2G7HA

Structure of an o6-methylguanine dna methyltransferase from methanococcus jannaschii (mj1529)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
167
structure length
167
Chain Sequence
MIIQIEEYFIGMIFKGNQLVRNTIPLRREEIFNFMDGEVVSNPEDEHLKVAEIILKLYFAEIDDKKVRELISYKLEVPEFTKKVLDIVKDIEFGKTLTYGDIAKKLNTSPRAVGMALKRNPLPLIIPCHRVVAKNSLGGYSYGLDKKKFILERERLNMVSFKFNKVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies of MJ1529, an O(6)-methylguanine-DNA methyltransferase
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
total genus 20
structure length 167
sequence length 167
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2006-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2g7hA02
3.30.160.460 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2g7hA01
4RB1A 2A3SA 4A5MA 4ZZDA 1BJAA 2TDXA 5D4RA 4EM0B 3V8KA 2A61A 4UHTA 1SMTA 2M87A 5JR3A 4U7DA 3CTAA 2XAHA 1O7FA 1V3FA 4RAZA 2PBIA 5FO5A 5D8LB 4G8XA 4KMFA 1I1SA 2FOKA 3RKWA 3LA3A 2DW4A 4I98B 3DV8A 1IUYA 3HRUA 4WCGA 4U0VA 3I53A 2MC3A 2K4BA 3NRVA 1E17A 2O03A 2QZ8A 5JHUA 1B59A 4LB6B 1KU9A 1HW1A 4IPAA 5CVVA 4BNCA 1MJBA 2O8XA 1R1UA 3FX3A 3RI4A 3FM5A 5LGUA 4D0PA 1G6NA 1F5TA 3QAHA 4EJWA 4HBLA 4GO1A 1XGOA 5D6EA 2H6CA 1IZ1A 3WTZA 3I54A 3K69A 4Y15A 3ZPLA 3R61A 3DF8A 2P8TA 1PUEE 1I27A 2QM3A 2M30A 4UNOA 3P9CA 3IHUA 2NRAC 2WV0A 4FHTA 3REOA 4EGZA 1EH7A 3HRTA 1QQIA 1BI3A 4EVIA 4BQAA 2X4HA 1HW2A 3CO7C 3JSOA 2LDUA 2KIFA 4CGZA 1EH8A 2Z5UA 2JZYA 2XKOA 2EFNA 2VT3A 4AIKA 1I6XA 2P5VA 2C6YA 1XMAA 1IN5A 3E5QA 5CVJA 3JTHA 3PFIA 4CDGA 4I09A 3HOSA 3P9KA 2ZNZA 2FBHA 1P4WA 2YX4A 2ZMEB 3KP4A 2CO5A 4G9YA 4WXHA 1HKSA 3ISPA 3VB2A 3I58A 1WKMA 4MHGA 2G7UA 3HRMA 4A6EA 2DT5A 4WK8F 3N97A 2A6HF 5D4SA 4I2OA 3M9AA 4ASNA 5L3CA 1JE8A 2K02A 5BQTA 3L7WA 4P9UA 4OMYA 4LK1F 5BMZA 4BHPA 3M8EA 1WI9A 2A68F 1S8NA 2Z99A 1A04A 2UZKA 3QU3A 1LB2A 3I59A 4MGRA 5J8CA 1UB9A 1JGSA 3COAC 3CUQA 1KA8A 4IJAA 4Q5SF 2F5EA 2PEXA 4ZYHA 2ELHA 3IKTA 4O5VA 2EV0A 5AONA 1R58A 4OIPF 3KP5A 2DQLA 2LKPA 4U7BA 2EFWA 2H09A 4ZYEA 1U2WA 1LQ1A 3F8MA 2JTVA 2NYXA 4OINF 3EDPA 4GYIA 3HSFA 3B73A 4XLNF 1ZN2A 4EQQA 3WTTC 1TLHB 4U0YA 1U8RA 2J5OA 2HGCA 3LAJA 2Y75A 1RUOA 1G3WA 3GEZA 5F1RA 1FYLA 2AXLA 4AD9A 3V4GA 1VTNC 3SZTA 1BIAA 4P9FA 3RJPA 3WTYC 4ENKA 3KP3A 2O61A 3CJNA 2HKXA 1TNSA 1O57A 4ETSA 1WQ2A 3WTWC 4HLXA 2QQAA 4WX9A 3HSRA 1ZARA 2RDPA 3QP5A 4KDPA 1FSEA 4Q4ZF 2GQQA 1FNNA 1G3SA 5FD5A 3TGNA 3PQKA 5HS8A 4RGRA 4GXOA 3E5UA 3M1EA 1YS7A 2XAFA 4UUVA 3GX4X 3WTUC 1XDSA 2XKPA 1OMIA 3EYIA 2XRNA 2OZ6A 1IXCA 2JPCA 2RV8A 4Q48A 5J6XA 3K2ZA 1P6RA 1FY7A 1UHWA 4PGHA 4QWQA 3FZVA 3MZHA 2V1XA 3U9GA 3CLOA 2DK8A 3RPUA 4MQVA 5DEQA 4L0ZB 2P6SA 1W7PD 4A5NA 4OIRF 4RGSA 3ZMDA 4XLPF 1JXSA 1QO0D 5E17F 1KYZA 4L5IA 1S3JA 2Y0MA 4R1HA 5J8FA 2LF8A 2CW0F 3R0JA 1ZRCA 2ESHA 3M8FA 2ADUA 3ZQ7A 1PP7U 4G7HF 4L9VA 1L0OC 5K5OA 3E6BA 3W6JB 4A0YA 4LLLA 4HQMA 5FLXZ 5A2QZ 2H6BA 3GVAA 4M9ZA 2RGVA 4HQEA 4MTEA 3J81Z 1YW9A 4HZFA 2L02A 2Q0OA 1IW7F 3E6CC 3E3VA 1OR7A 2Q8KA 1O3TA 3BJAA 2ZO4A 1KQ9A 2P5KA 5BS6A 1P2FA 2ZCWA 3IWZA 1TQPA 2IA0A 1XSVA 4YFNF 5DCFA 2K27A 3I59B 4UV9A 3FM3A 2DLLA 2H27A 3JTGA 2PMHA 3IKVA 4M6XA 1K6OA 2QBYA 2IPQX 2ACJA 3OOPA 3IRRA 3TO7A 1IXRC 2EFOA 5E20A 1AOYA 1SD6A 3J80K 2OAZA 4I0AA 3HRSA 1IRFA 4UV8A 2KJCA 4L18B 4L0YB 1TQIA 3I71A 3HTSB 3DEUA 3O3KA 1J59A 1XMKA 3FXQA 3MCZA 2EA2A 2E7WA 4HX8A 5E1WA 2PFBA 1Z9CA 2JPBA 1SD7A 4MQ9F 1XB4A 5LHGA 5D5VB 3QPTA 2D1HA 4P55A 1GHCA 2W57A 4DNCA 2DQRA 3L00A 3P9IA 5ERIA 4YIFA 3DQVC 1USTA 2BV6A 1T39A 3FF5A 2QQ9A 2STTA 1OYWA 1Z91A 2L4AA 1Z7UA 3ZMUA 1K79A 4BAYA 1XDUA 1UCRA 4MEXF 1GVJA 1WRJA 2VONA 4EV0A 1O3SA 3KZZA 3O6BB 1X3UA 2OQRA 2PLYA 2A69F 3WG9A 5FLXK 5A2QK 2NAZA 5IT3A 2XGXA 1BI0A 4EJVA 1ON1A 2QENA 5ILVA 3GFIA 3T1BA 4NHJA 4XBFA 3BROA 4UVCA 2F2EA 3DKWA 3J80Z 5KVRA 2ZNYA 1BC7C 2NNYA 3RDIA 2CQKA 5ILUA 5BOXA 5E8IA 1TW2A 1J2XA 3RYRA 3F8FA 2K7LA 2D2WA 3BOQA 1ZGJA 2YSRA 5LHIA 2IA2A 4LGWA 3C7JA 3QOPA 3V7RA 1DP7P 1NHAA 3GYHX 1W7PB 2RNJA 3RKXA 2FE3A 1YS6A 4ON0A 2O6GE 1Z05A 1O3QA 4Y13A 5F64A 1QZYA 2KKOA 2DFIA 2P6TA 4KIGA 1HSJA 1R1TA 4GYGA 1D8JA 1R5GA 5F6FA 3EUHA 3ECHA 3F22A 3RPQA 2CG4A 2M5WA 3TDZC 2RQPA 4LB5A 3BWGA 3R4KA 1J7KA 1TW3A 2HYFA 2V1UA 3C3WA 4A2UA 1XCVA 1J9IA 1SFEA 1XCBA 4L9TA 2BE5F 2HTSA 4Y17A 3MZYA 1CF7A 4HDUA 4MEYF 4TV7A 1YW8A 3R6SA 3MQ0A 1OKRA 4KFCA 1IAWA 4OU0A 4IRIA 3F6VA 2BEOA 3SZPA 4OOIA 2O3FA 3HIFA 4LMYA 1PP8F 1YFHA 4I7HA 2KJBA 4EJUA 3FHZA 3T5XA 2HQNA 4R79A 3LSTA 5HLGA 3K1MA 3C1DA 4XSXF 3DPLC 2VN2A 1YTYA 3ZN0A 4I01A 3EETA 1IN7A 5ICEA 2ETHA 2XAJA 4F7ZA 1E2XA 1CGPA 1ZRFA 1HW5A 1MDMA 3VEPA 4HW0A 3BZ6A 2XVCA 2DI3A 4IRGA 2DBBA 1O7LA 3HTUA 2HR3A 2YX7A 3U1DA 4OIOF 2K86A 1BBYA 6PAXA 4S04A 3GWZA 1K7AA 4M74A 2D45A 3LWFA 5CJ9A 2EV5A 2LF7A 4HF1A 2J5PA 2M45A 2XIGA 3KCCA 2VC0A 3H3UA 5JFRA 2FNPA 2ISYA 1ZRDA 4CYDA 3LAPA 5D5XB 1H9GA 5L3FA 2RKHA 3LA7A 4G6DA 2CYYA 3QP6A 4HX7A 5TRDA 3F6OA 1YW7A 2QLZA 2IA1A 5HLHA 3QRFF 4HF2A 3S2WA 1AWCA 4HX4A 3CUOA 4U0WA 2FF4A 3KLNA 3WGHA 4UVBA 3MWMA 1QBJA 1XGNA 1J75A 2RN7A 4ZH4F 2IT0A 4XRFA 4ZYDA 3V7CA 4YG2F 2DU9A 2E1NA 4RAYA 1L3LA 2WC2A 3F8BA 2FMYA 5HOOA 1HKTA 4ENMA 3QPHA 