4GZNC

Mouse zfp57 zinc fingers in complex with methylated dna
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
59
structure length
59
Chain Sequence
b'SERPFFCNFCGKTYRDASGLSRHRRAHLGYRPRSCPECGKCFRDQSEVNRHLKVHQNKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*TP*AP*TP*TP*GP*CP*(5CM)P*GP*CP*AP*G)-3')
publication title An atomic model of Zfp57 recognition of CpG methylation within a specific DNA sequence.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 19
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4gznC02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4gznC01
4IS1C 2PRTA 1ZU1A 2YTJA 1G2DC 2YU8A 2EM0A 2YSOA 3EPHA 1ZAAC 2EOZA 3EPKA 2E72A 2YRKA 2DLQA 2WBTA 2WBSA 2MDGA 1KJKA 1WJPA 2RSIA 1RMDA 2ENCA 2EORA 4R2PA 3UK3C 2CSHA 2DLKA 2R1FA 2ENAA 2GLIA 2ELYA 2YSPA 2A25A 5KL7A 2EMIA 2EN1A 2EM7A 1X6EA 1A1IA 2DRPA 2EM6A 2EOOA 2EOQA 4R2RA 2EOHA 2EOXA 2HGHA 2YTNA 2EOJA 2WCC3 1YSAC 2CT1A 2EMXA 2EOIA 1ZR9A 1BBOA 2EMKA 3MHHC 2LV2A 2EMFA 2EM5A 2LT7A 1UBDC 1JK2A 4F6NA 2EMYA 1X6HA 2EM9A 1X5WA 2EPXA 2EN7A 1A1GA 2MKDA 2EOMA 4IJDA 2J7JA 4R2CA 2EL5A 4GZNC 2EPCA 2LVHA 1MEYC 2YTFA 2EMZA 1A1HA 2VRDA 2EMWA 1A1LA 5KL5A 4WSGA 1DGCA 3MHSC 2EQ1A 2EN6A 4R2SA 2EMGA 1A1KA 1NCSA 4R2DA 2EP3A 1TF6A 2YRMA 2DGCA 2JPAA 2EOYA 4R2EA 2GHFA 2EPPA 2EPUA 2EM3A 1F2IG 4F6MA 2EM4A 1YUIA 2EN2A 1G2FC 2EPAA 1JK1A 4R2AA 2LO3A 1TF3A 2EOEA 1A1JA 2I13A 5KL6A 2YTIA 2EMCA 3EPJA 1UN6B 2EL6A 2EOFA 2NABA 2EQ3A 2EM2A 2YTOA 4F2JC 2RPCA 5KL4A 5KL2A 1P47A 2WBUA 1YUJA 2EN3A 2EJ4A 5KL3A 2EPZA 2MKNA 2YTPA 2EOSA 2YU5A 1X6FA 1LLMC 2EL4A 2ELZA 2EN8A 3EPLA 4R2QA 2ADRA 2EM8A 2ENHA 1AAYA 2M9AA 2EN4A 2EMLA 2YTEA 2YTDA 2D9HA 2EMHA 1A1FA 2YRHA 2YTGA 2EE8A 2EPRA 2JP9A 2CTDA 4M9VC 2YTQA 2BB8A 1Z1BA 4X9JA 1B69A 2DMIA 2EMBA 1BB8A 2EQ0A 1X3CA 2EMAA 2LCEA 3M99B 3VHTB 1TN9A 4FK5C
chains in the Genus database with same CATH superfamily
