4GZNC

Mouse zfp57 zinc fingers in complex with methylated dna
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
59
structure length
59
Chain Sequence
SERPFFCNFCGKTYRDASGLSRHRRAHLGYRPRSCPECGKCFRDQSEVNRHLKVHQNKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*TP*AP*TP*TP*GP*CP*(5CM)P*GP*CP*AP*G)-3')
publication title An atomic model of Zfp57 recognition of CpG methylation within a specific DNA sequence.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 19
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4gznC02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4gznC01
2EQ0A 4R2QA 2EOFA 2ELYA 2YRKA 4R2DA 2EN2A 1BBOA 2YSPA 1ZU1A 2YTOA 2LCEA 1YSAC 4F6NA 2EM6A 2EN4A 2EN3A 2EPAA 2EOXA 1UBDC 2YRMA 1A1GA 2EL5A 2EJ4A 2YSOA 5KL7A 3MHSC 2MKNA 2EN8A 1RMDA 2EMXA 5KL4A 1A1IA 2EOIA 1TF3A 2GLIA 2EMIA 4R2EA 2BB8A 2EMHA 2J7JA 2YTNA 2EPCA 1F2IG 2LVHA 2EMGA 2EOYA 2LO3A 1A1HA 4M9VC 2R1FA 1Z1BA 2EN7A 2EOMA 4R2RA 2YU8A 2EOQA 2EP3A 3M99B 2EMAA 4X9JA 2HGHA 2EM2A 2EMCA 2EQ1A 2EMWA 4FK5C 4WSGA 1NCSA 4R2AA 1X3CA 3UK3C 3EPHA 2EOZA 1X5WA 3EPJA 4GZNC 1B69A 2CTDA 2D9HA 2DLQA 2EPPA 1A1FA 2MKDA 1A1JA 2EL4A 2WBUA 4R2CA 2CSHA 2E72A 2EPRA 2EL6A 1UN6B 3VHTB 2LT7A 2YTFA 1JK2A 1AAYA 1DGCA 2NABA 5KL2A 2EM4A 5KL5A 5KL6A 2EMKA 2LV2A 3EPLA 1TF6A 2YTGA 2DLKA 2DMIA 2EOOA 2EPZA 1LLMC 2DRPA 2EM3A 2EM7A 2YTQA 2WBSA 2RPCA 2YU5A 2ADRA 2EM5A 2JPAA 2YTDA 1WJPA 4IS1C 2EM9A 2WCC3 2EM0A 2YTIA 1G2DC 1G2FC 2EOHA 2EPUA 2A25A 4R2SA 2PRTA 2RSIA 2EOJA 1MEYC 2EN1A 2EMLA 1P47A 2ENAA 2YTJA 4F6MA 3MHHC 2EORA 5KL3A 2EPXA 3EPKA 2JP9A 1BB8A 2EMFA 2EMYA 2EM8A 1YUIA 2MDGA 1KJKA 2EMZA 1A1LA 2M9AA 2I13A 1YUJA 2YRHA 1X6FA 2ENCA 1ZR9A 2EN6A 4R2PA 2YTEA 1A1KA 2EE8A 1ZAAC 2DGCA 1X6EA 2ELZA 2EMBA 4F2JC 2EQ3A 2GHFA 2VRDA 1TN9A 2WBTA 1JK1A 2EOSA 2ENHA 2EOEA 2YTPA 4IJDA 2CT1A 1X6HA
chains in the Genus database with same CATH superfamily