3SFZA 3JAMK 3CO6C 1OYYA 3F8NA 1BM9A 1T0FA 4OMZA 4KICA 2B0LA 3J81K 2FMLA 3CDHA 3T0YA 1LJ9A 4ESBA 1MJ9A 3NEUA 2L54A 3F23A 4A0XA 4CICA 4CZZA 3BPXA 3TO9A 4EJOA 4E70A 1HBXG 2QVOA 3OV8A 1S6LA 2JT1A 4EMSA 3GFMA 2Z3YA 2IRFG 3WTXC 2ESNA 1GXQA 2CGPA 3K1PA 3WTVC 3D0SA 1U78A 1ZG3A 2X0LA 5DCMA 3ABTA 3WODF 1TTYA 3GW2A 4M72A 5AIQA 4CO8A 2EV6A 2IJLA 3I64A 4KN7X 2FNAA 3TQNA 2YU3A 1QZZA 1TBXA 5LBQA 2VOOA 4IHTA 1HXDA 2HZTA 4YFKF 1U5TB 3Q9VA 1RI7A 1I5ZA 4KMUX 3BDDA 3TOBA 2W84A 2P5LC 4HYEA 5LGNA 3K1NA 2Q2EA 1F4KA 1FLIA 3GO5A 1ODDA 4WXDA 4GGGA 4RB3C 1YIOA 2STWA 1U6GA 3C18A 2NNNA 2QBYB 3DPTA 3L2CA 2EJRA 4ESFA 4A0ZA 2HYGD 3ELKA 3GFJA 2PG4A 2M1BA 1FYMA 4ENJA 3Q5FA 1G4DA 2A5YB 4LG0A 4G6QA 5EEGA 4EGYA 5LHHA 2XROA 2KRFA 2VODA 4FX0A 4WF2A 2HEOA 1XN7A 3JW4A 1RIOH 2RC4A 5L3DA 3EQLF 3MAJA 3EYYA 5L3GA 4PGGA 2F5DA 1UFMA 2V79A 3RKYA 5HDNA 5LRSA 1RZ4A 4KT5C 3Q9SA 4L9JA 5KK1A 3KE2A 4Z2YA 2OZUA 2HKOA 2MH9A 1W7PA 1FT9A 3QU6A 5DUKA 1B9NA 3FXRA 1SFXA 2GA2A 4KNYA 2PQ8A 2VBXA 1LNWA 1FP2A 4R8HA 4EJTA 5ICFA 3V8LA 1REPC 3TO6A 5HVQC 1V4RA 1IN8A 3F8CA 2L4MA 5H6RA 4CHUA 1FBSA 2BYVE 2HQRA 2ZBKA 1BIBA 3FMSA 5HDKA 3IWFA 5K5RA 2DTRA 1G3YA 5L3EA 2LSOA 1XGSA 4G7ZF 1ZG5A 3HUGA 3F21A 1IF1A 5K1YA 3WE3A 4BH9A 3ZMVA 3HOTA 3JSPA 4I0BA 1H0MA 2XAQA 4ENNA 2XV4S 3BY6A 3RTRA 1YG2A 3ULQB 1JHFA 3PQJA 2FSWA 5AIPA 4KYWA 3U2RA 3KEOA 2YPRA 2HWVA 1R5HA 2FBIA 5D5UB 2G7HA 1R36A 3G73A 2ZMEA 3R60A 5ICCA 2XHKA 2GA1A 5DDGA 4HV6A 1S7AA 2FQ3A 4LK0F 5D8KB 4N9IA 5CVRA 1ZLKA 1YQAA 4K2EA 4N9HA 1STZA 2F5FA 2DO7A 1B6AA 2HTJA 1J5YA 2MA3A 4S05A 2VC1A 4DQ2A 2GZWA 1C0WA 2VXZA 5DD4A 1ZHFA 1HKQA 3D5LA 3V7SA 2K4JA 2EB7A 2FU4A 4PDKA 2LNBA 1PDNC 5DYMA 3LQQA 3ABUA 3I0TA 2EA4A 3P7NA 1SFUA 2Z9OA 1BC8C 4LD5A 4JBAA 4YIIA 2O0YA 4HAMA 3ROUA 4M71A 2PJPA 3IRQA 2GWRA 3I4PA 3SHFA 5DD8A 2D1VA 3SQNA 4JK1X 2A07F 3LFKA 2FEZA 3IC7A 4QLCU 1U5TA 2IVMA 5IT9K 1R22A 3VOEA 1U3EM 3KLOA 1KU2A 1MGTA 2P4WA 3J7AO 2G9WA 1ZG1A 4G7OF 1Z6RA 1SD5A 3VODA 3IL2A 2MH2A 3BJ6A 1S29A 2CWEA 1XSDA 1W5SA 3KETA 2GXGA 5LEJA 1CF7B 1DDNA 2ZJ2A 5E1ZB 2GXBA 4OIQF 5L3BA 1Z1DA 3V8JA 3GZ6A 4PZJA 1D3YA 2HOEA 4PCQA 2P7VB 5FD6A 1P92A 1K78A 1LEBA 4L5JA 5E1XA 4EM2A 3E97A 1U5TC 5LRRA 3ZMZA 4UXNA 5LGTA 3GFLA 2EFQA 3G3ZA 1HQCA 2ZXJA 3L09A 3LQRA 4RB0A 1ONVA 1KGSA 1T98A 4B8XA 3R0AA 5CLSA 1D8KA 2L01A 4MTDA 2GIVA 1S7OA 3WGGA 4RGXA 1YLFA 3ERED 3WGIA 2RVCA 4RS8A 2KIMA 3RIRA 3SXYA 4KA4A 2PN6A 1IXSB 1T38A 4ZYGA 4BYYA 2IP2A 1DUXC 2W24A 1XD7A 4O3MA 3CUQC 2AS5F 3TKYA 1QPMA 3GXOA 2OQGA 5CYVA 1J0RA 2OU2A 1Y0UA 4KN4X 1XGMA 5K5QA 2MLGA 2UWMA 4Q47A 2EK5A 3O2PE 1R00A 2WWYA 4JQFA 4IHSA 2UXNA 4LG0B 3F72A 3DP7A 2W25A 3MEXA 3VFZA 5DUIA 1FBQA 1FPQA 2XASA 1P4XA 3E6DA 2VE9A 1DPRA 2OBPA 1OPCA 1EV7A 5H20A 3W6KB 5HLIA 3WU1B 5TJJA 1ZYRF 1D5VA 3N4MA 1FP1D 3WTSC 4I02A 3CUQB 4H0EA 1T2KA 2DAOA 2R7DA 5FFZA 2A6EF 4LLGF 2W85A 5LLQA 2V9VA 3K9TA 3T8RA 1BI2A 3WE2A 2F5CA 2VBYA 5ICGA 1KQ8A 2FA5A 3M7GA 3DXJF 1MDMB 3AAFA 5FFXA 2PI0A 1EH6A 2CSOA 1QNTA 2Y48A 1LDDA 1KQ0A 4P96A 2OD5A 2VE8A 4WXCA 2IW5A 5D6FA 4U88A 5H6QA 1MD0A 4AWXB 4HA8A 4M73A 1ZAOA 2JRTA 1W4MA 4AIHA 4NQWA 2E7XA 3ML6A 3ZMSA 1USSA 5CVUA 5BPIA 1LDJA 1TNTA 4M9SA 1QGPA 1ON2A 4M6YA 2R7FA 2DPUA 4N0BA 1DPUA 3DFGA 1TQMA 1H9TA 4G94A 4RB2C 2OA4A 1KU7A 1B9MA 1F9NA 4IXAA 1T6SA 4IVNA 3KP7A 4KUMA 1FYKA 1K78B 1B1BA 3RYPA 1YYVA 1G3TA 3BPVA 4BHBA 3T8TA 4RGUA 1R7JA 5FB2A 1ZREA 1W5TA 2HS5A 1MZBA 2QQBA 2ZFWA 3HYIA 1BI1A 5IT9Z 1LEAA 4A6DA 3FWEA 2EWNA 1ZLJA 4WWCA 1SD4A 1B4AA 2BBYA 5JVTA 4CXFA 2HFHA 3H92A 2VT2A 3ZMTA 2YR2A 3BP8A 1IN4A 1Z6TA 3K0LA 3FMRA 5ILSA 2P7CB 1FWZA 4A12A 1ZH5A 4HOBA 3TOAA 2HDCA 2QWWA 2V6CA 2DK5A 2MLKA 2L3DA 2QUFA 2DPDA 1LVAA 3GZ5A 4LFUA 4UVAA 3ZP5A 4GCVA 4HF0A 1FX7A 4M9XA 3HHHA 2FXAA 3KP2A 4BHCA 5D5WB 2XAGA 1JHHA 3TDUC 2VBWA 5DV5A 4LLNA 3ZN1A 1KU3A 3KFWX 3NQOA 1P4AA 4EM1A 2NS0A 4B09A 3E5XA 5JI6A 2FBKA 2GAUA 4ZZLA 2M8EA 1FC3A 1IRGA 4BXUA 1F1ZA 3L9FA 1ZGAA 3F3XA 1SMYF 5EEHA 4P5OA 4KIBA 1FOKA 3B02A 1FZPB 1YO5C 3MFKA 2Z33A 2MBFA 2ISZA 1WSUA 2FRHA 1Q1HA 4ESJA 1FSHA 3E6MA 2H94A 5E8GA 3HSEA 4MNUA 1I1GA 4LJZF 4AVPA 4YFXF 4HDVA 2JSCA 4FT8A 2BGCA 1FBUA 2CFXA 3GF2A 5DCMB 4IRHA 5BPDA 1WWXA 2XUBA 3KEQA 1SAXA 1BOAA 5LEKA 2VBZA 1LDKB 3KP6A 4KIFA 2ZKZA 5HS9A 1XSXA 2MD5A 2E1CA 4IF4A 4AIJA 5E18F 1UHMA 1R23A 2PMUA 3I5UA 2UXXA 1R1VA 2VOPA 4FX4A 2EFPA 3FXUA 4XSZF 3BJOA 2KIUA 1RUNA 3LA2A 3WU0A 3HHGA 5ED4A 1BN5A 2QYOA 4HLYA 1MJAA 1MKMA 1ULYA 1RNLA 4L9NA 3GLXA 1IN6A 3FMQA 1KYWA 3KZYA 5HS7A 1HSTA 4O6JA 2WTEA 5HDGA 1OYIA 2V1DA 3ECOA 2COMA 3H3ZA 5FGMA 3GUDA 4HV5A 4NB5A 1GXPA 5CVIA 2R3SA 1O3RA 3JAMZ
chains in the Genus database with same CATH superfamily