4IS1C 2LRSA 2PRTA 2B7VA 4LF7E 3HXLA 3TQMA 2EOZA 3EPKA 2N3GA 3IWBA 2DLQA 1X48A 2WBTA 2VQFE 1KJKA 2RSIA 3ADJA 2LUQA 4DV6E 4JI1E 3UK3C 1I94E 2Q8UA 2N8XA 2GLIA 4RHBB 4B3TE 5KL7A 2EN1A 2EM7A 2DRPA 2EM6A 5AASA 3HTXA 3DF6A 4R2RA 2EOHA 2EOXA 4RH8A 1YSAC 4TUIA 4X65E 5A6BD 2E1MA 4JI3E 1ZR9A 2EM5A 4LFAE 2EMYA 2ODRD 4KZSA 1HNWE 4F9BB 2DB2A 3LLHA 4L8NA 1HR0E 2J7JA 4R2CA 3K6QA 4GKJE 2LVHA 1SFEA 1MEYC 2MDRA 2YTFA 1STUA 4LF6E 2VF1A 5IWAE 1BBGA 1N36E 4R2DA 2DIXA 1YFHA 2DGCA 3C4TA 2L3JA 2WZOA 2V83A 3MSWA 3VYYA 4F6MA 2EM4A 1ZBQA 4BC7A 3KWRA 1JK1A 3ADIA 2LO3A 2EOEA 2I13A 2JY9A 2EL6A 1FKAE 1HNXE 3JAMC 4F2JC 4DV2E 4JYAE 1YUJA 2L2MA 5F3WA 2UU9E 1DI2A 2EJ4A 4X66E 2LUPB 4ZYEA 4BS9A 1LLMC 4M30A 2ELZA 4F9AB 3EPLA 3T1HE 4JI2E 1XNRE 2L6MA 2B7TA 2M9AA 2KOUA 3IWDA 3KZYA 2JR1A 2YTEA 4B3SE 4DUYE 4NHRA 5T6JA 4LF4E 2NUEA 2EPLX 2EE8A 1QU6A 2R76A 5A69A 4M9VC 2JYAA 1B69A 4Q35B 2EMBA 3F6HA 4WXCA 1X3CA 3VHTB 4KWYA 5IT9C 1ZU1A 2F8BA 2L2KB 4JI8E 4P78A 3EPHA 1T4NA 2MDGA 1RMDA 2CSHA 2RTXA 1FJGE 2R1FA 1YPNA 1WRJA 2YSPA 2EMIA 1X6EA 5AE3A 4BBYA 3BF2A 2YTNA 3ECRA 2UXBE 2V88A 2KHXA 5AE1A 1T39A 4BHBA 4HEIA 2EOIA 4X8WA 2BBGA 3AV0A 2LV2A 1UBDC 2LTSA 1JK2A 1ZBTA 2MC6A 2YT4A 1IQOA 4JI7E 5AE2A 2EM9A 2EPXA 3OTOE 4NZVA 1N3GA 1A1HA 5LLQA 4GEQB 5AC5A 4WSGA 1DGCA 2EQ1A 4DV0E 4NXNE 4TUGA 1A1KA 4WXDA 3HPSA 2YRMA 2EPPA 2EPUA 3DJWA 1YUIA 1J5EE 1G2FC 4DR1E 2NUGA 4R2AA 2LTRA 1TF3A 3VYXA 5KL6A 4I8OA 2B9DA 2V8QB 2YTOA 5A6AA 5KL2A 4DV7E 4JI5E 3ADGA 4BCAA 4YY3E 3J80C 2MKNA 4KHPE 2EOSA 2YU5A 4BMJA 4WSPA 2M7QA 4DV1E 2UXDE 2JVAA 2K4VA 1UHZA 1AAYA 4DMIA 2JWOA 4JV5E 4O5GA 3L00A 1QNTA 2JP9A 2BB8A 1Z1BA 4X9JA 3HQ1A 1BB8A 4WPYA 2EMAA 2LCEA 3M99B 1XNQE 1TN9A 2F4VE 4DR2E 2YTJA 1G2DC 3VK6A 1N34E 3THOB 1GZ6A 2EM0A 1ZAAC 1XMOE 1IBME 2E72A 2YRKA 2RS6A 2E5LE 1WJPA 1WHQA 4DR5E 1N32E 4DR4E 2ENCA 2EORA 5A6BA 2JOXA 1PJSA 1PDAA 2ENAA 1GQEA 1GTKA 2ELYA 4O43A 1HNZE 1YYWA 1RQ0A 2A25A 2HC5A 2HJJA 4BHCA 5IV8B 4X64E 2EOOA 3IWCA 2GPIA 2HGHA 2WCC3 4MLQA 2RS7A 4O24A 2CT1A 2YWQA 4GKKE 2LJUA 4JI6E 3THNA 2NA2A 2ODRC 3ZOQB 1BBOA 2CPNA 2V86A 1T4OA 4F54A 4DR6E 4F6NA 2FGGA 2B3TB 1T38A 4N4RB 1X6HA 1X5WA 1A1GA 2EN7A 