1UA 4R8OA 1FIAA 1JUMA 2M87A 2XKPA 4JI8E 4I8OA 3FKJA 2F6CA 4GYIA 4C3IJ 5C44J 1Q1VA 2DMIA 2LREA 4LLLA 3FMQA 4G6TB 4DV6E 2E19A 2EIKH 5E1ZB 3F6HA 4D0PA 3HPGA 3L9FA 3BPXA
chains in the Genus database with same CATH topology
2IW5A 1QQIA 3VODA 4LB6B 1HW1A 2EA4A 1EH6A 2K4JA 4DV2E 3TDZC 2M1SA 2KJBA 2HFHA 2M30A 1ZG5A 1SFXA 2HKOA 4WSPA 2RC4A 2PBIA 4OMZA 3FM5A 1TQIA 3K2ZA 4EJTA 5DD8A 5AE3A 1U8RA 2W25A 3HSFA 2P5KA 2DI3A 4JQFA 3CTAA 4UXNA 4N9IA 1FPQA 1IBME 1O7LA 4HF0A 1H9TA 3ECOA 5DDGA 1FNNA 4DR4E 1X49A 2ZMEA 3I53A 2IPQX 2E1MA 4DR7E 1J7KA 2A07F 1RUNA 2YZTA 2DSYA 2RQPA 1T2KA 5K5QA 4GCVA 1FY7A 4MQ9F 3ABTA 2IRFG 1LJ9A 3GFJA 5AIQA 4KIBA 3P1XA 1J5EE 1W7PA 4FX4A 1K79A 4KNYA 4M30A 3N97A 2LTRA 3F8BA 1YZ9A 3QRFF 3VYYA 2HQRA 4BS9A 4FT8A 2KJCA 1YS6A 4GGGA 4CGZA 1HW2A 5EEGA 3ROUA 2EB7A 3F72A 2OZUA 4HYEA 1SFUA 2UWMA 2CPNA 1S7OA 4G94A 3TQNA 4BYYA 5L3EA 4JI3E 4WPYA 2QZ8A 1U5TC 3HPZA 5DNYA 3DXJF 2J5OA 2VT3A 2P6SA 3ZQ7A 4MEXF 4DV4E 2V88A 2VE8A 4JI0E 2QUFA 4UVBA 2CQKA 1KA8A 2L6MA 1TQPA 4LD5A 5IT9C 1R7JA 4OX9E 4DR3E 2UXCE 4GXOA 5KVRA 2UUCE 2DBBA 1ON2A 4ETSA 5H20A 4UNOA 5DCMA 4UV8A 3CLOA 2HYFA 3RKYA 1FLIA 3QOPA 3T8RA 2W57A 5D4SA 3J7AO 4LLNA 3I71A 3V7CA 4E70A 3HOSA 2MA3A 2HS5A 4G6QA 5E8GA 5ICFA 1IN6A 3R4KA 4I01A 1R22A 4KZSA 2IT0A 5FO5A 1HNXE 2NNYA 1LB2A 3HSEA 4ESFA 2NAZA 3C4BA 2TDXA 3VEPA 3CO6C 1T98A 3FXUA 3DF8A 2JR1A 1I6XA 3GX4X 4DR2E 1O3TA 1CGPA 4FX0A 4G7OF 1TW3A 1SD5A 1KQ9A 5CVRA 3IWDA 2VN2A 2FXAA 3IKTA 1XD7A 3ELKA 1QU6A 2K4VA 3KP6A 1XNQE 1LVAA 6PAXA 4JI2E 4LMYA 4L9JA 3JAMZ 2MC5A 4BHPA 3VB2A 1I1GA 1LDDA 4WCGA 1UHWA 2EFPA 4LK1F 2DQRA 1BI3A 2C6YA 1KU3A 4KIGA 4IRHA 4X66E 1J2XA 2V79A 2UXXA 2RN7A 1K78A 1CF7B 4NXNE 3WTZA 2DW4A 5LBQA 3FIGA 1USSA 5HLGA 3E6MA 3KFWX 4HF2A 4GKJE 5LGTA 