3W2VA 4RB1A 2V88A 2DMQA 2ENAA 2A3SA 4A5MA 4ZZDA 1BJAA 5KL7A 3ONQA 2TDXA 5D4RA 2PMZA 1QPIA 4EM0B 3V8KA 2A61A 4UHTA 3THOB 1SMTA 2OCCH 5EG0A 2DA1A 4B1RA 1NEIA 2M87A 2FQ4A 5JR3A 4U7DA 3G1OA 2XSDC 1I39A 3CTAA 3CCMI 2XAHA 2IS6A 1O7FA 5AC4A 1V3FA 4RAZA 2PBIA 3BC8A 4RM3A 2R5YB 2Y2ZA 5FO5A 4XONA 5D8LB 4G8XA 4KMFA 4Y52J 5CQGA 1I1SA 2FOKA 3RKWA 2W4SA 3LA3A 2DW4A 4I98B 1MH3A 3NWSA 1BA5A 2JWTA 3DV8A 4F9AB 1IUYA 3HRUA 2P0WA 4WCGA 4U0VA 3I53A 2MC3A 2K4BA 4E7IA 3NRVA 1E17A 2LJHA 3QG5C 3OSFA 1OJLA 2O03A 2QZ8A 3VHTB 5JHUA 1B59A 1Z3XA 4LB6B 1KU9A 1HW1A 3ZGKA 3KZIC 4XK4A 1SFKA 4IPAA 5CVVA 3A0BC 4QTRA 4BNCA 1JUMA 3CDLA 1G2DC 1MJBA 5EZGA 2CT1A 4GRIA 2O8XA 2A05A 1R1UA 1XNRE 3DTIA 2CUEA 1DU6A 1I3QJ 3FX3A 3RI4A 3FM5A 4OWRB 1LUJB 4NNJA 4IKFA 1VQPI 5LGUA 5EDNA 3F6GA 2ECCA 3MZ8A 1FJGE 4D0PA 1JKOC 3CC4I 1G6NA 1F5TA 3QAHA 2CQNA 4EJWA 1Z77A 1YRNA 1OCCH 2HI3A 4HBLA 4LFAE 3TMOA 4GO1A 2WBTA 3HPZA 5E3MA 1XGOA 5D6EA 1I94E 1VQ7I 5M5YJ 3JU0A 2H6CA 1IZ1A 3WTZA 2EM9A 1X1CA 3I54A 1X6EA 3M8JA 3FXJA 3K69A 1PJTA 4Y15A 1BB8A 3ZPLA 3R61A 3DF8A 2P8TA 3VYXA 1PUEE 1Q1VA 3FISA 1I27A 2BHZA 3CCSI 2QM3A 2XF6A 4WFTA 2M30A 1VQ5I 2L7FP 4UNOA 3ZOQB 1A1GA 3P9CA 3IHUA 3OS1A 2NRAC 2LTSA 2WV0A 2CV0A 3OYFA 5J1YA 2EPFA 1QVUA 2E1MA 4FHTA 3REOA 4EGZA 1EH7A 3JRDA 1ZBTA 3HRTA 1U9NA 2EORA 1QQIA 1BI3A 3GMEA 2FUG2 4EVIA 3OIPA 4KISA 3M99B 2O9LA 3HOWJ 5ADZA 3IAS2 1SFOJ 4BQAA 1VQ6I 4C2UA 2X4HA 1HW2A 1YZ9A 3QYEA 1QZEA 4X6AJ 3CO7C 1IO2A 3JSOA 2VPLA 4B3TE 2LDUA 2KIFA 2EPRA 4DYRA 4CGZA 1EH8A 1V54H 2JN6A 3OYNA 5DM7F 3UR3C 2YT4A 2Z5UA 2JZYA 2CUJA 2Z2SB 2XKOA 1T95A 4JI4E 1V5GA 2M0MA 4DZJA 2EFNA 1JTXA 3VYSB 5IYBJ 3OYEA 2VT3A 4RAGA 4XN3A 4AIKA 1I6XA 2V9KA 2P5VA 2C6YA 1XMAA 2W48A 2JSPA 3O8GA 4W97A 3AG2H 1IN5A 1EKEA 2LCEA 1GDTA 3E5QA 3C4BA 5CVJA 1YI2I 1DU0A 3JTHA 3PFIA 4CDGA 1S9HA 5T6JA 4LF4E 2UV1A 5CKTA 4I09A 1UHZA 3ZCOA 3HOSA 5J47A 2HVSA 1EJ9A 5HNHA 3P9KA 5TGTA 5KNLA 2EM7A 2ZNZA 2FBHA 3PJRA 1P4WA 5GTHC 5F0CA 2YX4A 2LH9A 2LYCA 2ZMEB 4Q28A 3KP4A 4PJMA 2DLQA 4BUPA 3J81C 2CO5A 4G9YA 4F55A 4ZJZA 4WXHA 2E2IJ 1HKSA 3ISPA 3VB2A 1N36E 3I58A 1A36A 4TUGA 1WKMA 1WHNA 2XPWA 3C6MA 4MHGA 4DMIA 5BR8E 2XDVA 2EZKA 4BEHA 5A2QC 2G7UA 2R7UA 3HRMA 4A6EA 1XMQE 2DT5A 4WK8F 2DDAA 3N97A 2A6HF 1ETWA 1TF6A 1MIJA 3OYJA 1FEXA 5D4SA 4I2OA 3M9AA 4ASNA 5L3CA 1JE8A 2K02A 5BQTA 2R92J 2EMKA 3SDBA 3CMEI 3L7WA 4P9UA 3JRHA 2VB6A 2R1FA 4OMYA 3FIWA 4LK1F 5BMZA 1UG2A 2Z1DA 3RPUD 4BHPA 2YZTA 2CS3A 2NVYJ 2MABA 3M8EA 1WI9A 4R2AA 2A68F 1S8NA 2LBFA 4N4OB 2Z99A 1A04A 2L7ZA 3MVPA 2UZKA 3RQIA 3GTKJ 3QU3A 4A3FJ 1YHQI 4J19A 3I59A 4MGRA 1LB2A 2EOXA 1VQ9I 4F6NA 5J8CA 1UB9A 1JGSA 3COAC 3CUQA 1KA8A 4IJAA 4Q5SF 2F5EA 2PEXA 2YRMA 4ZYHA 2ELHA 2R7SA 3IKTA 4O5VA 2EV0A 1GV5A 5AONA 2UUZA 1DGWY 1R58A 4OIPF 3KP5A 2DQLA 1F43A 2G0EA 3L2UA 2YRHA 1TT0A 2MGQA 2LKPA 4U7BA 4G12A 2EFWA 2H09A 1WHUA 4BXFA 1K83J 3BR5A 1U2WA 4ZYEA 3K70C 1LQ1A 1EA3A 3B6CA 3M07A 3F8MA 2JTVA 4LIUA 1UN6B 2NYXA 1MBKA 3JR9A 4OINF 3EDPA 4GYIA 2UXCE 3HSFA 3B73A 2EN6A 4HNTA 4XLNF 1ZN2A 4BBYA 4EQQA 1G2HA 3WTTC 1LFPA 1TLHB 4U0YA 2W7NA 4CZCA 3OYKA 1RETA 4P1WA 5A6JA 3EPLA 1X1DA 4BJ6C 1U8RA 4IQJA 2FX0A 2X1EA 4LIVA 2KONA 1BR2A 2IS4A 2QSFX 2J5OA 3ADGA 1XMOE 4X8WA 4NC7A 2HGCA 3LAJA 2Y75A 2EPNA 1RUOA 2Q8UA 2R7TA 3BTLA 3GEZA 1G3WA 3KPHA 5F1RA 2QCOA 1FYLA 1AAYA 2AXLA 4AD9A 3V4GA 1VTNC 3SZTA 2V87A 1BIAA 4XRMA 4P9FA 2FD5A 3RJPA 2VJIA 3WTYC 2H1LA 1XC5A 3I55I 4ENKA 1ORKA 1IC8A 4CCJA 3O8HA 4DBRA 3CC7I 1A6IA 3KP3A 1B8IA 4R2DA 3RMPA 2O61A 3CF2A 3CJNA 3KYCB 3HC7A 3FXKA 1FTTA 1U9OA 2HKXA 2EMGA 1TNSA 1O57A 2VJ4A 1N34E 1Y8RB 4ETSA 5IYDJ 1NG6A 2BBGA 2YRKA 2V26A 2YU8A 1WQ2A 3WTWC 3J7AG 4L5EA 4HLXA 2H8RA 2QQAA 2DXIA 2VE7C 2M4IA 1BW6A 2CV2A 4WX9A 3HSRA 1ZARA 2HU9A 1X1AA 3DWLE 2RDPA 4AC0A 3MHSC 1A1IA 4JYAE 3KEYA 3QP5A 3VSLA 2KZVA 4KDPA 1D1CA 1FSEA 2XF5A 1MH4A 3BIDA 4Q4ZF 1WJFA 2ZXWH 3LOCA 2GQQA 2VI6A 3HDDA 1FNNA 2A25A 5A6BA 1G3SA 5FD5A 3TGNA 3PQKA 5HS8A 1YSAC 4RGRA 4GXOA 1QRYA 2EL6A 3ADIA 3E5UA 5JLXA 3M1EA 3F6HA 2DJNA 1YS7A 2XAFA 2GBYA 2VKHA 3FXOA 4UUVA 3GX4X 3CESA 3WTUC 1XDSA 2XKPA 2BHYA 2DMIA 1OMIA 3EYIA 2Y30A 3A1YA 3GBGA 3OR2C 4NC8A 2XRNA 1ZR4A 1MBEA 1Y8QB 4LOCA 4MLOA 2HYJA 1MW7A 2OZ6A 1IXCA 3DBHB 5CQEA 3MKLA 3K4CA 2NUGA 3FIGA 2V9PA 2JPCA 3GZNB 2RV8A 2CU7A 4Q48A 4CUGA 4B3ME 1FIPA 1ETVA 5J6XA 4DV6E 3K2ZA 1P6RA 1FY7A 1UHWA 3K4LA 3PM1A 4PGHA 2E5ZA 4QWQA 4E6KG 2Y9ZA 1UJ8A 1ERDA 3FZVA 2EBIA 3W2WA 2EM3A 3MZHA 2V1XA 2GOXB 2O8KA 2DFFA 3U9GA 3TW6A 1WHQA 2JOXA 2KPMA 3SJMA 3CLOA 4AUXA 1D0YA 2JVGA 2DK8A 2F4IA 4X1EA 3RPUA 4MQVA 5DEQA 2PJRA 1I3AA 2P6SA 4L0ZB 2GPIA 1TC3C 2WAEA 2ZXHA 1W7PD 4A5NA 1BR1A 4OIRF 4RGSA 1GZ6A 3ZMDA 1Y39A 3CCLI 4XLPF 1JXSA 1QO0D 3FXLA 5E17F 1KYZA 4L5IA 1S3JA 1MMNA 2JJ7A 3SEQA 2Y0MA 3PSFA 4R1HA 2LF8A 5J8FA 1IG7A 2CW0F 3R0JA 2DA3A 1ZRCA 4PUSA 1X48A 2ESHA 1OLTA 3L1PA 4XN0A 4DV1E 2HXOA 1VQKI 3OYLA 2XPUA 3M8FA 1IBME 4I76A 3I56I 2M2EA 4R2QA 3H9GA 2ADUA 1E3PA 3ZQ7A 4KITB 1PP7U 2DTZA 3DLLF 4D7NA 2R7VA 4G7HF 3PO3J 3H1CA 1W0TA 2EOZA 2KT0A 3AL0B 4L9VA 3S1RJ 1L0OC 5FKNA 2OUMA 5K5OA 3E6BA 3W6JB 1Z7LA 4A0YA 1K6YA 4MIMA 4LLLA 4HQMA 2YU9J 5FLXZ 2VQCA 5A2QZ 1JUPA 2H6BA 4DV5E 4C3IJ 2EMXA 2L7KA 3S3OA 2YTIA 3GVAA 4M9ZA 1RC7A 1ZK8A 2JUCA 4UUSA 1VQLI 2RGVA 3BG9A 4HQEA 4MTEA 2MC5A 4UB6C 3J81Z 1YW9A 3JAMC 4HZFA 3H0DA 3HL2A 4YHHE 2L02A 3I4MJ 4OX9E 1TZLA 2Q0OA 1IW7F 4YY3E 1GV2A 4DYCA 5EG0B 1VZ0A 3HJEA 4JP0A 3AG3H 1ZU1A 3E6CC 3E3VA 3BG5A 4PFPA 2EOJA 1OR7A 5F0HA 2Q8KA 1O3TA 3BJAA 3E1SA 2VASA 4QSHA 3BG7A 2ZJQF 2ZO4A 2EN4A 3KWRA 1KQ9A 1TWAJ 2P5KA 3S15J 5BS6A 1P2FA 2ZCWA 4LF8E 3HG9A 3D1NI 3IWZA 1TQPA 1SANA 2DOAA 2IA0A 3QQAA 1XSVA 2F48A 4BMJA 3CCUI 4YFNF 