2FV4B 2MKDA 1PKPA 1IQSA 2NUFA 3BBGA 4M0VA 2EL5A 1IMUA 4DKKA 2IHR1 1EH8A 1NEIA 5A6JA 4GZNC 4B3ME 2EMZA 1X49A 5DNYA 1A1LA 5KL5A 2V89A 3MHSC 4DUZE 4B3RE 3J7AG 3F6GA 4L5NC 2EP3A 5AC4A 2EOYA 4JI4E 2EM3A 3JTZA 2JOBA 3KZZA 5LMNE 1L4SA 2K7IA 1A1JA 2JXPA 4DR3E 3LMLA 2KONA 2EMCA 3H09A 1WHNA 4LF5E 1EH7A 2EOFA 1YYKA 2EM2A 2G7HA 2RPCA 2UUAE 1P47A 2WBUA 2EN3A 1EKZA 4OOGC 5KL3A 4NXME 2EPZA 5CFFE 2M1SA 2L8TA 2UUBE 5A6KA 2L92A 1T4LB 1X47A 4Q28A 5BR8E 4R2QA 2UUCE 2UXCE 2ADRA 2EM8A 5LL6R 3J7Yp 3ADLA 4YHHE 1YYOA 4P7DA 2EMHA 1A1FA 2YRHA 2RQLA 5A2QC 1N33E 2YTQA 1PJQA 2EPMX 4LTYA 3C6KA 4WYQB 2EQ0A 4X62E 1SR9A 1DQ3A 4FK5C 5ADZA 1RC7A 2LBSB 1WXRA 2L33A 1EH6A 2YPNA 3FIGA 2YU8A 2YSOA 2ZM6E 2LMZA 3EQ1A 4R03A 2WBSA 4WFTA 2H36X 3J81C 4R2PA 2DLKA 2EWLA 4JI0E 4O4KA 2L3CA 1YZ9A 3C4BA 2M4IA 4MLVA 4WX9A 3RMPA 1A1IA 2EPNA 2VQEE 4LF9E 4OX9E 4LU9A 2EOQA 4K0KE 4J8ZA 2EOJA 3JU0A 2VE7C 2EMXA 3OMLA 4ZYDA 5FLXC 4LFBE 2EMKA 2RSMA 3MHHC 2LT7A 2EMFA 2MC5A 4R8OA 4HTGA 2EOMA 4IJDA 5TSEA 2I9IA 2L2NA 3HPZA 1MGTA 2EPCA 4ZYHA 2VRDA 2EMWA 2YZTA 2EN6A 4LF8E 4R2SA 2EMGA 1NCSA 1TF6A 2EPKX 2JPAA 4R2EA 2GHFA 1F2IG 3T1YE 2EN2A 2DMYA 2EPAA 4ZYGA 2EZ6A 2FTXB 4AQYE 4DV4E 3AUZA 1KYQA 2YTIA 3EPJA 1IBLE 1UN6B 2NABA 2EQ3A 4F9CB 1XMQE 1PJTA 1O0WA 2N3HA 5KL4A 1J26A 4DR7E 2DSYA 1AH5A 2YTPA 3BIDA 1X6FA 3P1XA 3QG5C 2EL4A 2V87A 3C6MA 2EN8A 2LE2A 4BC9A 2V85A 2ENHA 1IBKE 2EN4A 2EMLA 4M2ZA 2YTDA 2D9HA 2HHHE 4DV5E 2YTGA 5IXMB 2EPRA 2CTDA 1UILA 4DV3E 2DMIA 5LMUE 3BGHA 2LJHA 2EPOA 4LFCE
chains in the Genus database with same CATH topology
4IS1C 2PRTA 1ZU1A 2YTJA 1G2DC 2YU8A 2EM0A 2YSOA 3EPHA 1ZAAC 2EOZA 3EPKA 2E72A 2YRKA 2DLQA 2WBTA 2WBSA 2MDGA 1KJKA 1WJPA 2RSIA 1RMDA 2ENCA 2EORA 4R2PA 3UK3C 2CSHA 2DLKA 2R1FA 2ENAA 2GLIA 2ELYA 2YSPA 2A25A 5KL7A 2EMIA 2EN1A 2EM7A 1X6EA 1A1IA 2DRPA 2EM6A 2EOOA 2EOQA 4R2RA 2EOHA 2EOXA 2HGHA 2YTNA 2EOJA 2WCC3 1YSAC 2CT1A 2EMXA 2EOIA 1ZR9A 1BBOA 2EMKA 3MHHC 2LV2A 2EMFA 2EM5A 2LT7A 1UBDC 1JK2A 4F6NA 2EMYA 1X6HA 2EM9A 1X5WA 2EPXA 2EN7A 1A1GA 