2EWLA 4DUYE 2KHXA 4JI8E 5AASA 2EOFA 3J7Yp 2UXBE 2YRKA 4X64E 1X47A 2VE7C 1YYOA 2JYAA 1WHNA 2YTOA 5LMNE 4DV0E 3IWDA 2EM6A 4F6NA 1UBDC 1STUA 2YRMA 2N3GA 3THOB 1N32E 3MHSC 2L2NA 2DB2A 3ADIA 1RMDA 2EMXA 3KZZA 1GZ6A 2GLIA 2EMIA 4ZYHA 5CFFE 2EMGA 1J5EE 1PJQA 4JI5E 2EM2A 5AE2A 2EMWA 4R2AA 1X3CA 3UK3C 2LRSA 4GEQB 4X8WA 5DNYA 1X5WA 3EPJA 3JTZA 5LLQA 2CTDA 4X66E 1A1JA 3BBGA 2WBUA 4K0KE 5T6JA 3J80C 1JK2A 4P7DA 4DV2E 4WXCA 5KL5A 5KL6A 2LV2A 1N33E 4X62E 3EPLA 3ZOQB 2DLKA 1EH8A 1IQSA 1YYKA 1LLMC 2EPZA 2DRPA 2LUPB 2RPCA 2YU5A 3C4BA 2EM5A 4DR6E 1WJPA 3HQ1A 4NXME 2RS6A 2UUAE 1X49A 3EQ1A 2H36X 2RSIA 2E5LE 4ZYDA 1MEYC 4DR7E 2EMLA 4JI1E 3IWBA 3L00A 2EPXA 2EPKX 4LTYA 3EPKA 2JP9A 1HNXE 2FTXB 4KHPE 4BHCA 4DV1E 2LTRA 3F6GA 4X65E 2V89A 1A1LA 4F9CB 2YRHA 1HNWE 2ENCA 4R2PA 1ZAAC 4YY3E 2YWQA 1X6EA 2KONA 1EH7A 1IBLE 3HPSA 5AE3A 2EOEA 2YTPA 4BBYA 4DR5E 2JVAA 4RH8A 1EKZA 2B9DA 3TQMA 1Z1BA 2EQ0A 5IV8B 4R2QA 4Q28A 2NUFA 1L4SA 2EN2A 3T1YE 1BBOA 1ZU1A 4DR2E 4BMJA 4B3ME 2EN3A 4N4RB 2EOXA 4I8OA 2WZOA 1A1GA 4DR1E 2EL5A 2EJ4A 2VQEE 2RQLA 1RQ0A 2LJUA 1YFHA 1YYWA 2L3CA 2EN8A 1A1IA 2HHHE 2ZM6E 5LMUE 3DF6A 3OTOE 3HTXA 1WRJA 1F2IG 1HNZE 2LO3A 2IHR1 1A1HA 4M9VC 1KYQA 2JOBA 2M7QA 4P78A 4DV6E 2LJHA 1T38A 4R2RA 2YU8A 2V85A 4YHHE 2EP3A 4O4KA 2EQ1A 2JXPA 3EPHA 3P1XA 2EOZA 3OMLA 5A6AA 3BGHA 3KWRA 1A1FA 4BS9A 1DQ3A 2MKDA 2E72A 4JI7E 1ZBTA 2RTXA 3IWCA 1UN6B 2YTFA 1AAYA 3VK6A 1WHQA 2EM4A 3LMLA 1N36E 2EMKA 2K7IA 2I9IA 1GTKA 1X48A 2LUQA 4BCAA 2ODRC 2DMIA 3K6QA 5IWAE 2EM3A 4JI6E 2LE2A 5A6BA 5ADZA 4DV7E 2JPAA 2UXDE 4IS1C 2V83A 2EZ6A 2EM0A 2CPNA 2YTIA 1RC7A 1IBME 1G2FC 3BIDA 4R2SA 3QG5C 4LFBE 4LFCE 2EOJA 3AV0A 2VQFE 2Q8UA 2ENAA 4DV3E 5A6JA 2EORA 2MDRA 1UILA 1BBGA 2GPIA 2EMYA 2E1MA 4M30A 4DKKA 1SR9A 1X6FA 4B3SE 2G7HA 4NZVA 1PKPA 4TUGA 2YTEA 2EE8A 4L8NA 4KWYA 4LF5E 3VYXA 1TN9A 4IJDA 4WXDA 4NHRA 4M2ZA 1X6HA 4MLQA 2L2MA 2L3JA 2NA2A 2DIXA 4OOGC 3HPZA 2JWOA 4R2DA 2YSPA 2LCEA 2LBSB 1QNTA 2DMYA 2EN4A 2LTSA 2YSOA 5KL7A 2F8BA 1IBKE 3C6KA 2EOIA 2M4IA 1TF3A 4TUIA 2HJJA 2BB8A 1IQOA 2EPCA 4OX9E 2EOYA 4B3TE 1QU6A 4O24A 2EOMA 1FJGE 2N8XA 3DJWA 2YPNA 2EOQA 3M99B 1N34E 4O43A 4WYQB 2EMCA 