4XMYA 1ZR9A 3G71I 4LF6E 3OYIA 5DCFA 1M1EB 2K27A 3RKQA 1N75A 2CW8A 3I59B 4BGDA 3OYGA 2LV2A 4IQ4A 2CQXA 1WJAA 2WV1A 3M4OJ 3DKYA 2JOBA 4UV9A 4DR1E 1A1JA 3RCOA 3FM3A 4DIQA 5B5EC 1MNEA 2DLLA 4MFDA 3BTJA 1T33A 2H27A 2RREA 4Y4RA 2L33A 2HNHA 3JTGA 3CLQA 3OOUA 2PMHA 3IKVA 4M6XA 4XKWA 1K6OA 2MKDA 2UUAE 2QBYA 1IJWC 2IPQX 1ETKA 2N3HA 2ACJA 3OOPA 3IRRA 3ZRGA 1UELB 3DF6A 3TO7A 1IXRC 2EFOA 3AKZA 3IWCA 4BEHB 5E20A 2E35A 3CDIA 1AOYA 1YYWA 1RQ0A 1AHDP 3NAUA 1SD6A 1X2NA 3J80K 2OAZA 4I0AA 2RPCA 2HOAA 1IRFA 3HRSA 4UV8A 2M34A 1PVEA 1S7EA 2KJCA 4L18B 4P78A 2P81A 2EPOA 1YJWI 2LOOA 4L0YB 1TQIA 3OL3A 4IEJA 2Y31A 4IHVA 3I71A 5J3LA 2HGHA 2M7AA 4IHWA 3HTSB 5B1BH 2IS2A 2JA6J 3DEUA 3O3KA 2WB1N 1J59A 1N25A 4G6TB 1XMKA 4XICA 3FXQA 4B44A 2X85A 3MCZA 2EA2A 2E7WA 4M2ZA 4HX8A 5E1WA 1FJLA 3ABLH 4B3SE 3OY9A 3JCUC 2PFBA 1Z9CA 2MD0A 2JPBA 1SD7A 4MQ9F 2PJRB 1XB4A 3DU5A 5LHGA 2LG4A 5D5VB 3QPTA 4B48A 2D1HA 1P7JA 4P55A 5CPRB 4BU2A 1XMXA 1D1AA 1GHCA 2W57A 1K4TA 4DNCA 2DQRA 4JOMA 1YIJI 5K7HA 3L00A 2V8QB 1TWHJ 1XX5A 4I99C 3P9IA 5ERIA 4LFBE 3I3LA 4YIFA 3DQVC 2CQQA 1USTA 2AXTC 3OYCA 2BV6A 4HEIA 4MLVA 3MHHC 1T39A 1FKAE 3NARA 3FF5A 1WVRA 2QQ9A 2K9LA 2STTA 1GVDA 3IV5A 2X6WA 1OYWA 1Z91A 2RTXA 3FKIJ 2EZIA 2OCEA 5B1AH 3OYBA 4F9BB 2HOTA 3LSGA 3JRGA 2RS7A 2L4AA 1R9TJ 2E1MC 3PO2J 1YE9A 1Z7UA 3ZMUA 1K79A 4BAYA 4QIWN 1XDUA 2R7XA 1UCRA 4MEXF 1GVJA 3HOYJ 1WRJA 2CMPA 4RBOA 1FIAA 2VONA 4EV0A 1O3SA 3KZZA 3O6BB 3K4KA 1X3UA 2OQRA 1HR0E 1WFXA 1VQMI 4LG3A 2R7WA 2PLYA 2A69F 3WG9A 5FLXK 3CCVI 5A69A 5A2QK 4A3IJ 2NAZA 4PJJA 3DEWA 5IT3A 2V6EA 2ELZA 2XGXA 1BI0A 2ME6A 4C3HJ 4EJVA 3M3YJ 1ON1A 4BQNA 3ADLA 2QENA 1X3ZB 4PSWA 5ILVA 2OTJI 4FE4A 4XL9A 3GFIA 2HVQA 3T1BA 4NHJA 1WJCA 4XBFA 1JT0A 3BROA 1VQ8I 2DA4A 3CQZJ 1DGRM 2EJ4A 3BGHA 4UVCA 2HXIA 2B63J 2F2EA 1N77A 3S3NA 3CP8A 1VQNI 1BR4A 3DKWA 3DBLB 5J4YA 1R4MB 3ESWB 2ZXIA 4RHBB 5KL3A 1JTYA 3J80Z 3LSJA 5KVRA 1NK2P 3MN2A 2L6MA 2L0KA 4IZZA 1IBLE 2ZNYA 4C9YA 3BCBA 1BC7C 3LSRA 2NNYA 1IRXA 2E60A 2ENCA 4XLEA 3RDIA 2CQKA 2KLOA 1HCRA 4J00A 5ILUA 5BOXA 3QODA 1J26A 4F92B 2LP0A 5E8IA 1O0WA 1TW2A 2WA0A 1J2XA 3RYRA 3F8FA 5LMUE 2K7LA 3IH3A 2D2WA 1MBHA 3SDGA 2BXYA 3BOQA 1ZGJA 2VQGA 3H5AA 3Q0UA 2YSRA 2DFEA 2LUPB 5LHIA 4BBRJ 4A3KJ 5EF6A 2IA2A 4LGWA 3C7JA 4DV7E 3AUZA 2M4GA 3G1LA 1X19A 2DODA 3QOPA 3V7RA 1DP7P 1NHAA 2X6YA 4YELA 1TWGJ 3GYHX 1W7PB 2RNJA 1LFUP 2R5YA 4AIDA 3RKXA 2FE3A 1TN9A 4FQGA 1YS6A 4ON0A 2O6GE 3PFYA 1Z05A 1O3QA 4Y13A 2IAIA 1QZYA 2KKOA 5F64A 2N8GA 2DFIA 4B43A 4DOZA 3OYDA 4Q35B 2P6TA 2ELYA 4D7MA 4BS9A 2EQ3A 4KIGA 2BB8A 2EOQA 1HSJA 1R1TA 1VQ4I 4E4HA 2LY9A 4GYGA 1OCTC 4DZPA 1D8JA 4V19K 1XG1A 1X49A 1R5GA 5A6AA 2VLAA 2EPCA 5F6FA 4TUIA 2DCEA 1CQTA 3CCQI 3DEEA 3EUHA 2EN2A 1X5WA 3WG7H 4JX5A 3ECHA 4MO7A 4F93B 1D1BA 4O24A 2MW8A 4A3EJ 4D9JA 3F22A 2FV4B 1NCSA 2EPAA 3RPQA 2CG4A 2L2MA 2M5WA 4BQQA 3TDZC 3BR2A 2RQPA 3PIPF 1NH3A 3C2BA 4LB5A 2DDBA 3BWGA 3R4KA 3GTPJ 1J7KA 1TW3A 2BVMA 2HYFA 4A2UA 3C3WA 2V1UA 2JP9A 5GPCA 2KMUA 2D9HA 5DNYA 3H9QA 1XCVA 2ODRC 4YRVA 2NVXJ 1WJPA 1J9IA 1X6HA 3MKYB 1SFEA 1XCBA 2IEKA 3K6GA 4L9TA 2ODRD 1OR7C 4JV5E 2BE5F 2HTSA 2OF7A 4Y17A 2KRHA 2FGGA 2LMDA 4AM3A 3GTJJ 1T4NA 2MKNA 3MZYA 4DR6E 1CF7A 2JA8J 4HDUA 2DSYA 2LBSB 4MEYF 2EMAA 2JVAA 2WCC3 4TV7A 3WHCA 2JYAA 3KYLA 1YW8A 2XRLA 3R6SA 1RESA 3MQ0A 1OKRA 4MFEA 1WXRA 4KFCA 1IAWA 2N3GA 4OU0A 1MEYC 4IRIA 3EQ1A 4R03A 3F6VA 2BEOA 4BBSJ 3SZPA 4OOIA 5AASA 1AA7A 2O3FA 3DJWA 3HIFA 1JKPC 1ACIA 3TQMA 4LMYA 1PP8F 1YFHA 4I7HA 1HOMA 2KJBA 4EJUA 2KDZA 4II3A 4RLFA 1LFBA 2YTPA 2CQ7A 3FHZA 3FXMA 2HQNA 3T5XA 1X1BA 4R79A 2QSHX 3UKGA 3LSTA 5HLGA 3K1MA 2X1DA 3C1DA 3OYMA 4XSXF 4DJAA 3BLYA 3DPLC 4RLQA 2VN2A 3JRBA 1X3WB 2MSYA 1YTYA 1L4SA 3ZN0A 2XF7A 1IUFA 5IOZA 4I01A 1A1KA 2EOOA 3K6QA 5KL5A 2EMYA 1W0UA 3EETA 1IN7A 2VUMJ 5ICEA 3A02A 1RKTA 2ETHA 2XAJA 3OWTA 4F7ZA 2VIXA 3MD2A 2JWOA 4R2CA 4R8OA 2DB2A 4E7ZA 1E2XA 2KISA 2WAQA 1CGPA 4KT6A 1MMSA 4CSWA 1ZRFA 4JX4A 2EM0A 1HW5A 2CFOA 1GUUA 1MDMA 4JI6E 2ID6A 3VEPA 3A2KA 5IP6A 3C2GA 4HW0A 5IP7J 2MC6A 5JHFA 3BZ6A 1QHHD 2LRSA 2EPUA 2Y0SA 4CCLA 4XLFA 2XVCA 3B6AA 3HBLA 1IQSA 1ETXA 2K4VA 2DI3A 9ANTA 2M8GX 2EMBA 2M4KA 4IRGA 2QKMB 5C3EJ 3CJQB 2DBBA 1O7LA 3HTUA 1TWFJ 2HR3A 2YX7A 2VQEE 1BBOA 3U1DA 3A4CA 4OIOF 4JI3E 2H1KA 2K86A 5A6KA 5FLVA 1BBYA 3FKJA 2E34A 6PAXA 3CMYA 4S04A 3GWZA 2EQ1A 3PUFA 5J1RA 2L2OA 2V85A 2YWQA 1K7AA 4M74A 3PNTA 3LWFA 5CJ9A 2D45A 3IP4B 1GQEA 3H09A 5TSEA 5JLWA 3S1NJ 5E3OA 2R4GA 2EV5A 2LF7A 4HF1A 2ZFUA 2J5PA 3HKZA 2M45A 2XIGA 3H5NA 1X47A 3KCCA 3K4MA 1NG7A 2VC0A 4RDUA 3H3UA 3TP0A 5JFRA 2FNPA 1PUFB 3DBRB 3S16J 2EIKH 2EIMH 2LK2A 1E3OC 2EN8A 2GXAA 2A5WA 2ISYA 1ZRDA 1HDPA 3WU2C 2DA6A 1ETQA 5TISC 4CYDA 5EGOA 2JPAA 4XOTA 1V5EA 3FDYA 1DP3A 3LAPA 5D5XB 2F5VA 3ZR8X 1H9GA 2TRTA 4CYCA 3EUKL 3GTGJ 2RSMA 5L3FA 2D5VA 4F6MA 2RKHA 1WJDA 1IDYA 3LA7A 2DOFA 4G6DA 3SYTA 2E71A 4HNUA 2CYYA 3QP6A 5FKLA 1JK1A 4HX7A 4BY7J 5TRDA 1ZAAC 4IS1C 4GDFA 2DA5A 1ZKGA 3F6OA 1WJEA 5IV8B 4JYKA 1YW7A 2QLZA 2IA1A 5HLHA 3QRFF 3ZQHA 3S2WA 1E3HA 4HX4A 2R5ZA 1AWCA 1AKHA 3CUOA 2KFDA 4HF2A 5M5WJ 2HVRA 4U0WA 3ZXSA 2FF4A 3KLNA 3WGHA 2UUCE 2EOMA 5F08A 1B69A 4UVBA 3MWMA 