2MKDA 2EOMA 4IJDA 2J7JA 4R2CA 2EL5A 4GZNC 2EPCA 2LVHA 1MEYC 2YTFA 2EMZA 1A1HA 2VRDA 2EMWA 1A1LA 5KL5A 4WSGA 1DGCA 3MHSC 2EQ1A 2EN6A 4R2SA 2EMGA 1A1KA 1NCSA 4R2DA 2EP3A 1TF6A 2YRMA 2DGCA 2JPAA 2EOYA 4R2EA 2GHFA 2EPPA 2EPUA 2EM3A 1F2IG 4F6MA 2EM4A 1YUIA 2EN2A 1G2FC 2EPAA 1JK1A 4R2AA 2LO3A 1TF3A 2EOEA 1A1JA 2I13A 5KL6A 2YTIA 2EMCA 3EPJA 1UN6B 2EL6A 2EOFA 2NABA 2EQ3A 2EM2A 2YTOA 4F2JC 2RPCA 5KL4A 5KL2A 1P47A 2WBUA 1YUJA 2EN3A 2EJ4A 5KL3A 2EPZA 2MKNA 2YTPA 2EOSA 2YU5A 1X6FA 1LLMC 2EL4A 2ELZA 2EN8A 3EPLA 4R2QA 2ADRA 2EM8A 2ENHA 1AAYA 2M9AA 2EN4A 2EMLA 2YTEA 2YTDA 2D9HA 2EMHA 1A1FA 2YRHA 2YTGA 2EE8A 2EPRA 2JP9A 2CTDA 4M9VC 2YTQA 2BB8A 1Z1BA 4X9JA 1B69A 2DMIA 2EMBA 1BB8A 2EQ0A 1X3CA 2EMAA 2LCEA 3M99B 3VHTB 1TN9A 4FK5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IS1 C;  2PRT A;  1ZU1 A;  2YTJ A;  1G2D C;  2YU8 A;  2EM0 A;  2YSO A;  3EPH A;  1ZAA C;  2EOZ A;  3EPK A;  2E72 A;  2YRK A;  2DLQ A;  2WBT A;  2WBS A;  2MDG A;  1KJK A;  1WJP A;  2RSI A;  1RMD A;  2ENC A;  2EOR A;  4R2P A;  3UK3 C;  2CSH A;  2DLK A;  2R1F A;  2ENA A;  2GLI A;  2ELY A;  2YSP A;  2A25 A;  5KL7 A;  2EMI A;  2EN1 A;  2EM7 A;  1X6E A;  1A1I A;  2DRP A;  2EM6 A;  2EOO A;  2EOQ A;  4R2R A;  2EOH A;  2EOX A;  2HGH A;  2YTN A;  2EOJ A;  2WCC 3;  1YSA C;  2CT1 A;  2EMX A;  2EOI A;  1ZR9 A;  1BBO A;  2EMK A;  3MHH C;  2LV2 A;  2EMF A;  2EM5 A;  2LT7 A;  1UBD C;  1JK2 A;  4F6N A;  2EMY A;  1X6H A;  2EM9 A;  1X5W A;  2EPX A;  2EN7 A;  1A1G A;  2MKD A;  2EOM A;  4IJD A;  2J7J A;  4R2C A;  2EL5 A;  4GZN C;  2EPC A;  2LVH A;  1MEY C;  2YTF A;  2EMZ A;  1A1H A;  2VRD A;  2EMW A;  1A1L A;  5KL5 A;  4WSG A;  1DGC A;  3MHS C;  2EQ1 A;  2EN6 A;  4R2S A;  2EMG A;  1A1K A;  1NCS A;  4R2D A;  2EP3 A;  1TF6 A;  2YRM A;  2DGC A;  2JPA A;  2EOY A;  4R2E A;  2GHF A;  2EPP A;  2EPU A;  2EM3 A;  1F2I G;  4F6M A;  2EM4 A;  1YUI A;  2EN2 A;  1G2F C;  2EPA A;  1JK1 A;  4R2A A;  2LO3 A;  1TF3 A;  2EOE A;  1A1J A;  2I13 A;  5KL6 A;  2YTI A;  2EMC A;  