2V86A 4FK5C 4LF9E 4JYAE 4WSGA 1NCSA 1AH5A 1T4NA 4GZNC 1B69A 4LF4E 2YT4A 1SFEA 1YZ9A 4HEIA 2V88A 2EL4A 4R2CA 2CSHA 2EPRA 2LMZA 3F6HA 2UU9E 2EL6A 1DGCA 2NABA 2MC5A 3ECRA 5AC4A 4KZSA 4BC7A 1TF6A 1YPNA 4LF6E 1NEIA 4ZYGA 1UHZA 3J7AG 1ZBQA 2EM7A 2YTQA 4WX9A 2WBSA 2ADRA 2MC6A 2YTDA 4J8ZA 2ODRD 2WCC3 2NUEA 3RMPA 4LF8E 1T4LB 1G2DC 2EPUA 4R03A 4BHBA 2PRTA 4WPYA 4JV5E 2EN1A 4DV4E 1P47A 4F6MA 3MHHC 4BC9A 2V8QB 5KL3A 4AQYE 1T39A 2UUCE 1PJSA 2L33A 5BR8E 2EM8A 2MDGA 1KJKA 2M9AA 2I13A 2RSMA 2EN6A 5AE1A 4F9BB 2R76A 2ELZA 5A69A 2GHFA 2L6MA 5AC5A 2HC5A 2WBTA 1PDAA 2EOSA 1JK1A 2B7VA 3C6MA 3MSWA 2CT1A 5IXMB 5FLXC 1XNQE 3ADJA 2ELYA 2VF1A 4DR4E 1YSAC 2V87A 3AUZA 2EPAA 2DSYA 4ZYEA 2M1SA 4JI3E 4JI2E 2FGGA 2MKNA 5A6KA 5KL4A 1O0WA 4R2EA 1XMOE 2EMHA 2J7JA 2YTNA 4O5GA 3JU0A 2B3TB 2LVHA 4DMIA 2JY9A 2R1FA 2NUGA 4RHBB 4WFTA 2EN7A 1XNRE 4LF7E 4DUZE 4DR3E 4LU9A 2EMAA 1J26A 4X9JA 2HGHA 1GQEA 1MGTA 3T1HE 2L92A 2EPMX 4F9AB 3J81C 1I94E 1EH6A 1XMQE 2D9HA 2DLQA 2EPPA 3FIGA 3C4TA 3HXLA 2RS7A 3VHTB 2KOUA 2LT7A 2FV4B 5IT9C 5KL2A 2UUBE 4JI0E 4L5NC 2K4VA 4B3RE 3BF2A 2YTGA 2EOOA 3THNA 5A6BD 1T4OA 1PJTA 3H09A 2YZTA 2EM9A 2L8TA 5TSEA 2UXCE 2EOHA 2A25A 4HTGA 3KZYA 4GKKE 2EPLX 2F4VE 4GKJE 4M0VA 4Q35B 1WXRA 2YTJA 2EPNA 4JI4E 3LLHA 3ADLA 4DV5E 1BB8A 2EMFA 5F3WA 2L2KB 1YUIA 2JOXA 3ADGA 2EPOA 5LL6R 2EMZA 2N3HA 1YUJA 5A2QC 1N3GA 1HR0E 1ZR9A 4LFAE 3JAMC 2B7TA 1FKAE 1A1KA 4WSPA 2DGCA 2EMBA 4F2JC 2EQ3A 1DI2A 2VRDA 2BBGA 4R8OA 3VYYA 2ENHA 4MLVA 1IMUA 4F54A 4NXNE 2JR1A
chains in the Genus database with same CATH topology
2EQ0A 4R2QA 2EOFA 2ELYA 2YRKA 4R2DA 2EN2A 1BBOA 2YSPA 1ZU1A 2YTOA 2LCEA 1YSAC 4F6NA 2EM6A 2EN4A 2EN3A 2EPAA 2EOXA 1UBDC 2YRMA 1A1GA 2EL5A 2EJ4A 2YSOA 5KL7A 3MHSC 2MKNA 2EN8A 1RMDA 2EMXA 5KL4A 1A1IA 2EOIA 1TF3A 2GLIA 2EMIA 4R2EA 2BB8A 2EMHA 2J7JA 2YTNA 2EPCA 1F2IG 2LVHA 2EMGA 2EOYA 2LO3A 1A1HA 4M9VC 2R1FA 1Z1BA 2EN7A 2EOMA 4R2RA 2YU8A 2EOQA 2EP3A 3M99B 2EMAA 4X9JA 2HGHA 2EM2A 2EMCA 2EQ1A 2EMWA 4FK5C 4WSGA 1NCSA 4R2AA 1X3CA 3UK3C 3EPHA 