4GEQB 3JW4A 3RMPA 3DPLC 3GEZA 4A6EA 4BAYA 3ABUA 1JHFA 3TDUC 1HKSA 3SXYA 1GZ6A 4AQYE 3FMSA 1GHCA 2DPDA 2BGCA 2RDPA 4XRFA 1YG2A 3HXLA 4DV5E 1HNZE 2P5LC 2O8XA 1G3TA 1ZN2A 3P9CA 3CUQB 1EKZA 3R0AA 2ZFWA 5J6XA 4KUMA 1BBYA 3H3UA 2V1XA 4DV0E 3K69A 2JRTA 2L3CA 3C4TA 3G3ZA 1TBXA 1HNWE 3KEOA 4BNCA 2NYXA 4HW0A 1W7PB 4WWCA 5LHHA 4QWQA 3F6OA 3H3ZA 5HVQC 3ERED 3QU6A 4WXCA 4YFXF 5DYMA 4XSXF 1RZ4A 4OU0A 2Y0MA 5FD6A 3QAHA 4PDKA 1GXQA 2DK8A 1QPMA 5IT9K 4AD9A 3Q9SA 5A2QC 2JPCA 2OQGA 5D6EA 2YT4A 1ZLKA 1HKQA 4XLPF 1B1BA 2VC1A 2L2NA 5D8KB 2MC3A 5LRRA 5D4RA 3ADGA 1A04A 2R7DA 3R6SA 5BQTA 3ZMZA 1RQ0A 4P55A 2F4VE 4EVIA 3T8TA 4L8NA 1BJAA 1JGSA 1FWZA 3WG9A 4L5JA 3FHZA 4KDPA 5E17F 4IHTA 2B3TB 1KQ0A 1B4AA 2GXBA 4LFAE 3U1DA 2RVCA 4L0ZB 3KCCA 1XGOA 5LRSA 3N4MA 2VBXA 3BWGA 5E20A 1J5YA 4JI4E 2JY9A 4I0BA 3DF6A 3TKYA 5D5UB 1LQ1A 2JSCA 5HDGA 5CVVA 1QZYA 4DKKA 2XVCA 4I09A 1DPRA 2VBWA 1WRJA 2W85A 3WTWC 3GF2A 5BPDA 1FYMA 3SQNA 2HYGD 2JT1A 1WWXA 3KETA 1B9NA 3WGGA 4LF4E 2VONA 1XMOE 3V8LA 3WTTC 1ON1A 1P4WA 2V1DA 4HV6A 4IVNA 1YYVA 3BROA 2QBYB 4P78A 4CO8A 1MJBA 3RKWA 3HOTA 2EFWA 5JI6A 4KMUX 2EFNA 4RAZA 3L7WA 2HTSA 4ENKA 5CVJA 2P7VB 2XKOA 1YFHA 2L54A 3QPTA 3C3WA 2QQAA 2HZTA 2IJLA 3IKVA 4OIPF 2OBPA 4N9HA 1YW9A 3I5UA 1R1VA 1ZG3A 5ADZA 3BY6A 2L3DA 3BZ6A 2NS0A 4IPAA 1I1SA 4N0BA 3DJWA 4IRGA 2ZKZA 4BHCA 2NRAC 4R8HA 5FB2A 4HF1A 4M2ZA 3ZN1A 4AIHA 2MC6A 3JSPA 1KU9A 4M73A 5K5OA 3F3XA 2E5LE 4PGGA 3ZOQB 4OOGC 4F9BB 4L9NA 4LF7E 2XAFA 1J9IA 1WI9A 2YR2A 1RIOH 2ODRD 1T4OA 5A2QZ 1MJAA 1X48A 4TV7A 2Z99A 2JPBA 2JVAA 5D8LB 4RGXA 1V3FA 2KONA 3OMLA 5EEHA 2STTA 1IF1A 2L92A 4RB3C 3HIFA 5A2QK 2MDRA 4DUZE 1XGNA 3IWFA 4WK8F 3T1YE 3LQRA 3B02A 4DMIA 3R60A 1X47A 3QU3A 2L3JA 3F8NA 4HLXA 3MFKA 3J80C 3COAC 1JE8A 1KYWA 1FBQA 