1K4SA 1QBJA 1WH7A 4WPYA 1XGNA 3JREA 4R2EA 1J75A 2RN7A 4ZH4F 1JJ6C 2IT0A 1F36A 4XRFA 4ZYDA 4IHXA 3V7CA 3V42A 3QPSA 1R49A 1OFCX 4YG2F 2DU9A 4IHYA 2E1NA 4RAYA 4F91B 1GT0C 1L3LA 4GZNC 3VYYA 1W5CC 2VJ5A 3F8BA 1FOWA 1KONA 2WC2A 2YSPA 3S2HJ 2DMNA 3K7AJ 2H36X 2MG4A 3FBNB 3ZOBA 2FMYA 1G2FC 5HOOA 1HKTA 2EINH 4ENMA 5IXMB 4BJ5C 3QPHA 3SFZA 5AC5A 3JAMK 3CO6C 2Y9YA 2B7VA 5BNGA 4PFOA 1BOBA 1OYYA 4JI5E 2GM4A 4P7DA 2LKXA 2L7MP 1LLMC 3F8NA 1BM9A 2WBUA 1T0FA 2IGMA 4KICA 4OMZA 2B0LA 3J81K 2JVHA 3QYBA 2M7QA 1N32E 2LTPA 5FKMA 2FMLA 3CDHA 4A69C 3OSGA 2ZMEC 4JX6A 4XKCA 3T0YA 1LJ9A 4ESBA 1N78A 1MJ9A 2QA4I 1N3GA 4IO9F 4A3DJ 2V83A 3NEUA 2EZ6A 2L54A 1OCPA 1MMAA 3F23A 1YPNA 2EPZA 4A0XA 3TBIA 4CICA 4CZZA 3IH2A 2EN7A 2OV7A 3GCMA 1A31A 4BY1J 3BPXA 2WY7Q 3HZJA 3TO9A 3CCRI 4EJOA 4E70A 1RRJA 3LL7A 2DMUA 3QYFA 1HBXG 2JK3A 4AU7A 2QVOA 3OV8A 1S6LA 2JT1A 2EOIA 4EMSA 3GFMA 4FASD 2Z3YA 2IRFG 5FKOA 1JK2A 3BZCA 4IL6C 3WTXC 2RQLA 3HGYA 2ESNA 1GXQA 2CGPA 4A3GJ 2EMZA 1LE8A 2ZC2A 1D0ZA 2NVTJ 3EPJA 5FLMJ 4C2TA 3HGGA 4FETA 2EM4A 3K1PA 3WTVC 3D0SA 2YS9A 5DS9A 1U78A 1ZG3A 2X0LA 5DCMA 2V4JC 3ABTA 3WODF 4I6ZA 1LPQA 4CCNA 1A1FA 1JGGA 1TTYA 1KYQA 1X6FA 2IBDA 2VL8A 3BG3A 2ELKA 4NC6A 3P1XA 2LVSA 3GW2A 4M72A 5AIQA 3OIQA 4CO8A 2EV6A 1LKXA 4Y3OA 4F54A 1AU7A 2EPMX 5HODA 3U1KA 2IJLA 3I64A 2CTDA 4NXME 5KCMA 4KN7X 2GIZA 3S8PA 2F8BA 2LFBA 5JVGF 2FNAA 3CJTB 3TQNA 2L2NA 2YU3A 1QZZA 1XNQE 1TBXA 5F27A 3PIOF 4KJZA 5LBQA 4E7SA 2VOOA 3S3MA 4IHTA 1HXDA 2B7TA 2LLKA 2HHHE 3T1HE 3S32A 2HZTA 4D5CA 1TWCJ 5DM6F 1YITI 4PJ0C 4UY8I 2EOEA 4YFKF 2Y0SN 3BTCA 1H88C 1U5TB 3Q9VA 2F4OB 1RI7A 4BE0A 3MMYB 4HEA2 1I5ZA 3LMMA 1SC7A 3AG1H 2GLOA 4KMUX 5FROA 3BDDA 3TOBA 2W84A 2IGNA 2JUGA 2P5LC 3F0CA 4HYEA 2RSIA 2M7BA 5LGNA 1DQUA 3ASOH 3K1NA 2Q2EA 5F04A 1F4KA 2J7JA 1FLIA 2LTRA 3EPKA 5H2FC 4JI7E 3GO5A 2CPNA 1ODDA 2W00A 4WXDA 4GGGA 4RB3C 1YIOA 4R2SA 2STWA 1U6GA 3C18A 4HNVA 3OYAA 1FMWA 2KDOA 1H89C 3Q0WA 3TP3A 2YUSA 2NNNA 3W6VA 2QBYB 2EM2A 3DPTA 3L2CA 2EJRA 3BZKA 4A0ZA 4ESFA 5LMNE 5KL6A 4XLHA 2JY9A 5GAGJ 2VQLA 4IOCF 2HYGD 4BDYA 2FTXB 2I10A 2IGKA 3ELKA 4B47A 3ZQLA 1TL8A 2L9NA 2DMYA 1IGNA 2HJJA 3GFJA 4NDLA 4KWYA 2PG4A 2F4MB 2M1BA 1FYMA 4A3LJ 4A3JJ 1D5YA 4ENJA 3Q5FA 2VQFE 1G4DA 2A5YB 4LG0A 4G6QA 3S17J 5EEGA 4EGYA 5LHHA 2XROA 2KRFA 2VODA 2I9IA 4FX0A 4WF2A 3IWBA 1N33E 1IV8A 3TW7A 2X9DA 4O5GA 4X9JA 4KHPE 1UAAA 2HQ5A 2LKSA 2OJED 4XM3A 3G4SI 2HEOA 1T8IA 1XN7A 5EJCA 4E7JA 1YUIA 2DRPA 1T56A 3H36A 3JW4A 3H0GJ 3H5RA 1RIOH 2RC4A 5L3DA 2DMTA 1D0XA 3EQLF 3MAJA 3EYYA 4D5FA 3HOUJ 4X64E 5L3GA 4PGGA 2F5DA 4DR5E 1UFMA 2OC6A 4O4KA 1YYKA 3QOEA 2ELJA 2V79A 4XORA 3C6KA 4NHRA 2XB0X 3RKYA 4ZDPA 3JRFA 5HDNA 4EEFG 1RZ4A 5LRSA 4KT5C 3Q9SA 4L9JA 5KK1A 3KE2A 5IOYA 4Z2YA 2EILH 2OZUA 2HKOA 2FOWA 2MH9A 3L2WA 3E0JB 1W7PA 2EL5A 1FT9A 3HPHA 4XLAA 3AG4H 2VPRA 3QU6A 5DUKA 1B9NA 3Q0VA 3RZDJ 2LO3A 2EL4A 3FXRA 1SFXA 4LFCE 1NK3P 2NVQJ 2EZHA 2HPIA 2GA2A 4KNYA 2TCTA 2PQ8A 2VBXA 2QKLB 1LNWA 2RNGA 5C44J 2DN0A 1FP2A 3HM5A 3CCEI 3VWBA 2WZOA 4F52A 4GFBA 4R8HA 3UK3C 4EJTA 5ICFA 2NVUB 3V8LA 1REPC 3LSKA 3TO6A 5FLXC 2VKDA 5HVQC 2EM8A 3LNQA 1V4RA 4XRSG 1IN8A 1STUA 3F8CA 2L4MA 3AFHA 4BC9A 5H6RA 2NS7A 2LR8A 2V86A 4CHUA 4LTYA 1FBSA 3X2QH 2B3TB 2BYVE 4BE1A 3IAM2 2HQRA 2ZBKA 1BIBA 3FMSA 3G2BA 4M3EA 5HDKA 3IWFA 4R2RA 3JRCA 4BQOA 4XQFA 5FRNA 5K5RA 2V1NA 2EE8A 1RMDA 2JMWA 3ZQIA 2DTRA 4MLQA 1G3YA 5L3EA 2LSOA 1XGSA 3CZ6A 4FE7A 1P7IA 4G7ZF 1ZG5A 3HUGA 2HPMA 4DR4E 3F21A 2E5LE 2UXDE 5A6BD 3G6EI 2L9VA 4Y33A 4M9VC 1H8AC 1IF1A 5K1YA 3H3VK 3WE3A 4B4CA 1UILA 2EPKX 4RA2A 3RSNA 4BH9A 3C4TA 3VYRB 5KAIC 3ZMVA 3HOTA 1YX3A 2X51A 4JI2E 3JSPA 3THNA 2WAQN 4I0BA 1H0MA 3UNGC 3CD6I 2X6XA 2XAQA 3BF2A 2W82A 4ENNA 4N4NB 2JXPA 2XV4S 2RS6A 3BY6A 4YEJA 3RTRA 2B7EA 1ZQ3P 2JR1A 3BBGA 2YSOA 2LY2A 1YG2A 3ULQB 2LD5A 3HOVJ 1KZHA 1JHFA 3PQJA 2FSWA 1S5LC 5AIPA 2YTQA 4WSGA 4KYWA 3U2RA 4PSXA 3KEOA 2YPRA 1FOXA 2HWVA 2IGOA 2ADRA 1R5HA 2FBIA 5IPAA 5D5UB 2G7HA 1JI8A 2AQFA 2ZSHB 1R36A 3G73A 2X48A 2ZMEA 2K40A 3KX2A 3R60A 5ICCA 2GHFA 1Y56A 3FK7A 2JQ7A 3HPSA 2XHKA 2XGCA 3K10A 2CH0A 2LC2A 4XR6A 2GA1A 2GOMA 2VKVA 4X66E 1HDDC 1T0FC 5DDGA 4HV6A 2EM5A 2NA2A 1S7AA 4CA0A 2UU9E 2L5QA 2FQ3A 2UUBE 5B3SH 3BQZA 3JRIA 3QPLA 4LK0F 3DTEA 3HKZN 5D8KB 2EMWA 3OL4A 4N9IA 5CVRA 5J40A 3JRAA 1ZLKA 3KIOA 1Y6IA 2CJJA 1WPKA 3Q3SA 1YQAA 4B3RE 1MMDA 2V7FA 4K2EA 2MFZA 4ANJA 2E1OA 2XGDA 1RC9A 5M3FJ 2YPNA 4N9HA 2DIXA 2JA7J 2DLKA 3DKXA 2HQAA 1STZA 2F5FA 3CMMA 3LSIA 4V2GA 5B66C 2DO7A 1B6AA 2HTJA 1J5YA 2MA3A 4M3GA 5HNFA 4S05A 1A1HA 2VC1A 3HXLA 2BXZA 5GTIC 4DQ2A 3CCJI 5GAHJ 2GZWA 1C0WA 1F2IG 2VXZA 2KHMA 5DD4A 4II2A 2EQRA 1MNMC 1ZHFA 5F3WA 4X62E 1HKQA 4DV3E 2MYSA 3OTOE 2R7ZJ 3F9KA 3D5LA 3V7SA 2K4JA 1TP4A 2K7IA 2EB7A 3EPZA 2FU4A 4A3CJ 4PDKA 2LNBA 4WSPA 2VJJA 1PDNC 2X6OA 5GPAA 5DYMA 3LQQA 3ABUA 3I0TA 3PNYA 2EMLA 4CCOA 3VYUB 2EA4A 3L2VA 5M3MJ 3HPGA 3P7NA 1SFUA 4DR3E 2Z9OA 2UXBE 1BC8C 4LD5A 1VF9A 1SVLA 4JBAA 2O0YA 4HAMA 4YIIA 4IJDA 3ROUA 4JI0E 4M71A 2PJPA 2LJUA 1QU3A 3ZQFA 2NOGA 1VNDA 5KHDA 3IRQA 2KQRA 2GWRA 3I4PA 1SAUA 4C3JJ 4DKKA 2KL4A 1WCMJ 2M0CA 3SHFA 3I4NJ 2JA5J 4DW6A 5DD8A 2BY3A 4E7LA 2D1VA 3SQNA 