2EOZA 1X5WA 3EPJA 4GZNC 1B69A 2CTDA 2D9HA 2DLQA 2EPPA 1A1FA 2MKDA 1A1JA 2EL4A 2WBUA 4R2CA 2CSHA 2E72A 2EPRA 2EL6A 1UN6B 3VHTB 2LT7A 2YTFA 1JK2A 1AAYA 1DGCA 2NABA 5KL2A 2EM4A 5KL5A 5KL6A 2EMKA 2LV2A 3EPLA 1TF6A 2YTGA 2DLKA 2DMIA 2EOOA 2EPZA 1LLMC 2DRPA 2EM3A 2EM7A 2YTQA 2WBSA 2RPCA 2YU5A 2ADRA 2EM5A 2JPAA 2YTDA 1WJPA 4IS1C 2EM9A 2WCC3 2EM0A 2YTIA 1G2DC 1G2FC 2EOHA 2EPUA 2A25A 4R2SA 2PRTA 2RSIA 2EOJA 1MEYC 2EN1A 2EMLA 1P47A 2ENAA 2YTJA 4F6MA 3MHHC 2EORA 5KL3A 2EPXA 3EPKA 2JP9A 1BB8A 2EMFA 2EMYA 2EM8A 1YUIA 2MDGA 1KJKA 2EMZA 1A1LA 2M9AA 2I13A 1YUJA 2YRHA 1X6FA 2ENCA 1ZR9A 2EN6A 4R2PA 2YTEA 1A1KA 2EE8A 1ZAAC 2DGCA 1X6EA 2ELZA 2EMBA 4F2JC 2EQ3A 2GHFA 2VRDA 1TN9A 2WBTA 1JK1A 2EOSA 2ENHA 2EOEA 2YTPA 4IJDA 2CT1A 1X6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EQ0 A;  4R2Q A;  2EOF A;  2ELY A;  2YRK A;  4R2D A;  2EN2 A;  1BBO A;  2YSP A;  1ZU1 A;  2YTO A;  2LCE A;  1YSA C;  4F6N A;  2EM6 A;  2EN4 A;  2EN3 A;  2EPA A;  2EOX A;  1UBD C;  2YRM A;  1A1G A;  2EL5 A;  2EJ4 A;  2YSO A;  5KL7 A;  3MHS C;  2MKN A;  2EN8 A;  1RMD A;  2EMX A;  5KL4 A;  1A1I A;  2EOI A;  1TF3 A;  2GLI A;  2EMI A;  4R2E A;  2BB8 A;  2EMH A;  2J7J A;  2YTN A;  2EPC A;  1F2I G;  2LVH A;  2EMG A;  2EOY A;  2LO3 A;  1A1H A;  4M9V C;  2R1F A;  1Z1B A;  2EN7 A;  2EOM A;  4R2R A;  2YU8 A;  2EOQ A;  2EP3 A;  3M99 B;  2EMA A;  4X9J A;  2HGH A;  2EM2 A;  2EMC A;  2EQ1 A;  2EMW A;  4FK5 C;  4WSG A;  1NCS A;  4R2A A;  1X3C A;  3UK3 C;  3EPH A;  2EOZ A;  1X5W A;  3EPJ A;  4GZN C;  1B69 A;  2CTD A;  2D9H A;  2DLQ A;  2EPP A;  1A1F A;  2MKD A;  1A1J A;  2EL4 A;  2WBU A;  4R2C A;  2CSH A;  2E72 A;  2EPR A;  2EL6 A;  1UN6 B;  3VHT B;  2LT7 A;  2YTF A;  1JK2 A;  1AAY A;  1DGC A;  2NAB A;  5KL2 A;  2EM4 A;  5KL5 A;  5KL6 A;  2EMK A;  2LV2 A;  3EPL A;  1TF6 A;  2YTG A;  2DLK A;  2DMI A;  2EOO A;  2EPZ A;  1LLM C;  2DRP A;  2EM3 A;  2EM7 A;  2YTQ A;  2WBS A;  2RPC A;  2YU5 A;  2ADR A;  2EM5 A;  2JPA A;  2YTD A;  1WJP A;  4IS1 C;  2EM9 A;  