5ILSA 1S6LA 3TO6A 2MH9A 2LSOA 4B3TE 3FWEA 3OV8A 4DR5E 2X0LA 3WTUC 3LA7A 1ZYRF 2F8BA 2ADUA 4ENNA 3O2PE 3I64A 2CO5A 4ZYDA 3BDDA 4DR1E 2WTEA 5DUIA 1YYOA 2L4AA 4AIKA 1CF7A 5FFZA 3MQ0A 2E1CA 3BP8A 4LK0F 3H92A 1BOAA 5D6FA 4HBLA 1G3YA 4HX8A 4HX7A 2NNNA 2M45A 4I7HA 3R0JA 2ZO4A 5K1YA 3PQKA 3MCZA 4AIJA 3FZVA 2Z33A 3EYIA 5D5WB 1X3UA 1YW8A 2DIXA 2X4HA 2FRHA 3F21A 3MWMA 2YX7A 4I2OA 1IW7F 1WHNA 1T0FA 4A6DA 3CUQA 3RTRA 2CYYA 5F3WA 2GAUA 1PP8F 4X62E 2BEOA 3JTGA 3RDIA 2K02A 2KHXA 2L01A 2L4MA 2KIMA 1R5GA 1GQEA 3I0TA 1ZBTA 4A5MA 2EZ6A 2CG4A 1ZRCA 3U2RA 3RPUA 2WZOA 5JHUA 2IP2A 1J75A 3F8MA 2P5VA 1JXSA 3IC7A 1YQAA 1ZREA 3MSWA 1LEAA 2UUBE 1ZGAA 2YSRA 1HQCA 4R1HA 2UUAE 3SZTA 4KA4A 1IN4A 3KLOA 1REPC 2FGGA 1FKAE 1ZG1A 1STZA 4L5NC 4MGRA 2Z3YA 4M9XA 2UXBE 4Q28A 3BPVA 2O61A 1I5ZA 3T0YA 2OD5A 3HSRA 4EM2A 3AV0A 3GWZA 4R03A 1TLHB 4P9UA 1R00A 5LGUA 4LG0B 4OIOF 5LL6R 3WGHA 3SZPA 2V87A 3KP5A 4G8XA 3V8JA 3I59B 2L8TA 2VQEE 3GFMA 4L5IA 4ENJA 3KE2A 3K1NA 4WF2A 1P2FA 3M8EA 1IRGA 2L02A 4KIFA 1O3RA 3E3VA 2DT5A 2GXGA 5H6QA 3J80Z 1N32E 2QYOA 4S05A 2DTRA 2NA2A 3IHUA 1TQMA 3J80K 4P9FA 2PI0A 4NB5A 4HQMA 2UXDE 4BCAA 5ILUA 1R5HA 2B7TA 4MQVA 2LTSA 4LGWA 3M9AA 4ZYGA 3DEUA 4QLCU 5F64A 2FTXB 2ZJ2A 3G73A 2ZBKA 3ZP5A 4TUIA 1T6SA 2E7XA 2VOOA 2BE5F 2VBYA 1U3EM 3WU0A 5JR3A 1IRFA 4RS8A 5JFRA 2Q8KA 1Q1HA 4DUYE 1T38A 1P4XA 4YIIA 2H6CA 2ODRC 2FMLA 3B73A 3K0LA 2QBYA 1W7PD 2RV8A 3W6JB 1BI2A 1B59A 1HKTA 5DEQA 2VC0A 3EYYA 1XMKA 4JI5E 3IRRA 2OQRA 2XIGA 1YO5C 5ICCA 2IA0A 4PCQA 2E1NA 4JI1E 3F8FA 3HRTA 1D8KA 1YLFA 3IWCA 2H94A 2UXNA 4ZH4F 3K6QA 3IWZA 4IRIA 3T5XA 3Q9VA 3GVAA 2G9WA 4YY3E 1B9MA 3AAFA 2L2KB 2BV6A 3LMLA 4KFCA 4EV0A 5AE2A 3C7JA 3OOPA 2H36X 1ONVA 2NUFA 5DV5A 3WGIA 4RAYA 4J8ZA 2DPUA 4MTEA 4Y17A 4LF9E 