3EPJ A;  1UN6 B;  2EL6 A;  2EOF A;  2NAB A;  2EQ3 A;  2EM2 A;  2YTO A;  4F2J C;  2RPC A;  5KL4 A;  5KL2 A;  1P47 A;  2WBU A;  1YUJ A;  2EN3 A;  2EJ4 A;  5KL3 A;  2EPZ A;  2MKN A;  2YTP A;  2EOS A;  2YU5 A;  1X6F A;  1LLM C;  2EL4 A;  2ELZ A;  2EN8 A;  3EPL A;  4R2Q A;  2ADR A;  2EM8 A;  2ENH A;  1AAY A;  2M9A A;  2EN4 A;  2EML A;  2YTE A;  2YTD A;  2D9H A;  2EMH A;  1A1F A;  2YRH A;  2YTG A;  2EE8 A;  2EPR A;  2JP9 A;  2CTD A;  4M9V C;  2YTQ A;  2BB8 A;  1Z1B A;  4X9J A;  1B69 A;  2DMI A;  2EMB A;  1BB8 A;  2EQ0 A;  1X3C A;  2EMA A;  2LCE A;  3M99 B;  3VHT B;  1TN9 A;  4FK5 C; 
#chains in the Genus database with same CATH topology
 4IS1 C;  2LRS A;  2PRT A;  2B7V A;  4LF7 E;  3HXL A;  3TQM A;  2EOZ A;  3EPK A;  2N3G A;  3IWB A;  2DLQ A;  1X48 A;  2WBT A;  2VQF E;  1KJK A;  2RSI A;  3ADJ A;  2LUQ A;  4DV6 E;  4JI1 E;  3UK3 C;  1I94 E;  2Q8U A;  2N8X A;  2GLI A;  4RHB B;  4B3T E;  5KL7 A;  2EN1 A;  2EM7 A;  2DRP A;  2EM6 A;  5AAS A;  3HTX A;  3DF6 A;  4R2R A;  2EOH A;  2EOX A;  4RH8 A;  1YSA C;  4TUI A;  4X65 E;  5A6B D;  2E1M A;  4JI3 E;  1ZR9 A;  2EM5 A;  4LFA E;  2EMY A;  2ODR D;  4KZS A;  1HNW E;  4F9B B;  2DB2 A;  3LLH A;  4L8N A;  1HR0 E;  2J7J A;  4R2C A;  3K6Q A;  4GKJ E;  2LVH A;  1SFE A;  1MEY C;  2MDR A;  2YTF A;  1STU A;  4LF6 E;  2VF1 A;  5IWA E;  1BBG A;  1N36 E;  4R2D A;  2DIX A;  1YFH A;  2DGC A;  3C4T A;  2L3J A;  2WZO A;  2V83 A;  3MSW A;  3VYY A;  4F6M A;  2EM4 A;  1ZBQ A;  4BC7 A;  3KWR A;  1JK1 A;  3ADI A;  2LO3 A;  2EOE A;  2I13 A;  2JY9 A;  2EL6 A;  1FKA E;  1HNX E;  3JAM C;  4F2J C;  4DV2 E;  4JYA E;  1YUJ A;  2L2M A;  5F3W A;  2UU9 E;  1DI2 A;  2EJ4 A;  4X66 E;  2LUP B;  4ZYE A;  4BS9 A;  1LLM C;  4M30 A;  2ELZ A;  4F9A B;  3EPL A;  3T1H E;  4JI2 E;  1XNR E;  2L6M A;  2B7T A;  2M9A A;  2KOU A;  3IWD A;  3KZY A;  2JR1 A;  2YTE A;  4B3S E;  4DUY E;  4NHR A;  5T6J A;  4LF4 E;  2NUE A;  2EPL X;  2EE8 A;  1QU6 A;  2R76 A;  5A69 A;  4M9V C;  2JYA A;  1B69 A;  4Q35 B;  2EMB A;  