4GZNC

Mouse zfp57 zinc fingers in complex with methylated dna
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
59
structure length
59
Chain Sequence
SERPFFCNFCGKTYRDASGLSRHRRAHLGYRPRSCPECGKCFRDQSEVNRHLKVHQNKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*AP*TP*TP*GP*CP*(5CM)P*GP*CP*AP*G)-3')
publication title An atomic model of Zfp57 recognition of CpG methylation within a specific DNA sequence.
pubmed doi rcsb
source organism Mus musculus
total genus 19
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4gznC02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4gznC01
2DMIA 1NCSA 2CSHA 2EMBA 2MKNA 2ENHA 2EPCA 4R2QA 2GLIA 2EL4A 2EL5A 2YU8A 5KL3A 2LT7A 1BBOA 2WBUA 4IS1C 3MHHC 2EP3A 4R2AA 2EPXA 2J7JA 2EM4A 1UN6B 2YTGA 2YTEA 1WJPA 2EM8A 2EOSA 2EOHA 2EN3A 1JK1A 1G2FC 2BB8A 3VHTB 4IJDA 2EN6A 1LLMC 2EMKA 2R1FA 5KL4A 4GZNC 1X3CA 2YSOA 2DRPA 4R2RA 2EQ1A 2JP9A 2CT1A 1X6HA 3UK3C 2ADRA 2EN1A 2EQ3A 2EPAA 2EOZA 2YRKA 4F6NA 2JPAA 4FK5C 1YUJA 2DGCA 1X6EA 3MHSC 2EMXA 2EL6A 1A1FA 2EM5A 1A1KA 2HGHA 2M9AA 1G2DC 2D9HA 2YTJA 2DLQA 4F2JC 2ELYA 2EOJA 2VRDA 1MEYC 2EMHA 2EORA 2LVHA 1Z1BA 2EMZA 1YUIA 1KJKA 1X5WA 3EPJA 2EMCA 2EJ4A 1A1HA 5KL7A 2EOFA 2EM3A 2MDGA 1ZAAC 3M99B 2EOMA 2A25A 2EMAA 1TF3A 2EMWA 2YTIA 2ELZA 2WCC3 4R2SA 4R2EA 3EPHA 2EQ0A 1BB8A 2NABA 4WSGA 2EM9A 2DLKA 2EMGA 2YU5A 4X9JA 2EM6A 2ENCA 2YTQA 2YTDA 4F6MA 1X6FA 2EMIA 2EM2A 3EPKA 5KL5A 2WBSA 2EE8A 1F2IG 2EN8A 1TF6A 1AAYA 2E72A 1A1IA 1ZR9A 2EOXA 2PRTA 2EN2A 1ZU1A 2RPCA 1B69A 1A1JA 2YRMA 2YRHA 2EM0A 2YTNA 2YTFA 2EPPA 2YSPA 2ENAA 2EPUA 4M9VC 1JK2A 1P47A 2EMYA 2EOOA 3EPLA 4R2PA 1A1GA 2EN4A 2YTPA 2LO3A 2EPZA 2EPRA 2EOIA 4R2CA 2EMLA 2EOQA 4R2DA 1UBDC 2EMFA 1RMDA 2GHFA 2YTOA 5KL2A 2RSIA 1A1LA 2EOYA 2LCEA 2WBTA 2EOEA 2I13A 2EN7A 1YSAC 5KL6A 2MKDA 1TN9A 2LV2A 2EM7A 2CTDA 1DGCA
chains in the Genus database with same CATH superfamily