1BI0A 1R23A 3BJ6A 3KP7A 4HV5A 3EETA 3RYRA 2LRSA 2HHHE 4Y13A 3E6BA 5TJJA 1D5VA 1FP2A 2PQ8A 2IVMA 3HRMA 2DO7A 1XB4A 5E18F 1IXSB 3L00A 1Z7UA 5LGNA 4M74A 4B3ME 2L2MA 3HUGA 3H09A 4XLNF 1XNRE 2LUPB 3GW2A 3J81C 1ZBQA 2O6GE 5FLXC 1EH7A 4YHHE 4GKKE 3HRSA 3AUZA 3KP3A 2HGCA 5ED4A 1FC3A 1DDNA 3WE2A 4P5OA 4WXDA 2VE7C 2MBFA 2QVOA 1FX7A 2XGXA 1Y0UA 4EGZA 3ECHA 3V7SA 1HR0E 4HOBA 5HS7A 4B3SE 1N33E 2Y75A 4HQEA 1WQ2A 2M4IA 2LE2A 3P9IA 3QP5A 1FYLA 1S8NA 3FM3A 2VBZA 1U5TA 5E1XA 4A5NA 1UILA 5IT9Z 3RIRA 2FBHA 4A0YA 5LLQA 5ICEA 4BQAA 4OIQF 1KYZA 1T39A 4LB5A 1FP1D 3I4PA 3NQOA 1SMTA 1UFMA 1S29A 3ZMVA 4UHTA 4HZFA 4OIRF 2EV6A 2O03A 1I94E 2JTVA 1G6NA 4CYDA 3P7NA 1E17A 3D5LA 4EM0B 1IAWA 1FOKA 1XCBA 1DI2A 1ODDA 5D5VB 3BJOA 2EFQA 4S04A 3EQLF 1HXDA 1SR9A 4LF5E 3VK6A 3FXQA 2V1UA 3V7RA 3ZMDA 4DNCA 3QP6A 4CDGA 3GZ5A 4U88A 4H0EA 4X65E 4JI6E 1PP7U 1HBXG 1YW7A 5D5XB 2ZNYA 5HS8A 2EJRA 1Z6TA 3RKXA 4LTYA 2F2EA 2PMUA 3JU0A 3HHGA 2M1BA 4A12A 4LJZF 5LHGA 3L2CA 2GWRA 1F9NA 1BIAA 4G9YA 2MLGA 1DUXC 2L33A 4DV3E 2ETHA 4JBAA 1GXPA 2GQQA 3TOBA 3ZMTA 4NQWA 4IHSA 2GIVA 1NHAA 1J59A 3V8KA 4JK1X 4A2UA 3JTZA 4ZYEA 1LNWA 2H09A 1HSJA 1BC7C 1XN7A 3CUQC 3W6KB 1MZBA 3E5XA 1MDMA 2P4WA 2HDCA 4L9VA 2F5EA 1XGMA 4LLGF 1XMAA 3MEXA 2COMA 4Y15A 1E2XA 2V86A 2PFBA 2V89A 2P6TA 3Q5FA 5LMUE 1IXCA 1L3LA 4HLYA 4WXHA 4LG0A 5FLXZ 1Z05A 3GFIA 3I59A 4AVPA 2VT2A 3HTUA 4EJWA 3J81K 2W84A 5FLXK 4OINF 4M0VA 2XROA 5BPIA 2CWEA 1F4KA 1U6GA 1DQ3A 2EWLA 4CZZA 2RSMA 2KOUA 3MZYA 2Y48A 2FBIA 3LAPA 5HLIA 2MH2A 3GLXA 1ZLJA 1ZRFA 2YU3A 2DAOA 5KK1A 1W5TA 3TO7A 2D45A 4O6JA 3CJNA 5J8CA 2XAJA 2VQFE 4F9CB 3E6DA 4ZYHA 3WTYC 2YPRA 1QGPA 1RNLA 1ULYA 5FD5A 1J0RA 1EH8A 1IZ1A 2N3HA 5DUKA 4F7ZA 5BS6A 4GYGA 4G6DA 4O5VA 3IRQA 2D1HA 4MHGA 2V8QB 3LAJA 4B3RE 