3F6H A;  4WXC A;  1X3C A;  3VHT B;  4KWY A;  5IT9 C;  1ZU1 A;  2F8B A;  2L2K B;  4JI8 E;  4P78 A;  3EPH A;  1T4N A;  2MDG A;  1RMD A;  2CSH A;  2RTX A;  1FJG E;  2R1F A;  1YPN A;  1WRJ A;  2YSP A;  2EMI A;  1X6E A;  5AE3 A;  4BBY A;  3BF2 A;  2YTN A;  3ECR A;  2UXB E;  2V88 A;  2KHX A;  5AE1 A;  1T39 A;  4BHB A;  4HEI A;  2EOI A;  4X8W A;  2BBG A;  3AV0 A;  2LV2 A;  1UBD C;  2LTS A;  1JK2 A;  1ZBT A;  2MC6 A;  2YT4 A;  1IQO A;  4JI7 E;  5AE2 A;  2EM9 A;  2EPX A;  3OTO E;  4NZV A;  1N3G A;  1A1H A;  5LLQ A;  4GEQ B;  5AC5 A;  4WSG A;  1DGC A;  2EQ1 A;  4DV0 E;  4NXN E;  4TUG A;  1A1K A;  4WXD A;  3HPS A;  2YRM A;  2EPP A;  2EPU A;  3DJW A;  1YUI A;  1J5E E;  1G2F C;  4DR1 E;  2NUG A;  4R2A A;  2LTR A;  1TF3 A;  3VYX A;  5KL6 A;  4I8O A;  2B9D A;  2V8Q B;  2YTO A;  5A6A A;  5KL2 A;  4DV7 E;  4JI5 E;  3ADG A;  4BCA A;  4YY3 E;  3J80 C;  2MKN A;  4KHP E;  2EOS A;  2YU5 A;  4BMJ A;  4WSP A;  2M7Q A;  4DV1 E;  2UXD E;  2JVA A;  2K4V A;  1UHZ A;  1AAY A;  4DMI A;  2JWO A;  4JV5 E;  4O5G A;  3L00 A;  1QNT A;  2JP9 A;  2BB8 A;  1Z1B A;  4X9J A;  3HQ1 A;  1BB8 A;  4WPY A;  2EMA A;  2LCE A;  3M99 B;  1XNQ E;  1TN9 A;  2F4V E;  4DR2 E;  2YTJ A;  1G2D C;  3VK6 A;  1N34 E;  3THO B;  1GZ6 A;  2EM0 A;  1ZAA C;  1XMO E;  1IBM E;  2E72 A;  2YRK A;  2RS6 A;  2E5L E;  1WJP A;  1WHQ A;  4DR5 E;  1N32 E;  4DR4 E;  2ENC A;  2EOR A;  5A6B A;  2JOX A;  1PJS A;  1PDA A;  2ENA A;  1GQE A;  1GTK A;  2ELY A;  4O43 A;  1HNZ E;  1YYW A;  1RQ0 A;  2A25 A;  2HC5 A;  2HJJ A;  4BHC A;  5IV8 B;  4X64 E;  2EOO A;  3IWC A;  2GPI A;  2HGH A;  2WCC 3;  4MLQ A;  2RS7 A;  4O24 A;  2CT1 A;  2YWQ A;  4GKK E;  2LJU A;  4JI6 E;  3THN A;  2NA2 A;  2ODR C;  3ZOQ B;  1BBO A;  2CPN A;  2V86 A;  1T4O A;  4F54 A;  4DR6 E;  4F6N A;  2FGG A;  2B3T B;  1T38 A;  4N4R B;  1X6H A;  1X5W A;  1A1G A;  2EN7 A;  2FV4 B;  2MKD A;  1PKP A;  1IQS A;  2NUF A;  3BBG A;  4M0V A;  2EL5 A;  1IMU A;  4DKK A;  2IHR 1;  1EH8 A;  1NEI A;  5A6J A;  4GZN C;  4B3M E;  