5AC5A 1NCSA 2CSHA 1I94E 2EPLX 4X62E 4LU9A 1FJGE 4F54A 2ENHA 1HNZE 2EPCA 4KZSA 1N36E 2GLIA 1QU6A 1IQSA 5KL3A 4O24A 2LT7A 2HHHE 5ADZA 2L2NA 2RQLA 2B7TA 2I9IA 4IS1C 2EM4A 3L00A 1DI2A 2V83A 2UU9E 2M1SA 2EOSA 2N3GA 2EN3A 1IBLE 2NUFA 3VHTB 4IJDA 2EN6A 2MC6A 1LLMC 2R1FA 4DUZE 2JVAA 4YHHE 1EH8A 2YSOA 4BBYA 2LMZA 4DV1E 3J7Yp 4JI4E 2RS6A 3VYXA 1QNTA 5LL6R 2EOZA 2DSYA 4JI5E 2YRKA 2JPAA 2EWLA 2L33A 3OTOE 4GKJE 2DGCA 1X6EA 2K7IA 2JWOA 1WRJA 2EMXA 2YWQA 3FIGA 1A1FA 4X8WA 2EM5A 2HGHA 2JYAA 1SR9A 1G2DC 2RTXA 4DV0E 4JI3E 2VRDA 5CFFE 2UXDE 2LTSA 2DB2A 1YUIA 4NZVA 5AE2A 4LF9E 1O0WA 3T1YE 2EOMA 2E1MA 1SFEA 2EMAA 2ELZA 2WCC3 2GPIA 4R2EA 4X65E 5IV8B 2NABA 2DLKA 3VK6A 2YTQA 4F6MA 2YTDA 4DV5E 3THNA 2UUAE 4GKKE 4J8ZA 2EE8A 2IHR1 2FTXB 2JR1A 1XMOE 2EN8A 2EPOA 1AAYA 5AC4A 3THOB 4WFTA 4WPYA 1B69A 1WXRA 2LUPB 2YRHA 2EM0A 2MC5A 2HC5A 2YTFA 2ENAA 2LRSA 3J7AG 2JY9A 4JI0E 2EN4A 2YTPA 2LO3A 2EPZA 4WSPA 1YYWA 4BHBA 2EMLA 1T4NA 1YFHA 4NXNE 1A1LA 2E5LE 2EOYA 2LCEA 3TQMA 2EOEA 4LFAE 5T6JA 1YSAC 4LFCE 4L8NA 5KL6A 2MKDA 2VE7C 5LMUE 3HQ1A 4BC9A 2N8XA 1HNXE 3C6KA 2V88A 4X66E 1ZBTA 4MLVA 4WYQB 2EL4A 2EL5A 2L3JA 4LF8E 1GZ6A 3QG5C 4F9BB 1BBOA 2HJJA 4MLQA 1EH7A 3MHHC 4R2AA 2EPXA 2LTRA 4OOGC 2EPKX 4DR5E 1HR0E 1YZ9A 2YTEA 2EM8A 1JK1A 1G2FC 2BB8A 5AE1A 2EMKA 5IT9C 4DR1E 2DRPA 3JAMC 3KZYA 4M0VA 2ADRA 2EPAA 2F8BA 3ECRA 1KYQA 2UXBE 1YUJA 1XNQE 1AH5A 2EL6A 4P7DA 4LF7E 2FV4B 5A69A 4B3RE 4RHBB 3F6HA 3MSWA 3C4TA 2EOJA 2LJUA 2EPNA 3HXLA 1IQOA 2LVHA 1Z1BA 4DV2E 1KJKA 3ADIA 4R8OA 2EJ4A 4O4KA 5DNYA 2DIXA 1ZAAC 3M99B 2EMWA 4R2SA 3DF6A 3EPHA 4DR6E 2F4VE 4B3SE 1IBME 2V87A 4F9AB 4WX9A 5F3WA 2EM2A 4DKKA 2WBSA 4AQYE 1T4LB 2LUQA 1TF6A 2EOXA 2PRTA 2RPCA 4LFBE 2R76A 2YRMA 4TUGA 2EPPA 2ZM6E 1JK2A 2EMYA 1YYKA 2EOIA 4R2DA 1RMDA 2YTOA 3BF2A 2DMYA 1N34E 3HTXA 4Q35B 4BMJA 5A6BA 4JI6E 4Q28A 4DR4E 4B3TE 