2Z9OA 3LWFA 4KICA 3DPTA 1YYWA 3FF5A 2CFXA 2VOPA 5IT3A 1ZH5A 1T4NA 1UHZA 2LF8A 2A3SA 1F1ZA 4L9TA 3PFIA 1L0OC 1EV7A 4B09A 2HKXA 4BC9A 1OYWA 1H0MA 1XDSA 1RC7A 2M8EA 4WYQB 3LA3A 4CHUA 3WODF 4Q48A 1U5TB 2HWVA 3PQJA 1IBKE 1K6OA 5LMNE 2A69F 1O7FA 1WHQA 2ESNA 2NUEA 3RPQA 1SAXA 3WE3A 2EFOA 3RI4A 4DR6E 2B0LA 3CUOA 3GFLA 4KN7X 3KLNA 4OOIA 1R58A 1XMQE 2EA2A 4I98B 2W24A 1PDNC 3RYPA 1RUOA 2QWWA 3GXOA 4B8XA 3V4GA 5CVUA 2ELHA 1PKPA 2V6CA 3E5QA 4U7BA 1LDKB 3T1HE 1LEBA 3HTXA 1FBSA 2FOKA 2RNJA 5K5RA 2XRNA 3NEUA 3IWBA 2B7VA 2QQ9A 4EMSA 2FSWA 2JOXA 4U7DA 1P92A 5ERIA 2K86A 4Q5SF 2VODA 5FFXA 2G7HA 4M72A 1XSVA 3VFZA 4PGHA 2FEZA 1YS7A 4LF8E 3TOAA 4M9ZA 5BR8E 1ZHFA 4RGRA 2D2WA 4BH9A 1AWCA 1R1TA 1IN5A 4MTDA 1PUEE 3RJPA 2A6EF 1U2WA 2BYVE 3M7GA 3WTXC 4NXME 2IHR1 3JAMC 5CFFE 5IWAE 3O3KA 4LFCE 1F5TA 4M9SA 2FU4A 1C0WA 4K2EA 4BC7A 3EDPA 2DQLA 1SD6A 2ISZA 4YFNF 2VXZA 1N36E 1KQ8A 3GYHX 3C18A 3LSTA 4M6XA 2FBKA 3SHFA 5F6FA 2LDUA 1MDMB 3ADLA 1V4RA 3LFKA 4A0ZA 3DV8A 1BN5A 5LEJA 4CICA 4UUVA 5CJ9A 1B6AA 5H6RA 3D0SA 2A68F 2CSOA 4I0AA 1TNSA 4HDVA 5AIPA 2UU9E 4JV5E 1YYKA 1KU2A 3KZZA 2R7FA 2RS6A 1O3QA 5ILVA 4P96A 2ACJA 1FYKA 2J5PA 2GA2A 1MGTA 4WFTA 5HLHA 3IL2A 3E6CC 5AONA 4G7HF 4G7ZF 1XSXA 1U78A 1OMIA 2M5WA 1YTYA 1OPCA 2JOBA 1JHHA 2QLZA 4OMYA 4ENMA 4ESBA 2LNBA 4Q47A 2LUQA 1P6RA 2MD5A 3E5UA 2ISYA 2IA1A 2RKHA 3LQQA 1S3JA 3O6BB 1AOYA 1ZARA 3FXRA 2XAGA 3JSOA 4DQ2A 4HX4A 1BC8C 2K4BA 4YG2F 1FSHA 4EM1A 4WX9A 3F8CA 2Z5UA 3F6VA 3U9GA 2FNAA 4FHTA 3ZN0A 4K0KE 3TGNA 3FX3A 2WV0A 4AWXB 3GUDA 3JTHA 4TUGA 1W5SA 3I54A 1BI1A 1J26A 4X8WA 3J7AG 4KN4X 4EGYA 3ISPA 3WTSC 3QPHA 5TRDA 3I58A 3HQ1A 2FA5A 4EJUA 2N3GA 4I02A 4RGUA 4JYAE 2WWYA 1LDJA 2RTXA 1Z91A 2HR3A 2OA4A 2F5FA 4RB0A 2QM3A 1WKMA 3MAJA 4HA8A 1XGSA 2EK5A