2WCC 3;  2EM0 A;  2YTI A;  1G2D C;  1G2F C;  2EOH A;  2EPU A;  2A25 A;  4R2S A;  2PRT A;  2RSI A;  2EOJ A;  1MEY C;  2EN1 A;  2EML A;  1P47 A;  2ENA A;  2YTJ A;  4F6M A;  3MHH C;  2EOR A;  5KL3 A;  2EPX A;  3EPK A;  2JP9 A;  1BB8 A;  2EMF A;  2EMY A;  2EM8 A;  1YUI A;  2MDG A;  1KJK A;  2EMZ A;  1A1L A;  2M9A A;  2I13 A;  1YUJ A;  2YRH A;  1X6F A;  2ENC A;  1ZR9 A;  2EN6 A;  4R2P A;  2YTE A;  1A1K A;  2EE8 A;  1ZAA C;  2DGC A;  1X6E A;  2ELZ A;  2EMB A;  4F2J C;  2EQ3 A;  2GHF A;  2VRD A;  1TN9 A;  2WBT A;  1JK1 A;  2EOS A;  2ENH A;  2EOE A;  2YTP A;  4IJD A;  2CT1 A;  1X6H A; 
#chains in the Genus database with same CATH topology
 2EWL A;  4DUY E;  2KHX A;  4JI8 E;  5AAS A;  2EOF A;  3J7Y p;  2UXB E;  2YRK A;  4X64 E;  1X47 A;  2VE7 C;  1YYO A;  2JYA A;  1WHN A;  2YTO A;  5LMN E;  4DV0 E;  3IWD A;  2EM6 A;  4F6N A;  1UBD C;  1STU A;  2YRM A;  2N3G A;  3THO B;  1N32 E;  3MHS C;  2L2N A;  2DB2 A;  3ADI A;  1RMD A;  2EMX A;  3KZZ A;  1GZ6 A;  2GLI A;  2EMI A;  4ZYH A;  5CFF E;  2EMG A;  1J5E E;  1PJQ A;  4JI5 E;  2EM2 A;  5AE2 A;  2EMW A;  4R2A A;  1X3C A;  3UK3 C;  2LRS A;  4GEQ B;  4X8W A;  5DNY A;  1X5W A;  3EPJ A;  3JTZ A;  5LLQ A;  2CTD A;  4X66 E;  1A1J A;  3BBG A;  2WBU A;  4K0K E;  5T6J A;  3J80 C;  1JK2 A;  4P7D A;  4DV2 E;  4WXC A;  5KL5 A;  5KL6 A;  2LV2 A;  1N33 E;  4X62 E;  3EPL A;  3ZOQ B;  2DLK A;  1EH8 A;  1IQS A;  1YYK A;  1LLM C;  2EPZ A;  2DRP A;  2LUP B;  2RPC A;  2YU5 A;  3C4B A;  2EM5 A;  4DR6 E;  1WJP A;  3HQ1 A;  4NXM E;  2RS6 A;  2UUA E;  1X49 A;  3EQ1 A;  2H36 X;  2RSI A;  2E5L E;  4ZYD A;  1MEY C;  4DR7 E;  2EML A;  4JI1 E;  3IWB A;  3L00 A;  2EPX A;  2EPK X;  4LTY A;  3EPK A;  2JP9 A;  1HNX E;  2FTX B;  4KHP E;  4BHC A;  4DV1 E;  2LTR A;  3F6G A;  4X65 E;  2V89 A;  1A1L A;  4F9C B;  2YRH A;  1HNW E;  2ENC A;  4R2P A;  1ZAA C;  4YY3 E;  2YWQ A;  1X6E A;  2KON A;  1EH7 A;  1IBL E;  3HPS A;  5AE3 A;  2EOE A;  2YTP A;  4BBY A;  4DR5 E;  2JVA A;  4RH8 A;  1EKZ A;  2B9D A;  