4HTGA 1IBKE 4JI1E 5TSEA 4NXME 4YY3E 1PDAA 1TN9A 4DR7E 1DGCA 2DMIA 3ADJA 2EMBA 3BGHA 5FLXC 4R2QA 3BBGA 1PJTA 1YPNA 2KONA 4HEIA 4I8OA 2YU8A 1UILA 2WBUA 2EP3A 3ADGA 4ZYGA 4R03A 4BC7A 4N4RB 3IWCA 2YTGA 4DR2E 1WJPA 5AASA 4DV7E 2LE2A 3T1HE 5A6JA 3C4BA 4K0KE 2LBSB 1XNRE 5KL4A 1X3CA 1N3GA 4JI7E 1WHQA 2MDRA 2JP9A 2CT1A 4ZYEA 1X6HA 3UK3C 3OMLA 4F9CB 2EN1A 2EQ3A 4P78A 2V8QB 4FK5C 2YT4A 1RC7A 2ODRD 4BCAA 1MGTA 2BBGA 2KOUA 1XMQE 1A1KA 2NUGA 2M9AA 1BBGA 1X47A 2WZOA 2DLQA 1N32E 4NHRA 2NA2A 3LMLA 1MEYC 2EMHA 2EORA 2EMZA 1X5WA 2JOBA 3EPJA 1T4OA 2EMCA 3JU0A 1X49A 2CPNA 4O5GA 1A1HA 2H36X 2MDGA 3ZOQB 1TF3A 2A25A 2YZTA 1PKPA 3F6GA 5BR8E 4DV4E 2EQ0A 4DUYE 1NEIA 4WXDA 4WSGA 2EM9A 1EKZA 2EMGA 2YPNA 2YU5A 1X6FA 2EZ6A 1PJQA 4DV6E 1F2IG 2ODRC 4BS9A 2L8TA 3P1XA 5A6BD 4WXCA 2YTNA 2VF1A 1STUA 4RH8A 4JI8E 4M9VC 3HPZA 4LF6E 4TUIA 1DQ3A 1A1GA 2EPRA 4R2CA 2EOQA 2VQFE 2B3TB 4M2ZA 1GQEA 2WBTA 2B9DA 5LLQA 3EQ1A 4X64E 2EPMX 1IMUA 4ZYDA 2UXCE 3VYYA 2EM7A 2CTDA 4O43A 1WHNA 3H09A 4DR3E 2KHXA 2MKNA 1PJSA 1UHZA 2L6MA 2L2KB 4L5NC 4B3ME 2J7JA 2FGGA 1UN6B 2LJHA 2V86A 4LF5E 2EOHA 2NUEA 4M30A 1EH6A 3AUZA 2L2MA 2Q8UA 4KWYA 4GZNC 3IWBA 4GEQB 2M7QA 4R2RA 3IWDA 3AV0A 1YYOA 4JI2E 4LF4E 2EQ1A 5AE3A 2RSMA 2UUCE 1ZBQA 3LLHA 4F6NA 1N33E 4LTYA 2JOXA 3MHSC 5LMNE 5A6AA 5IWAE 4JV5E 2RS7A 3KZZA 2D9HA 2YTJA 4F2JC 1J5EE 2ELYA 2V85A 5A6KA 1T38A 1HNWE 3BIDA 2VQEE 3HPSA 4ZYHA 4BHCA 5KL7A 2EOFA 2EM3A 2YTIA 4KHPE 1L4SA 4DMIA 1BB8A 3C6MA 4X9JA 2EM6A 2ENCA 1GTKA 2EMIA 3EPKA 3ADLA 2L92A 5KL5A 2M4IA 5IXMB 2JXPA 4JYAE 1X48A 2E72A 1T39A 1A1IA 1ZR9A 3JTZA 2UUBE 1ZU1A 2EN2A 3DJWA 3J81C 1A1JA 2G7HA 2B7VA 4OX9E 2N3HA 2YSPA 2EPUA 1P47A 3J80C 2EOOA 3EPLA 4R2PA 4DV3E 3K6QA 1UBDC 2EMFA 2GHFA 5KL2A 2V89A 3RMPA 2RSIA 2I13A 2EN7A 2K4VA 2L3CA 1FKAE 1RQ0A 3KWRA 2LV2A 1J26A 5A2QC
chains in the Genus database with same CATH topology