2I5UA 1BW5A 4JK1X 2A07F 3LFKA 4ZC3A 2K5CA 4D1QA 1XPXA 3ERMA 4XRSA 2FEZA 3IC7A 2ZM6E 1EKZA 4QLCU 3S1MJ 1PYVA 1U5TA 2WBMA 5GAEJ 2IVMA 5IT9K 1R22A 4Z6YA 3VOEA 1B8IB 3CP2A 4F2JC 1Y1WJ 1FTZA 3T1YE 1U3EM 2VRDA 2EH3A 2KIQA 5DTDA 3RZOJ 3ZQCA 1MBJA 3KLOA 1KU2A 3ECRA 1MGTA 2P4WA 5K7ZA 3J7AO 3J7Yp 2G9WA 1ZG1A 4G7OF 2IS1A 4NXNE 1Z6RA 2DYRH 1SD5A 3OMYA 2PRTA 3VYTB 1UMQA 3VODA 2A6TA 4LU9A 3IL2A 2OTLI 2MH2A 3BJ6A 1S29A 2CWEA 3PL8A 4E7HA 3DU6A 1W5SA 1XSDA 2L3CA 3KETA 2GXGA 5LEJA 2MDRA 4BCAA 2F4VE 1HF0A 2R7RA 2I8DA 4GKJE 1ZR2A 1SR9A 4DBQA 4LF5E 3FBIB 1OQYA 1CF7B 3JTZA 1DDNA 2ZJ2A 4XKVA 5E1ZB 5GP9A 2GXBA 4OIQF 5L3BA 1V5FA 2V89A 4ZDOA 1KJKA 1Z1DA 3V8JA 3GZ6A 2Y69H 4HPQA 1D3YA 4PZJA 5IT9C 2HOEA 4FISA 5LD2C 4PCQA 2P7VB 5E3LA 5FD6A 1P92A 1K78A 1LEBA 2VKEA 5F0FA 4XLCA 4FTHA 4L5JA 1FOYA 4M6VA 5E1XA 4EM2A 3E97A 3J7ZI 1U5TC 2DT7B 5LRRA 3IH4A 3BR3A 3ZMZA 4UXNA 5LGTA 4C30A 3GFLA 2O5RA 4DV0E 2R7QA 1DQ3A 1HNXE 3TL4X 2EFQA 3G3ZA 1HQCA 3ZQQA 2VXDA 5M5XJ 2ZXJA 1X4PA 3P5JA 2EMIA 3L09A 3LQRA 4RB0A 1ONVA 2L8TA 1TT5B 3K4BA 4X65E 1T98A 1KGSA 1Y1VJ 1ZBQA 4B8XA 3R0AA 5CLSA 1Y0NA 1D8KA 2L01A 4MTDA 2LUQA 1W36D 2GIVA 3ABKH 1S7OA 2Z16A 3WGGA 4R2PA 3OMLA 3VPRA 4L5NC 4RGXA 4UUSB 3I9V2 4F3QA 1YLFA 2HZDA 3ERED 3SEZA 1MSEC 3DCFA 3WGIA 2RVCA 4RS8A 2KIMA 2EPPA 3RIRA 3MKWB 5EEAA 2EPLX 3NWTA 2OPTA 2K9QA 3SXYA 4KA4A 2PN6A 2VF1A 1IXSB 2YTOA 1BBGA 1T38A 3L2QA 4OAZA 4ZYGA 2LVHA 1U8BA 2JA2A 1VI0A 2E5NA 4BYYA 4GEQB 2IP2A 2XPVA 1BJZA 1DUXC 2W24A 1XD7A 2WB1A 2DT6A 4O3MA 1ZGWA 3CUQC 4BACA 1JUSA 1QVTA 2AS5F 4WYQB 3TKYA 4DUYE 1MMGA 1QPMA 1MBFA 4PK4A 5KL2A 2WY8Q 3U21A 3GXOA 1BL0A 2OQGA 4DGWB 5CYVA 3PNVA 2R5ZB 1J0RA 2YTFA 1YOVB 3QWLA 4NUBA 2OU2A 1QA6A 3VK6A 3N05A 1Y0UA 1GLNA 3IUOA 5HLTA 4KN4X 2B9DA 3D5SC 2BY2A 2GLIA 1XGMA 2L9RA 2XB5A 3BG6A 5K5QA 4LF7E 1Z67A 2MLGA 2UWMA 1WH5A 4Q47A 4O43A 1HNZE 2I13A 2EK5A 2N8XA 2PMZN 3O2PE 2NUEA 4EATA 1R00A 3BR1A 2WWYA 4JQFA 4IHSA 2UXNA 4LG0B 3F72A 2CUZA 3DP7A 2W25A 3MEXA 2HDWA 3VFZA 5DUIA 1FBQA 1FPQA 5FKKA 2XASA 4AVZA 1P4XA 4RM2A 4A3BJ 3E6DA 2VE9A 2BW3A 2DGCA 3G1MA 1DPRA 2OBPA 2NUFA 4YIRX 1OPCA 1EV7A 5H20A 3W6KB 2K9MA 5HLIA 3WU1B 4DV4E 1IV6A 1V55H 5TJJA 4CCKA 1VQOI 1ZYRF 3E7LA 1D5VA 2CW7A 2BW3B 5IP9J 3N4MA 3J7AY 2E1MB 1FP1D 3FHNA 2DOEA 2EMCA 5CFFE 4ZTFA 3LSMA 3WTSC 1EF4A 4I02A 4M3FA 2R93J 2M1SA 3CUQB 4HG2A 1J5EE 4H0EA 4B3AA 1T2KA 2DAOA 3MSWA 2R7DA 2EOHA 1ZELA 5FFZA 2A6EF 1HA8A 4LLGF 5KAFC 1R4NB 1RPWA 2W85A 4GKKE 5FRMA 5LLQA 4BDZA 2M9AA 2ZSIB 2V9VA 3K9TA 2IXSA 3T8RA 4HRIA 3GLLA 1BI2A 3WE2A 2F5CA 1YRNB 2VBYA 5ICGA 3S1QJ 2XSJC 4PJLA 1KQ8A 5J4VA 4RAFA 3BCAA 2FA5A 1FMVA 3M7GA 3RQ4A 3DXJF 5EZHA 1MDMB 3AAFA 5EYRA 4OAYA 5FFXA 2EP3A 2YTDA 4OOGC 5IWAE 3KYDB 4RMNA 4V2FA 2PI0A 5C4XJ 1X1PA 1EH6A 2CSOA 2QEXI 1OISA 1QNTA 4BKXA 1YUJA 2Y48A 2WBSA 4W1UA 1LDDA 3S2DJ 1IRZA 2BZTA 1X2MA 4FK5C 1GTKA 4DR7E 1KQ0A 1WJBA 1QHGA 4P96A 2ID3A 1W36C 2OD5A 2KOUA 2VE8A 4H4KC 4XNFA 3HOXJ 2COBA 1RR8C 3TEDA 4WXCA 1XTAA 2IW5A 1NTCA 5D6FA 4M3DA 4U88A 2DJIA 1YJNI 5H6QA 3K4NA 1MD0A 4AWXB 1UHSA 2QQ8A 1R5ID 4HA8A 4M73A 1ZAOA 2CUFA 2RAEA 4DR2E 2JRTA 1DI2A 1W4MA 2Q2EB 4NBQA 4ZTJA 3AV0A 4AIHA 4NQWA 2R7OA 2CV1A 2E7XA 3ML6A 1HNWE 2R0QC 1ETOA 4BE2A 1IBKE 1O4XA 4XOPA 3ZMSA 1USSA 1WI3A 2QSGX 5CVUA 1IDZA 2YTEA 4HTGA 4L8NA 5BPIA 4XIDA 1MSFC 1LDJA 1TNTA 2AQEA 4M9SA 1G59A 4IOAF 4M30A 1RKWA 4U87A 1QGPA 1QU6A 1ON2A 2LY1A 1HLVA 4AYBN 3GTOJ 2LBFB 1ZTRA 3A0HC 5J1UA 2EN1A 4M6YA 2Q1ZB 2R7FA 2DPUA 2PX9A 4A93J 4ZYAA 4N0BA 1DPUA 1PJQA 1YJ9I 3DFGA 1TQMA 4X0GA 1H9TA 3A01B 5LFAA 4G94A 1B72A 4RB2C 3LFUA 5C4JJ 2OA4A 1KU7A 1B9MA 2LRDA 1PDAA 1K61A 1F9NA 1HC8A 1B72B 4IXAA 1T6SA 4IVNA 3KP7A 4KUMA 3CMAI 1FYKA 2E19A 1K78B 1SVOA 1B1BA 3CJRB 3RYPA 1YYVA 2R76A 1W1WE 1RR7A 1G3TA 3ASNH 1I6HJ 3BPVA 4BHBA 3T8TA 4RGUA 3OS2A 2NXNB 1MNDA 2ZJRF 3W2AA 2AO9A 3SFIA 1R7JA 5FB2A 1ZREA 1Z1BA 1R6RA 5GADJ 1W5TA 2WADA 2HS5A 3A03A 1MZBA 5K7FA 2QQBA 2ECBA 2ZFWA 3HYIA 1BI1A 5IT9Z 1LEAA 4NQWB 4XKBA 3W3CA 4A6DA 4BL0B 1POGA 2K85A 2DA2A 3FWEA 2EWNA 3EPHA 1ZLJA 4DYQA 3DTKA 4WWCA 4CH7A 2MDGA 1A1LA 4QPQA 4F9CB 1SD4A 2F6CA 3VSKA 4ABZA 3HQ1A 2DYSH 1WZ2A 1B4AA 1A6QA 2K3PA 2BBYA 5JVTA 2HC5A 1LE8B 3CCYA 2HFHA 3H92A 4CXFA 4IX7A 4JI8E 3H9JA 2VT2A 3ZMTA 3HOZJ 2YR2A 4ZDLA 2M3AA 2ENHA 5E79C 3LLHA 3BP8A 1IN4A 4AQYE 1Z6TA 3K0LA 3J80C 3CC2I 1AKHB 1X58A 2EMHA 3FMRA 4LITA 5ILSA 2P7CB 1FWZA 3PUBA 4QPOA 4A12A 2DFHA 3HUGB 4ITVA 2LT7A 2EPXA 3CF5F 1ZH5A 4HOBA 3TOAA 1T08B 2RQQA 2HDCA 3BQYA 3HTXA 2QWWA 2IHR1 2V6CA 2DK5A 2MLKA 2L3DA 3EUAA 1SEUA 2QUFA 3IWDA 3D5RC 2DPDA 2LE2A 1LVAA 1AH5A 2W1OA 3BT9A 3GZ5A 2ZB9A 2BY0A 4BJTA 5AE2A 3EUHC 2E72A 2YTGA 4LFUA 4UVAA 3ZP5A 3GTQJ 4GCVA 4E7KA 4M0VA 1P47A 4HF0A 3LSPA 1J09A 1TF3A 1FX7A 4M9XA 2LMZA 5AE1A 3HHHA 4KZSA 1APLC 2FXAA 3KP2A 4BHCA 3BR6A 3OR1C 2L2KB 2K9NA 2EN3A 2BOLA 5D5WB 2XAGA 3BR0A 3VDXA 1ITYA 1Z0XA 1JHHA 2AHQA 4HSRA 2EOSA 3TDUC 2K9SA 2NS8A 3OS0A 2VBWA 1UG0A 2K3FA 1PKPA 1WGXA 5DV5A 4HSTA 1UZCA 4RH8A 4LLNA 3ZN1A 4S0HB 2L9SA 4BC7A 1IMUA 1JKQC 2HOSA 1KU3A 3KFWX 3NQOA 1P4AA 4EM1A 1X3CA 2NS0A 4B09A 3K70D 1OCZH 3E5XA 1VFCA 4B3XA 5F1JA 1UBDC 5JI6A 2FBKA 1PJRA 2GAUA 4ZZLA 2YTJA 2M8EA 