3TQM A;  1Z1B A;  2EQ0 A;  5IV8 B;  4R2Q A;  4Q28 A;  2NUF A;  1L4S A;  2EN2 A;  3T1Y E;  1BBO A;  1ZU1 A;  4DR2 E;  4BMJ A;  4B3M E;  2EN3 A;  4N4R B;  2EOX A;  4I8O A;  2WZO A;  1A1G A;  4DR1 E;  2EL5 A;  2EJ4 A;  2VQE E;  2RQL A;  1RQ0 A;  2LJU A;  1YFH A;  1YYW A;  2L3C A;  2EN8 A;  1A1I A;  2HHH E;  2ZM6 E;  5LMU E;  3DF6 A;  3OTO E;  3HTX A;  1WRJ A;  1F2I G;  1HNZ E;  2LO3 A;  2IHR 1;  1A1H A;  4M9V C;  1KYQ A;  2JOB A;  2M7Q A;  4P78 A;  4DV6 E;  2LJH A;  1T38 A;  4R2R A;  2YU8 A;  2V85 A;  4YHH E;  2EP3 A;  4O4K A;  2EQ1 A;  2JXP A;  3EPH A;  3P1X A;  2EOZ A;  3OML A;  5A6A A;  3BGH A;  3KWR A;  1A1F A;  4BS9 A;  1DQ3 A;  2MKD A;  2E72 A;  4JI7 E;  1ZBT A;  2RTX A;  3IWC A;  1UN6 B;  2YTF A;  1AAY A;  3VK6 A;  1WHQ A;  2EM4 A;  3LML A;  1N36 E;  2EMK A;  2K7I A;  2I9I A;  1GTK A;  1X48 A;  2LUQ A;  4BCA A;  2ODR C;  2DMI A;  3K6Q A;  5IWA E;  2EM3 A;  4JI6 E;  2LE2 A;  5A6B A;  5ADZ A;  4DV7 E;  2JPA A;  2UXD E;  4IS1 C;  2V83 A;  2EZ6 A;  2EM0 A;  2CPN A;  2YTI A;  1RC7 A;  1IBM E;  1G2F C;  3BID A;  4R2S A;  3QG5 C;  4LFB E;  4LFC E;  2EOJ A;  3AV0 A;  2VQF E;  2Q8U A;  2ENA A;  4DV3 E;  5A6J A;  2EOR A;  2MDR A;  1UIL A;  1BBG A;  2GPI A;  2EMY A;  2E1M A;  4M30 A;  4DKK A;  1SR9 A;  1X6F A;  4B3S E;  2G7H A;  4NZV A;  1PKP A;  4TUG A;  2YTE A;  2EE8 A;  4L8N A;  4KWY A;  4LF5 E;  3VYX A;  1TN9 A;  4IJD A;  4WXD A;  4NHR A;  4M2Z A;  1X6H A;  4MLQ A;  2L2M A;  2L3J A;  2NA2 A;  2DIX A;  4OOG C;  3HPZ A;  2JWO A;  4R2D A;  2YSP A;  2LCE A;  2LBS B;  1QNT A;  2DMY A;  2EN4 A;  2LTS A;  2YSO A;  5KL7 A;  2F8B A;  1IBK E;  3C6K A;  2EOI A;  2M4I A;  1TF3 A;  4TUI A;  2HJJ A;  2BB8 A;  1IQO A;  2EPC A;  4OX9 E;  2EOY A;  4B3T E;  1QU6 A;  4O24 A;  2EOM A;  1FJG E;  2N8X A;  3DJW A;  2YPN A;  2EOQ A;  3M99 B;  1N34 E;  4O43 A;  4WYQ B;  2EMC A;  2V86 A;  4FK5 C;  4LF9 E;  4JYA E;  4WSG A;  1NCS A;  1AH5 A;  1T4N A;  4GZN C;  1B69 A;  4LF4 E;  2YT4 A;  1SFE A;  1YZ9 A;  4HEI A;  2V88 A;  