2DMIA 1NCSA 2CSHA 2EMBA 2MKNA 2ENHA 2EPCA 4R2QA 2GLIA 2EL4A 2EL5A 2YU8A 5KL3A 2LT7A 1BBOA 2WBUA 4IS1C 3MHHC 2EP3A 4R2AA 2EPXA 2J7JA 2EM4A 1UN6B 2YTGA 2YTEA 1WJPA 2EM8A 2EOSA 2EOHA 2EN3A 1JK1A 1G2FC 2BB8A 3VHTB 4IJDA 2EN6A 1LLMC 2EMKA 2R1FA 5KL4A 4GZNC 1X3CA 2YSOA 2DRPA 4R2RA 2EQ1A 2JP9A 2CT1A 1X6HA 3UK3C 2ADRA 2EN1A 2EQ3A 2EPAA 2EOZA 2YRKA 4F6NA 2JPAA 4FK5C 1YUJA 2DGCA 1X6EA 3MHSC 2EMXA 2EL6A 1A1FA 2EM5A 1A1KA 2HGHA 2M9AA 1G2DC 2D9HA 2YTJA 2DLQA 4F2JC 2ELYA 2EOJA 2VRDA 1MEYC 2EMHA 2EORA 2LVHA 1Z1BA 2EMZA 1YUIA 1KJKA 1X5WA 3EPJA 2EMCA 2EJ4A 1A1HA 5KL7A 2EOFA 2EM3A 2MDGA 1ZAAC 3M99B 2EOMA 2A25A 2EMAA 1TF3A 2EMWA 2YTIA 2ELZA 2WCC3 4R2SA 4R2EA 3EPHA 2EQ0A 1BB8A 2NABA 4WSGA 2EM9A 2DLKA 2EMGA 2YU5A 4X9JA 2EM6A 2ENCA 2YTQA 2YTDA 4F6MA 1X6FA 2EMIA 2EM2A 3EPKA 5KL5A 2WBSA 2EE8A 1F2IG 2EN8A 1TF6A 1AAYA 2E72A 1A1IA 1ZR9A 2EOXA 2PRTA 2EN2A 1ZU1A 2RPCA 1B69A 1A1JA 2YRMA 2YRHA 2EM0A 2YTNA 2YTFA 2EPPA 2YSPA 2ENAA 2EPUA 4M9VC 1JK2A 1P47A 2EMYA 2EOOA 3EPLA 4R2PA 1A1GA 2EN4A 2YTPA 2LO3A 2EPZA 2EPRA 2EOIA 4R2CA 2EMLA 2EOQA 4R2DA 1UBDC 2EMFA 1RMDA 2GHFA 2YTOA 5KL2A 2RSIA 1A1LA 2EOYA 2LCEA 2WBTA 2EOEA 2I13A 2EN7A 1YSAC 5KL6A 2MKDA 1TN9A 2LV2A 2EM7A 2CTDA 1DGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DMI A;  1NCS A;  2CSH A;  2EMB A;  2MKN A;  2ENH A;  2EPC A;  4R2Q A;  2GLI A;  2EL4 A;  2EL5 A;  2YU8 A;  5KL3 A;  2LT7 A;  1BBO A;  2WBU A;  4IS1 C;  3MHH C;  2EP3 A;  4R2A A;  2EPX A;  2J7J A;  2EM4 A;  1UN6 B;  2YTG A;  2YTE A;  1WJP A;  2EM8 A;  2EOS A;  2EOH A;  2EN3 A;  1JK1 A;  1G2F C;  2BB8 A;  3VHT B;  4IJD A;  2EN6 A;  1LLM C;  2EMK A;  2R1F A;  5KL4 A;  4GZN C;  1X3C A;  2YSO A;  2DRP A;  4R2R A;  2EQ1 A;  2JP9 A;  2CT1 A;  1X6H A;  3UK3 C;  2ADR A;  2EN1 A;  2EQ3 A;  2EPA A;  2EOZ A;  2YRK A;  4F6N A;  2JPA A;  4FK5 C;  1YUJ A;  2DGC A;  1X6E A;  3MHS C;  2EMX A;  