2NABA 1FC3A 4I8OA 1MBGA 4UUTA 1F1ZA 3L9FA 4BXUA 1ZGAA 3J7YJ 4FCYA 3F3XA 1YX5A 1SMYF 5EEHA 2XAUA 2DA7A 4P5OA 4KIBA 2EOFA 1R71A 1G8XA 1FOKA 3GTMJ 4PJNA 3ZQGA 2YTNA 3B02A 2H8WA 1FZPB 2CRGA 1YO5C 1A5JA 3MFKA 2JRMA 2Z33A 4J8ZA 2MBFA 2ISZA 4LF9E 4CCMA 1IQOA 1WSUA 4JI1E 2CSHA 2FRHA 1Q1HA 4ESJA 1FSHA 3E6MA 1Z3YA 2H94A 1JKRC 5E8GA 3HSEA 3ADJA 2M9HA 4MNUA 5IY5H 1I1GA 2KHXA 3GTLJ 4LJZF 4AVPA 4YFXF 2LREA 4HDVA 2JSCA 2E2JJ 4FT8A 1XS9A 2BGCA 3HEFA 1FBUA 2CFXA 4J01A 3GF2A 5EGOB 3FK6A 5DCMB 4A3MJ 4IRHA 2ZJPF 4NZVA 3HB9A 5KL4A 1OCOH 5BPDA 2X1CA 3BTIA 1ETYA 2KZGA 4UB8C 1WWXA 2XUBA 3KEQA 1SAXA 3PSIA 1I50J 1X4OA 1BOAA 5AE3A 3K2AA 5LEKA 2VBZA 3L2RA 3C2HA 3M1CA 1LDKB 3KP6A 4CYCB 4KIFA 2ZKZA 3OIOA 5HS9A 1XSXA 2KRCA 2EIJH 3AL0C 2MD5A 2E1CA 1JJ8C 4IF4A 2L92A 4AIJA 5E18F 3OYHA 2KP6A 1UHMA 2E2HJ 1R23A 1DGCA 2PMUA 3LMLA 3I5UA 1PUFA 2UXXA 1JT6A 3WHBA 1R1VA 5E3NA 1T4OA 4DV2E 2VOPA 2EMFA 5LL6R 4FX4A 4Y7NJ 1S72I 2EWLA 2EFPA 1ENHA 2XC7A 2WAFA 1U0JA 3FXUA 3H35A 4XSZF 3BJOA 2QF7A 2KIUA 1RUNA 2L3JA 3LA2A 3WU0A 1E0EA 1OCRH 2ME0A 5FJ8J 3HHGA 2MC4A 2NOJB 5ED4A 2EM6A 1BN5A 3LSHA 4K0KE 2QYOA 1YYOA 2XGEA 3SZGA 4HLYA 1A35A 4AYBA 1P9QC 1MJAA 1MKMA 2YU5A 4N4RB 4DUZE 2BVLA 1ULYA 1RNLA 2BY1A 4L9NA 2B9SA 3GLXA 1IN6A 3DLAA 3FMQA 1KYWA 3K4JA 1T4LB 1IRGA 3KZYA 5HS7A 1HSTA 4O6JA 2FJ1A 2WTEA 5HDGA 2QGUA 1OYIA 4M3BA 3S14J 2O7OA 2V1DA 1LVKA 3ECOA 2EQ0A 2COMA 2E36A 2VQHA 3ABMH 3S93A 1SVMA 4C2MJ 5IYCJ 2ICWG 3MKZA 3H3ZA 3A01A 1PJSA 5FGMA 1Z21A 3GUDA 4HV5A 1WJ5A 2DMPA 2EZLA 4NB5A 1GXPA 5CVIA 2HDDA 4BXXJ 2R3SA 3DPUA 1O3RA 2EOYA 3JAMZ
chains in the Genus database with same CATH topology
2V88A 4RB1A 2A3SA 4A5MA 4ZZDA 1BJAA 2TDXA 5D4RA 4EM0B 3V8KA 2A61A 4UHTA 1SMTA 2M87A 5JR3A 4U7DA 3CTAA 2XAHA 1O7FA 1V3FA 4RAZA 2PBIA 5FO5A 5D8LB 4G8XA 4KMFA 1I1SA 2FOKA 3RKWA 3LA3A 2DW4A 4I98B 3DV8A 4F9AB 1IUYA 3HRUA 4WCGA 4U0VA 3I53A 2MC3A 2K4BA 3NRVA 1E17A 2LJHA 2O03A 2QZ8A 5JHUA 1B59A 4LB6B 1KU9A 1HW1A 4IPAA 5CVVA 4BNCA 1MJBA 2O8XA 1XNRE 1R1UA 3FX3A 3RI4A 3FM5A 5LGUA 3F6GA 1FJGE 4D0PA 1G6NA 1F5TA 3QAHA 4EJWA 4LFAE 4HBLA 4GO1A 3HPZA 1I94E 1XGOA 5D6EA 3JU0A 2H6CA 1IZ1A 3WTZA 3I54A 3K69A 4Y15A 3ZPLA 3R61A 3DF8A 2P8TA 3VYXA 1PUEE 1I27A 2QM3A 4WFTA 2M30A 4UNOA 3ZOQB 3P9CA 3IHUA 2NRAC 2LTSA 2WV0A 2E1MA 4FHTA 3REOA 4EGZA 1EH7A 1ZBTA 3HRTA 1QQIA 1BI3A 4EVIA 5ADZA 4BQAA 2X4HA 1HW2A 1YZ9A 3CO7C 3JSOA 4B3TE 2LDUA 2KIFA 4CGZA 1EH8A 2YT4A 2Z5UA 2JZYA 2XKOA 4JI4E 2EFNA 2VT3A 4AIKA 1I6XA 2P5VA 2C6YA 1XMAA 1IN5A 3E5QA 3C4BA 5CVJA 3JTHA 3PFIA 4CDGA 5T6JA 4LF4E 4I09A 1UHZA 3HOSA 3P9KA 2ZNZA 2FBHA 1P4WA 2YX4A 2ZMEB 4Q28A 3KP4A 3J81C 2CO5A 4G9YA 4WXHA 1HKSA 3ISPA 3VB2A 1N36E 3I58A 4TUGA 1WKMA 1WHNA 4MHGA 4DMIA 5BR8E 5A2QC 2G7UA 3HRMA 4A6EA 1XMQE 2DT5A 4WK8F 3N97A 2A6HF 5D4SA 4I2OA 3M9AA 4ASNA 5L3CA 1JE8A 2K02A 5BQTA 3L7WA 4P9UA 4OMYA 4LK1F 5BMZA 4BHPA 2YZTA 3M8EA 1WI9A 2A68F 1S8NA 2Z99A 1A04A 2UZKA 3QU3A 1LB2A 3I59A 4MGRA 5J8CA 1UB9A 1JGSA 3COAC 3CUQA 1KA8A 4IJAA 4Q5SF 2F5EA 2PEXA 4ZYHA 2ELHA 3IKTA 4O5VA 2EV0A 5AONA 1R58A 4OIPF 3KP5A 2DQLA 2LKPA 4U7BA 2EFWA 2H09A 4ZYEA 1U2WA 1LQ1A 3F8MA 2JTVA 2NYXA 4OINF 3EDPA 4GYIA 2UXCE 3HSFA 3B73A 4XLNF 1ZN2A 4BBYA 4EQQA 3WTTC 1TLHB 4U0YA 1U8RA 2KONA 2J5OA 3ADGA 1XMOE 4X8WA 2HGCA 3LAJA 2Y75A 1RUOA 1G3WA 3GEZA 5F1RA 1FYLA 2AXLA 4AD9A 3V4GA 1VTNC 3SZTA 2V87A 1BIAA 4P9FA 3RJPA 3WTYC 4ENKA 3KP3A 3RMPA 2O61A 3CJNA 2HKXA 1TNSA 1O57A 1N34E 4ETSA 3J7AG 1WQ2A 3WTWC 4HLXA 2QQAA 2VE7C 2M4IA 4WX9A 3HSRA 1ZARA 2RDPA 4JYAE 3QP5A 4KDPA 1FSEA 4Q4ZF 2GQQA 1FNNA 1G3SA 5FD5A 3TGNA 3PQKA 5HS8A 4RGRA 4GXOA 3ADIA 3E5UA 3M1EA 3F6HA 1YS7A 2XAFA 4UUVA 3GX4X 3WTUC 1XDSA 2XKPA 1OMIA 3EYIA 2XRNA 2OZ6A 1IXCA 2NUGA 3FIGA 2JPCA 2RV8A 4B3ME 4Q48A 5J6XA 4DV6E 3K2ZA 1P6RA 1FY7A 1UHWA 4PGHA 4QWQA 3FZVA 3MZHA 2V1XA 2JOXA 3U9GA 1WHQA 3CLOA 2DK8A 3RPUA 4MQVA 5DEQA 4L0ZB 2P6SA 1W7PD 4A5NA 4OIRF 4RGSA 1GZ6A 3ZMDA 4XLPF 1JXSA 1QO0D 5E17F 1KYZA 4L5IA 1S3JA 2Y0MA 4R1HA 5J8FA 2LF8A 2CW0F 3R0JA 1ZRCA 1X48A 2ESHA 4DV1E 3M8FA 1IBME 2ADUA 3ZQ7A 1PP7U 4G7HF 4L9VA 1L0OC 5K5OA 3E6BA 3W6JB 4A0YA 4LLLA 4HQMA 5FLXZ 5A2QZ 2H6BA 4DV5E 3GVAA 4M9ZA 1RC7A 2RGVA 4HQEA 4MTEA 2MC5A 3J81Z 1YW9A 3JAMC 4HZFA 4YHHE 2L02A 4OX9E 2Q0OA 1IW7F 4YY3E 3E6CC 3E3VA 1OR7A 2Q8KA 1O3TA 3BJAA 2ZO4A 3KWRA 1KQ9A 2P5KA 5BS6A 1P2FA 2ZCWA 4LF8E 3IWZA 1TQPA 2IA0A 1XSVA 4BMJA 4YFNF 4LF6E 5DCFA 2K27A 3I59B 2JOBA 4UV9A 4DR1E 3FM3A 2DLLA 2H27A 2L33A 3JTGA 2PMHA 3IKVA 4M6XA 1K6OA 2UUAE 2QBYA 2IPQX 2N3HA 2ACJA 3OOPA 3IRRA 3DF6A 3TO7A 1IXRC 2EFOA 3IWCA 5E20A 1AOYA 1YYWA 1RQ0A 1SD6A 3J80K 2OAZA 4I0AA 3HRSA 1IRFA 4UV8A 4P78A 2KJCA 4L18B 4L0YB 1TQIA 3I71A 3HTSB 3DEUA 3O3KA 1J59A 1XMKA 3FXQA 3MCZA 2EA2A 2E7WA 4M2ZA 4HX8A 5E1WA 4B3SE 2PFBA 1Z9CA 2JPBA 1SD7A 4MQ9F 1XB4A 5LHGA 5D5VB 3QPTA 2D1HA 4P55A 1GHCA 2W57A 4DNCA 2DQRA 3L00A 2V8QB 3P9IA 5ERIA 4LFBE 4YIFA 3DQVC 1USTA 2BV6A 1T39A 1FKAE 3FF5A 2QQ9A 2STTA 1OYWA 1Z91A 2RTXA 4F9BB 2RS7A 2L4AA 1Z7UA 3ZMUA 1K79A 4BAYA 1XDUA 1UCRA 4MEXF 1GVJA 1WRJA 2VONA 4EV0A 1O3SA 3KZZA 3O6BB 1HR0E 1X3UA 2OQRA 2PLYA 2A69F 3WG9A 5FLXK 5A2QK 2NAZA 5IT3A 2XGXA 1BI0A 4EJVA 3ADLA 1ON1A 