2EMZ A;  1X49 A;  5DNY A;  1A1L A;  5KL5 A;  2V89 A;  3MHS C;  4DUZ E;  4B3R E;  3J7A G;  3F6G A;  4L5N C;  2EP3 A;  5AC4 A;  2EOY A;  4JI4 E;  2EM3 A;  3JTZ A;  2JOB A;  3KZZ A;  5LMN E;  1L4S A;  2K7I A;  1A1J A;  2JXP A;  4DR3 E;  3LML A;  2KON A;  2EMC A;  3H09 A;  1WHN A;  4LF5 E;  1EH7 A;  2EOF A;  1YYK A;  2EM2 A;  2G7H A;  2RPC A;  2UUA E;  1P47 A;  2WBU A;  2EN3 A;  1EKZ A;  4OOG C;  5KL3 A;  4NXM E;  2EPZ A;  5CFF E;  2M1S A;  2L8T A;  2UUB E;  5A6K A;  2L92 A;  1T4L B;  1X47 A;  4Q28 A;  5BR8 E;  4R2Q A;  2UUC E;  2UXC E;  2ADR A;  2EM8 A;  5LL6 R;  3J7Y p;  3ADL A;  4YHH E;  1YYO A;  4P7D A;  2EMH A;  1A1F A;  2YRH A;  2RQL A;  5A2Q C;  1N33 E;  2YTQ A;  1PJQ A;  2EPM X;  4LTY A;  3C6K A;  4WYQ B;  2EQ0 A;  4X62 E;  1SR9 A;  1DQ3 A;  4FK5 C;  5ADZ A;  1RC7 A;  2LBS B;  1WXR A;  2L33 A;  1EH6 A;  2YPN A;  3FIG A;  2YU8 A;  2YSO A;  2ZM6 E;  2LMZ A;  3EQ1 A;  4R03 A;  2WBS A;  4WFT A;  2H36 X;  3J81 C;  4R2P A;  2DLK A;  2EWL A;  4JI0 E;  4O4K A;  2L3C A;  1YZ9 A;  3C4B A;  2M4I A;  4MLV A;  4WX9 A;  3RMP A;  1A1I A;  2EPN A;  2VQE E;  4LF9 E;  4OX9 E;  4LU9 A;  2EOQ A;  4K0K E;  4J8Z A;  2EOJ A;  3JU0 A;  2VE7 C;  2EMX A;  3OML A;  4ZYD A;  5FLX C;  4LFB E;  2EMK A;  2RSM A;  3MHH C;  2LT7 A;  2EMF A;  2MC5 A;  4R8O A;  4HTG A;  2EOM A;  4IJD A;  5TSE A;  2I9I A;  2L2N A;  3HPZ A;  1MGT A;  2EPC A;  4ZYH A;  2VRD A;  2EMW A;  2YZT A;  2EN6 A;  4LF8 E;  4R2S A;  2EMG A;  1NCS A;  1TF6 A;  2EPK X;  2JPA A;  4R2E A;  2GHF A;  1F2I G;  3T1Y E;  2EN2 A;  2DMY A;  2EPA A;  4ZYG A;  2EZ6 A;  2FTX B;  4AQY E;  4DV4 E;  3AUZ A;  1KYQ A;  2YTI A;  3EPJ A;  1IBL E;  1UN6 B;  2NAB A;  2EQ3 A;  4F9C B;  1XMQ E;  1PJT A;  1O0W A;  2N3H A;  5KL4 A;  1J26 A;  4DR7 E;  2DSY A;  1AH5 A;  2YTP A;  3BID A;  1X6F A;  3P1X A;  3QG5 C;  2EL4 A;  2V87 A;  3C6M A;  2EN8 A;  2LE2 A;  4BC9 A;  2V85 A;  2ENH A;  1IBK E;  2EN4 A;  2EML A;  4M2Z A;  2YTD A;  2D9H A;  2HHH E;  4DV5 E;  2YTG A;  5IXM B;  2EPR A;  2CTD A;  1UIL A;  4DV3 E;  2DMI A;  5LMU E;  3BGH A;  2LJH A;  2EPO A;  4LFC E; 