2EL6 A;  1A1F A;  2EM5 A;  1A1K A;  2HGH A;  2M9A A;  1G2D C;  2D9H A;  2YTJ A;  2DLQ A;  4F2J C;  2ELY A;  2EOJ A;  2VRD A;  1MEY C;  2EMH A;  2EOR A;  2LVH A;  1Z1B A;  2EMZ A;  1YUI A;  1KJK A;  1X5W A;  3EPJ A;  2EMC A;  2EJ4 A;  1A1H A;  5KL7 A;  2EOF A;  2EM3 A;  2MDG A;  1ZAA C;  3M99 B;  2EOM A;  2A25 A;  2EMA A;  1TF3 A;  2EMW A;  2YTI A;  2ELZ A;  2WCC 3;  4R2S A;  4R2E A;  3EPH A;  2EQ0 A;  1BB8 A;  2NAB A;  4WSG A;  2EM9 A;  2DLK A;  2EMG A;  2YU5 A;  4X9J A;  2EM6 A;  2ENC A;  2YTQ A;  2YTD A;  4F6M A;  1X6F A;  2EMI A;  2EM2 A;  3EPK A;  5KL5 A;  2WBS A;  2EE8 A;  1F2I G;  2EN8 A;  1TF6 A;  1AAY A;  2E72 A;  1A1I A;  1ZR9 A;  2EOX A;  2PRT A;  2EN2 A;  1ZU1 A;  2RPC A;  1B69 A;  1A1J A;  2YRM A;  2YRH A;  2EM0 A;  2YTN A;  2YTF A;  2EPP A;  2YSP A;  2ENA A;  2EPU A;  4M9V C;  1JK2 A;  1P47 A;  2EMY A;  2EOO A;  3EPL A;  4R2P A;  1A1G A;  2EN4 A;  2YTP A;  2LO3 A;  2EPZ A;  2EPR A;  2EOI A;  4R2C A;  2EML A;  2EOQ A;  4R2D A;  1UBD C;  2EMF A;  1RMD A;  2GHF A;  2YTO A;  5KL2 A;  2RSI A;  1A1L A;  2EOY A;  2LCE A;  2WBT A;  2EOE A;  2I13 A;  2EN7 A;  1YSA C;  5KL6 A;  2MKD A;  1TN9 A;  2LV2 A;  2EM7 A;  2CTD A;  1DGC A; 
#chains in the Genus database with same CATH topology
 5AC5 A;  1NCS A;  2CSH A;  1I94 E;  2EPL X;  4X62 E;  4LU9 A;  1FJG E;  4F54 A;  2ENH A;  1HNZ E;  2EPC A;  4KZS A;  1N36 E;  2GLI A;  1QU6 A;  1IQS A;  5KL3 A;  4O24 A;  2LT7 A;  2HHH E;  5ADZ A;  2L2N A;  2RQL A;  2B7T A;  2I9I A;  4IS1 C;  2EM4 A;  3L00 A;  1DI2 A;  2V83 A;  2UU9 E;  2M1S A;  2EOS A;  2N3G A;  2EN3 A;  1IBL E;  2NUF A;  3VHT B;  4IJD A;  2EN6 A;  2MC6 A;  1LLM C;  2R1F A;  4DUZ E;  2JVA A;  4YHH E;  1EH8 A;  2YSO A;  4BBY A;  2LMZ A;  4DV1 E;  3J7Y p;  4JI4 E;  2RS6 A;  3VYX A;  1QNT A;  5LL6 R;  2EOZ A;  2DSY A;  4JI5 E;  2YRK A;  2JPA A;  2EWL A;  