2QENA 5ILVA 3GFIA 3T1BA 4NHJA 4XBFA 3BROA 4UVCA 2F2EA 3DKWA 3J80Z 5KVRA 2L6MA 1IBLE 2ZNYA 1BC7C 2NNYA 3RDIA 2CQKA 1J26A 5ILUA 5BOXA 5E8IA 1O0WA 1TW2A 1J2XA 3RYRA 3F8FA 5LMUE 2K7LA 2D2WA 3BOQA 1ZGJA 2YSRA 2LUPB 5LHIA 2IA2A 4LGWA 3C7JA 4DV7E 3AUZA 3QOPA 3V7RA 1DP7P 1NHAA 3GYHX 1W7PB 2RNJA 3RKXA 2FE3A 1YS6A 4ON0A 2O6GE 1Z05A 1O3QA 4Y13A 5F64A 1QZYA 2KKOA 2DFIA 2P6TA 4BS9A 4KIGA 1HSJA 1R1TA 4GYGA 1D8JA 1X49A 1R5GA 5F6FA 4TUIA 3EUHA 3ECHA 2FV4B 3F22A 3RPQA 2CG4A 2L2MA 2M5WA 3TDZC 2RQPA 4LB5A 3BWGA 3R4KA 1J7KA 1TW3A 2HYFA 2V1UA 3C3WA 4A2UA 5DNYA 1XCVA 2ODRC 1J9IA 1SFEA 1XCBA 4L9TA 2ODRD 4JV5E 2BE5F 2HTSA 4Y17A 2FGGA 1T4NA 3MZYA 4DR6E 1CF7A 2DSYA 4HDUA 2LBSB 4MEYF 2JVAA 4TV7A 1YW8A 3R6SA 3MQ0A 1OKRA 1WXRA 4KFCA 1IAWA 2N3GA 4OU0A 4IRIA 4R03A 3F6VA 2BEOA 3SZPA 4OOIA 5AASA 2O3FA 3DJWA 3HIFA 4LMYA 1PP8F 1YFHA 4I7HA 2KJBA 4EJUA 3FHZA 3T5XA 2HQNA 4R79A 3LSTA 5HLGA 3K1MA 3C1DA 4XSXF 3DPLC 2VN2A 1YTYA 3ZN0A 4I01A 3K6QA 3EETA 1IN7A 5ICEA 2ETHA 2XAJA 4F7ZA 2JWOA 4R8OA 2DB2A 1E2XA 1CGPA 1ZRFA 1HW5A 1MDMA 4JI6E 3VEPA 4HW0A 2MC6A 3BZ6A 2LRSA 2XVCA 2K4VA 2DI3A 4IRGA 2DBBA 1O7LA 3HTUA 2HR3A 2YX7A 2VQEE 3U1DA 4OIOF 4JI3E 2K86A 1BBYA 6PAXA 4S04A 3GWZA 2V85A 1K7AA 4M74A 3H09A 2D45A 3LWFA 5CJ9A 1GQEA 2EV5A 2LF7A 4HF1A 2J5PA 2M45A 2XIGA 1X47A 3KCCA 2VC0A 3H3UA 5JFRA 2FNPA 2ISYA 1ZRDA 4CYDA 3LAPA 5D5XB 1H9GA 2RSMA 5L3FA 2RKHA 3LA7A 4G6DA 2CYYA 3QP6A 4HX7A 5TRDA 3F6OA 1YW7A 2QLZA 2IA1A 5HLHA 3QRFF 4HF2A 3S2WA 1AWCA 4HX4A 3CUOA 4U0WA 2FF4A 3KLNA 3WGHA 2UUCE 4UVBA 3MWMA 1QBJA 4WPYA 1XGNA 1J75A 2RN7A 4ZH4F 2IT0A 4XRFA 4ZYDA 3V7CA 4YG2F 2DU9A 2E1NA 4RAYA 1L3LA 3VYYA 2WC2A 3F8BA 2H36X 2FMYA 5HOOA 1HKTA 4ENMA 3QPHA 3SFZA 3JAMK 3CO6C 2B7VA 1OYYA 4JI5E 4P7DA 3F8NA 1BM9A 1T0FA 4OMZA 4KICA 2B0LA 3J81K 2M7QA 1N32E 2FMLA 3CDHA 3T0YA 1LJ9A 4ESBA 1MJ9A 2V83A 3NEUA 2EZ6A 2L54A 3F23A 4A0XA 4CICA 4CZZA 3BPXA 3TO9A 4EJOA 4E70A 1HBXG 2QVOA 3OV8A 1S6LA 2JT1A 4EMSA 3GFMA 2Z3YA 2IRFG 3WTXC 2ESNA 1GXQA 2CGPA 3K1PA 3WTVC 3D0SA 1U78A 1ZG3A 2X0LA 5DCMA 3ABTA 3WODF 1TTYA 3P1XA 3GW2A 4M72A 5AIQA 4CO8A 2EV6A 4F54A 2IJLA 3I64A 4NXME 4KN7X 2F8BA 2FNAA 3TQNA 2L2NA 2YU3A 1QZZA 1XNQE 1TBXA 5LBQA 2VOOA 4IHTA 1HXDA 2B7TA 2HHHE 3T1HE 2HZTA 4YFKF 1U5TB 3Q9VA 1RI7A 1I5ZA 4KMUX 3BDDA 3TOBA 2W84A 2P5LC 4HYEA 5LGNA 2LTRA 3K1NA 2Q2EA 1F4KA 1FLIA 4JI7E 3GO5A 2CPNA 1ODDA 4WXDA 4GGGA 4RB3C 1YIOA 2STWA 1U6GA 3C18A 2NNNA 2QBYB 3DPTA 3L2CA 2EJRA 4ESFA 4A0ZA 5LMNE 2JY9A 2HYGD 2FTXB 3ELKA 2DMYA 3GFJA 2PG4A 2M1BA 1FYMA 4ENJA 3Q5FA 2VQFE 1G4DA 2A5YB 4LG0A 4G6QA 5EEGA 4EGYA 5LHHA 2XROA 2KRFA 2VODA 4FX0A 4WF2A 3IWBA 1N33E 4KHPE 2HEOA 1XN7A 3JW4A 1RIOH 2RC4A 5L3DA 3EQLF 3MAJA 3EYYA 4X64E 5L3GA 4PGGA 2F5DA 4DR5E 1UFMA 1YYKA 2V79A 3RKYA 5HDNA 5LRSA 1RZ4A 4KT5C 3Q9SA 4L9JA 5KK1A 3KE2A 4Z2YA 2OZUA 2HKOA 2MH9A 1W7PA 1FT9A 3QU6A 5DUKA 1B9NA 3FXRA 1SFXA 4LFCE 2GA2A 4KNYA 2PQ8A 2VBXA 1LNWA 1FP2A 2WZOA 4R8HA 4EJTA 5ICFA 3V8LA 1REPC 3TO6A 5FLXC 5HVQC 1V4RA 1IN8A 1STUA 3F8CA 2L4MA 4BC9A 5H6RA 2V86A 4CHUA 4LTYA 1FBSA 2B3TB 2BYVE 2HQRA 2ZBKA 1BIBA 3FMSA 5HDKA 3IWFA 5K5RA 2DTRA 1G3YA 5L3EA 2LSOA 1XGSA 4G7ZF 1ZG5A 3HUGA 4DR4E 3F21A 2E5LE 2UXDE 1IF1A 5K1YA 3WE3A 1UILA 4BH9A 3C4TA 3ZMVA 3HOTA 4JI2E 3JSPA 4I0BA 1H0MA 2XAQA 4ENNA 2XV4S 2RS6A 3BY6A 3RTRA 2JR1A 1YG2A 3ULQB 1JHFA 3PQJA 2FSWA 5AIPA 4KYWA 3U2RA 3KEOA 2YPRA 2HWVA 1R5HA 2FBIA 5D5UB 2G7HA 1R36A 3G73A 2ZMEA 3R60A 5ICCA 3HPSA 2XHKA 2GA1A 4X66E 5DDGA 4HV6A 2NA2A 1S7AA 2UU9E 2FQ3A 2UUBE 4LK0F 5D8KB 4N9IA 5CVRA 1ZLKA 1YQAA 4B3RE 4K2EA 4N9HA 2DIXA 1STZA 2F5FA 2DO7A 1B6AA 2HTJA 1J5YA 2MA3A 4S05A 2VC1A 3HXLA 4DQ2A 2GZWA 1C0WA 2VXZA 5DD4A 5F3WA 1ZHFA 4X62E 1HKQA 4DV3E 3OTOE 3D5LA 3V7SA 2K4JA 2EB7A 2FU4A 4PDKA 2LNBA 4WSPA 1PDNC 5DYMA 3LQQA 3ABUA 3I0TA 2EA4A 3P7NA 1SFUA 4DR3E 2Z9OA 2UXBE 1BC8C 4LD5A 4JBAA 4YIIA 2O0YA 4HAMA 3ROUA 4JI0E 4M71A 2PJPA 3IRQA 2GWRA 3I4PA 4DKKA 3SHFA 5DD8A 2D1VA 3SQNA 4JK1X 2A07F 3LFKA 2FEZA 3IC7A 2ZM6E 1EKZA 4QLCU 1U5TA 2IVMA 5IT9K 1R22A 3VOEA 3T1YE 1U3EM 3KLOA 1KU2A 1MGTA 2P4WA 3J7AO 3J7Yp 2G9WA 1ZG1A 4G7OF 4NXNE 1Z6RA 1SD5A 3VODA 4LU9A 3IL2A 2MH2A 3BJ6A 1S29A 2CWEA 2L3CA 1XSDA 1W5SA 3KETA 2GXGA 5LEJA 2MDRA 4BCAA 2F4VE 4GKJE 1SR9A 4LF5E 1CF7B 3JTZA 1DDNA 2ZJ2A 5E1ZB 2GXBA 4OIQF 5L3BA 2V89A 1Z1DA 3V8JA 3GZ6A 4PZJA 1D3YA 5IT9C 2HOEA 4PCQA 2P7VB 5FD6A 1P92A 1K78A 1LEBA 4L5JA 5E1XA 4EM2A 3E97A 1U5TC 5LRRA 3ZMZA 4UXNA 5LGTA 3GFLA 4DV0E 1DQ3A 1HNXE 2EFQA 3G3ZA 1HQCA 2ZXJA 3L09A 3LQRA 4RB0A 1ONVA 2L8TA 4X65E 1KGSA 1T98A 1ZBQA 4B8XA 3R0AA 5CLSA 1D8KA 2L01A 4MTDA 2LUQA 2GIVA 1S7OA 3WGGA 3OMLA 4L5NC 4RGXA 1YLFA 3ERED 3WGIA 2RVCA 4RS8A 2KIMA 3RIRA 3SXYA 4KA4A 2PN6A 2VF1A 1IXSB 1T38A 4ZYGA 4BYYA 4GEQB 2IP2A 1DUXC 2W24A 1XD7A 4O3MA 3CUQC 2AS5F 4WYQB 3TKYA 4DUYE 1QPMA 3GXOA 2OQGA 5CYVA 1J0RA 2OU2A 3VK6A 1Y0UA 4KN4X 2B9DA 1XGMA 5K5QA 4LF7E 2MLGA 2UWMA 4Q47A 1HNZE 2EK5A 3O2PE 2NUEA 1R00A 2WWYA 4JQFA 4IHSA 2UXNA 4LG0B 3F72A 3DP7A 2W25A 3MEXA 3VFZA 5DUIA 1FBQA 1FPQA 2XASA 1P4XA 3E6DA 2VE9A 1DPRA 2OBPA 2NUFA 1OPCA 1EV7A 5H20A 3W6KB 5HLIA 3WU1B 5TJJA 1ZYRF 1D5VA 3N4MA 1FP1D 5CFFE 3WTSC 4I02A 2M1SA 3CUQB 1J5EE