2EL4 A;  4R2C A;  2CSH A;  2EPR A;  2LMZ A;  3F6H A;  2UU9 E;  2EL6 A;  1DGC A;  2NAB A;  2MC5 A;  3ECR A;  5AC4 A;  4KZS A;  4BC7 A;  1TF6 A;  1YPN A;  4LF6 E;  1NEI A;  4ZYG A;  1UHZ A;  3J7A G;  1ZBQ A;  2EM7 A;  2YTQ A;  4WX9 A;  2WBS A;  2ADR A;  2MC6 A;  2YTD A;  4J8Z A;  2ODR D;  2WCC 3;  2NUE A;  3RMP A;  4LF8 E;  1T4L B;  1G2D C;  2EPU A;  4R03 A;  4BHB A;  2PRT A;  4WPY A;  4JV5 E;  2EN1 A;  4DV4 E;  1P47 A;  4F6M A;  3MHH C;  4BC9 A;  2V8Q B;  5KL3 A;  4AQY E;  1T39 A;  2UUC E;  1PJS A;  2L33 A;  5BR8 E;  2EM8 A;  2MDG A;  1KJK A;  2M9A A;  2I13 A;  2RSM A;  2EN6 A;  5AE1 A;  4F9B B;  2R76 A;  2ELZ A;  5A69 A;  2GHF A;  2L6M A;  5AC5 A;  2HC5 A;  2WBT A;  1PDA A;  2EOS A;  1JK1 A;  2B7V A;  3C6M A;  3MSW A;  2CT1 A;  5IXM B;  5FLX C;  1XNQ E;  3ADJ A;  2ELY A;  2VF1 A;  4DR4 E;  1YSA C;  2V87 A;  3AUZ A;  2EPA A;  2DSY A;  4ZYE A;  2M1S A;  4JI3 E;  4JI2 E;  2FGG A;  2MKN A;  5A6K A;  5KL4 A;  1O0W A;  4R2E A;  1XMO E;  2EMH A;  2J7J A;  2YTN A;  4O5G A;  3JU0 A;  2B3T B;  2LVH A;  4DMI A;  2JY9 A;  2R1F A;  2NUG A;  4RHB B;  4WFT A;  2EN7 A;  1XNR E;  4LF7 E;  4DUZ E;  4DR3 E;  4LU9 A;  2EMA A;  1J26 A;  4X9J A;  2HGH A;  1GQE A;  1MGT A;  3T1H E;  2L92 A;  2EPM X;  4F9A B;  3J81 C;  1I94 E;  1EH6 A;  1XMQ E;  2D9H A;  2DLQ A;  2EPP A;  3FIG A;  3C4T A;  3HXL A;  2RS7 A;  3VHT B;  2KOU A;  2LT7 A;  2FV4 B;  5IT9 C;  5KL2 A;  2UUB E;  4JI0 E;  4L5N C;  2K4V A;  4B3R E;  3BF2 A;  2YTG A;  2EOO A;  3THN A;  5A6B D;  1T4O A;  1PJT A;  3H09 A;  2YZT A;  2EM9 A;  2L8T A;  5TSE A;  2UXC E;  2EOH A;  2A25 A;  4HTG A;  3KZY A;  4GKK E;  2EPL X;  2F4V E;  4GKJ E;  4M0V A;  4Q35 B;  1WXR A;  2YTJ A;  2EPN A;  4JI4 E;  3LLH A;  3ADL A;  4DV5 E;  1BB8 A;  2EMF A;  5F3W A;  2L2K B;  1YUI A;  2JOX A;  3ADG A;  2EPO A;  5LL6 R;  2EMZ A;  2N3H A;  1YUJ A;  5A2Q C;  1N3G A;  1HR0 E;  1ZR9 A;  4LFA E;  3JAM C;  2B7T A;  1FKA E;  1A1K A;  4WSP A;  2DGC A;  2EMB A;  4F2J C;  2EQ3 A;  1DI2 A;  2VRD A;  2BBG A;  4R8O A;  3VYY A;  2ENH A;  4MLV A;  1IMU A;  4F54 A;  4NXN E;  2JR1 A; 