2L33 A;  3OTO E;  4GKJ E;  2DGC A;  1X6E A;  2K7I A;  2JWO A;  1WRJ A;  2EMX A;  2YWQ A;  3FIG A;  1A1F A;  4X8W A;  2EM5 A;  2HGH A;  2JYA A;  1SR9 A;  1G2D C;  2RTX A;  4DV0 E;  4JI3 E;  2VRD A;  5CFF E;  2UXD E;  2LTS A;  2DB2 A;  1YUI A;  4NZV A;  5AE2 A;  4LF9 E;  1O0W A;  3T1Y E;  2EOM A;  2E1M A;  1SFE A;  2EMA A;  2ELZ A;  2WCC 3;  2GPI A;  4R2E A;  4X65 E;  5IV8 B;  2NAB A;  2DLK A;  3VK6 A;  2YTQ A;  4F6M A;  2YTD A;  4DV5 E;  3THN A;  2UUA E;  4GKK E;  4J8Z A;  2EE8 A;  2IHR 1;  2FTX B;  2JR1 A;  1XMO E;  2EN8 A;  2EPO A;  1AAY A;  5AC4 A;  3THO B;  4WFT A;  4WPY A;  1B69 A;  1WXR A;  2LUP B;  2YRH A;  2EM0 A;  2MC5 A;  2HC5 A;  2YTF A;  2ENA A;  2LRS A;  3J7A G;  2JY9 A;  4JI0 E;  2EN4 A;  2YTP A;  2LO3 A;  2EPZ A;  4WSP A;  1YYW A;  4BHB A;  2EML A;  1T4N A;  1YFH A;  4NXN E;  1A1L A;  2E5L E;  2EOY A;  2LCE A;  3TQM A;  2EOE A;  4LFA E;  5T6J A;  1YSA C;  4LFC E;  4L8N A;  5KL6 A;  2MKD A;  2VE7 C;  5LMU E;  3HQ1 A;  4BC9 A;  2N8X A;  1HNX E;  3C6K A;  2V88 A;  4X66 E;  1ZBT A;  4MLV A;  4WYQ B;  2EL4 A;  2EL5 A;  2L3J A;  4LF8 E;  1GZ6 A;  3QG5 C;  4F9B B;  1BBO A;  2HJJ A;  4MLQ A;  1EH7 A;  3MHH C;  4R2A A;  2EPX A;  2LTR A;  4OOG C;  2EPK X;  4DR5 E;  1HR0 E;  1YZ9 A;  2YTE A;  2EM8 A;  1JK1 A;  1G2F C;  2BB8 A;  5AE1 A;  2EMK A;  5IT9 C;  4DR1 E;  2DRP A;  3JAM C;  3KZY A;  4M0V A;  2ADR A;  2EPA A;  2F8B A;  3ECR A;  1KYQ A;  2UXB E;  1YUJ A;  1XNQ E;  1AH5 A;  2EL6 A;  4P7D A;  4LF7 E;  2FV4 B;  5A69 A;  4B3R E;  4RHB B;  3F6H A;  3MSW A;  3C4T A;  2EOJ A;  2LJU A;  2EPN A;  3HXL A;  1IQO A;  2LVH A;  1Z1B A;  4DV2 E;  1KJK A;  3ADI A;  4R8O A;  2EJ4 A;  4O4K A;  5DNY A;  2DIX A;  1ZAA C;  3M99 B;  2EMW A;  4R2S A;  3DF6 A;  3EPH A;  4DR6 E;  2F4V E;  4B3S E;  1IBM E;  2V87 A;  4F9A B;  4WX9 A;  5F3W A;  2EM2 A;  4DKK A;  2WBS A;  