#chains in the Genus database with same CATH homology
 4IS1 C;  2PRT A;  1ZU1 A;  2YTJ A;  1G2D C;  2YU8 A;  2EM0 A;  2YSO A;  3EPH A;  1ZAA C;  2EOZ A;  3EPK A;  2E72 A;  2YRK A;  2DLQ A;  2WBT A;  2WBS A;  2MDG A;  1KJK A;  1WJP A;  2RSI A;  1RMD A;  2ENC A;  2EOR A;  4R2P A;  3UK3 C;  2CSH A;  2DLK A;  2R1F A;  2ENA A;  2GLI A;  2ELY A;  2YSP A;  2A25 A;  5KL7 A;  2EMI A;  2EN1 A;  2EM7 A;  1X6E A;  1A1I A;  2DRP A;  2EM6 A;  2EOO A;  2EOQ A;  4R2R A;  2EOH A;  2EOX A;  2HGH A;  2YTN A;  2EOJ A;  2WCC 3;  1YSA C;  2CT1 A;  2EMX A;  2EOI A;  1ZR9 A;  1BBO A;  2EMK A;  3MHH C;  2LV2 A;  2EMF A;  2EM5 A;  2LT7 A;  1UBD C;  1JK2 A;  4F6N A;  2EMY A;  1X6H A;  2EM9 A;  1X5W A;  2EPX A;  2EN7 A;  1A1G A;  2MKD A;  2EOM A;  4IJD A;  2J7J A;  4R2C A;  2EL5 A;  4GZN C;  2EPC A;  2LVH A;  1MEY C;  2YTF A;  2EMZ A;  1A1H A;  2VRD A;  2EMW A;  1A1L A;  5KL5 A;  4WSG A;  1DGC A;  3MHS C;  2EQ1 A;  2EN6 A;  4R2S A;  2EMG A;  1A1K A;  1NCS A;  4R2D A;  2EP3 A;  1TF6 A;  2YRM A;  2DGC A;  2JPA A;  2EOY A;  4R2E A;  2GHF A;  2EPP A;  2EPU A;  2EM3 A;  1F2I G;  4F6M A;  2EM4 A;  1YUI A;  2EN2 A;  1G2F C;  2EPA A;  1JK1 A;  4R2A A;  2LO3 A;  1TF3 A;  2EOE A;  1A1J A;  2I13 A;  5KL6 A;  2YTI A;  2EMC A;  3EPJ A;  1UN6 B;  2EL6 A;  2EOF A;  2NAB A;  2EQ3 A;  2EM2 A;  2YTO A;  4F2J C;  2RPC A;  5KL4 A;  5KL2 A;  1P47 A;  2WBU A;  1YUJ A;  2EN3 A;  2EJ4 A;  5KL3 A;  2EPZ A;  2MKN A;  2YTP A;  2EOS A;  2YU5 A;  1X6F A;  1LLM C;  2EL4 A;  2ELZ A;  2EN8 A;  3EPL A;  4R2Q A;  2ADR A;  2EM8 A;  2ENH A;  1AAY A;  2M9A A;  2EN4 A;  2EML A;  2YTE A;  2YTD A;  2D9H A;  2EMH A;  1A1F A;  2YRH A;  2YTG A;  2EE8 A;  2EPR A;  2JP9 A;  2CTD A;  4M9V C;  2YTQ A;  2BB8 A;  1Z1B A;  4X9J A;  1B69 A;  2DMI A;  2EMB A;  1BB8 A;  2EQ0 A;  1X3C A;  2EMA A;  2LCE A;  3M99 B;  3VHT B;  1TN9 A;  4FK5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...