#chains in the Genus database with same CATH homology
 2EQ0 A;  4R2Q A;  2EOF A;  2ELY A;  2YRK A;  4R2D A;  2EN2 A;  1BBO A;  2YSP A;  1ZU1 A;  2YTO A;  2LCE A;  1YSA C;  4F6N A;  2EM6 A;  2EN4 A;  2EN3 A;  2EPA A;  2EOX A;  1UBD C;  2YRM A;  1A1G A;  2EL5 A;  2EJ4 A;  2YSO A;  5KL7 A;  3MHS C;  2MKN A;  2EN8 A;  1RMD A;  2EMX A;  5KL4 A;  1A1I A;  2EOI A;  1TF3 A;  2GLI A;  2EMI A;  4R2E A;  2BB8 A;  2EMH A;  2J7J A;  2YTN A;  2EPC A;  1F2I G;  2LVH A;  2EMG A;  2EOY A;  2LO3 A;  1A1H A;  4M9V C;  2R1F A;  1Z1B A;  2EN7 A;  2EOM A;  4R2R A;  2YU8 A;  2EOQ A;  2EP3 A;  3M99 B;  2EMA A;  4X9J A;  2HGH A;  2EM2 A;  2EMC A;  2EQ1 A;  2EMW A;  4FK5 C;  4WSG A;  1NCS A;  4R2A A;  1X3C A;  3UK3 C;  3EPH A;  2EOZ A;  1X5W A;  3EPJ A;  4GZN C;  1B69 A;  2CTD A;  2D9H A;  2DLQ A;  2EPP A;  1A1F A;  2MKD A;  1A1J A;  2EL4 A;  2WBU A;  4R2C A;  2CSH A;  2E72 A;  2EPR A;  2EL6 A;  1UN6 B;  3VHT B;  2LT7 A;  2YTF A;  1JK2 A;  1AAY A;  1DGC A;  2NAB A;  5KL2 A;  2EM4 A;  5KL5 A;  5KL6 A;  2EMK A;  2LV2 A;  3EPL A;  1TF6 A;  2YTG A;  2DLK A;  2DMI A;  2EOO A;  2EPZ A;  1LLM C;  2DRP A;  2EM3 A;  2EM7 A;  2YTQ A;  2WBS A;  2RPC A;  2YU5 A;  2ADR A;  2EM5 A;  2JPA A;  2YTD A;  1WJP A;  4IS1 C;  2EM9 A;  2WCC 3;  2EM0 A;  2YTI A;  1G2D C;  1G2F C;  2EOH A;  2EPU A;  2A25 A;  4R2S A;  2PRT A;  2RSI A;  2EOJ A;  1MEY C;  2EN1 A;  2EML A;  1P47 A;  2ENA A;  2YTJ A;  4F6M A;  3MHH C;  2EOR A;  5KL3 A;  2EPX A;  3EPK A;  2JP9 A;  1BB8 A;  2EMF A;  2EMY A;  2EM8 A;  1YUI A;  2MDG A;  1KJK A;  2EMZ A;  1A1L A;  2M9A A;  2I13 A;  1YUJ A;  2YRH A;  1X6F A;  2ENC A;  1ZR9 A;  2EN6 A;  4R2P A;  2YTE A;  1A1K A;  2EE8 A;  1ZAA C;  2DGC A;  1X6E A;  2ELZ A;  2EMB A;  4F2J C;  2EQ3 A;  2GHF A;  2VRD A;  1TN9 A;  2WBT A;  1JK1 A;  2EOS A;  2ENH A;  2EOE A;  2YTP A;  4IJD A;  2CT1 A;  1X6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...