4AQY E;  1T4L B;  2LUQ A;  1TF6 A;  2EOX A;  2PRT A;  2RPC A;  4LFB E;  2R76 A;  2YRM A;  4TUG A;  2EPP A;  2ZM6 E;  1JK2 A;  2EMY A;  1YYK A;  2EOI A;  4R2D A;  1RMD A;  2YTO A;  3BF2 A;  2DMY A;  1N34 E;  3HTX A;  4Q35 B;  4BMJ A;  5A6B A;  4JI6 E;  4Q28 A;  4DR4 E;  4B3T E;  4HTG A;  1IBK E;  4JI1 E;  5TSE A;  4NXM E;  4YY3 E;  1PDA A;  1TN9 A;  4DR7 E;  1DGC A;  2DMI A;  3ADJ A;  2EMB A;  3BGH A;  5FLX C;  4R2Q A;  3BBG A;  1PJT A;  1YPN A;  2KON A;  4HEI A;  4I8O A;  2YU8 A;  1UIL A;  2WBU A;  2EP3 A;  3ADG A;  4ZYG A;  4R03 A;  4BC7 A;  4N4R B;  3IWC A;  2YTG A;  4DR2 E;  1WJP A;  5AAS A;  4DV7 E;  2LE2 A;  3T1H E;  5A6J A;  3C4B A;  4K0K E;  2LBS B;  1XNR E;  5KL4 A;  1X3C A;  1N3G A;  4JI7 E;  1WHQ A;  2MDR A;  2JP9 A;  2CT1 A;  4ZYE A;  1X6H A;  3UK3 C;  3OML A;  4F9C B;  2EN1 A;  2EQ3 A;  4P78 A;  2V8Q B;  4FK5 C;  2YT4 A;  1RC7 A;  2ODR D;  4BCA A;  1MGT A;  2BBG A;  2KOU A;  1XMQ E;  1A1K A;  2NUG A;  2M9A A;  1BBG A;  1X47 A;  2WZO A;  2DLQ A;  1N32 E;  4NHR A;  2NA2 A;  3LML A;  1MEY C;  2EMH A;  2EOR A;  2EMZ A;  1X5W A;  2JOB A;  3EPJ A;  1T4O A;  2EMC A;  3JU0 A;  1X49 A;  2CPN A;  4O5G A;  1A1H A;  2H36 X;  2MDG A;  3ZOQ B;  1TF3 A;  2A25 A;  2YZT A;  1PKP A;  3F6G A;  5BR8 E;  4DV4 E;  2EQ0 A;  4DUY E;  1NEI A;  4WXD A;  4WSG A;  2EM9 A;  1EKZ A;  2EMG A;  2YPN A;  2YU5 A;  1X6F A;  2EZ6 A;  1PJQ A;  4DV6 E;  1F2I G;  2ODR C;  4BS9 A;  2L8T A;  3P1X A;  5A6B D;  4WXC A;  2YTN A;  2VF1 A;  1STU A;  4RH8 A;  4JI8 E;  4M9V C;  3HPZ A;  4LF6 E;  4TUI A;  1DQ3 A;  1A1G A;  2EPR A;  4R2C A;  2EOQ A;  2VQF E;  2B3T B;  4M2Z A;  1GQE A;  2WBT A;  2B9D A;  5LLQ A;  3EQ1 A;  4X64 E;  2EPM X;  1IMU A;  4ZYD A;  2UXC E;  3VYY A;  2EM7 A;  2CTD A;  4O43 A;  1WHN A;  3H09 A;  4DR3 E;  2KHX A;  2MKN A;  1PJS A;  1UHZ A;  2L6M A;  2L2K B;  4L5N C;  4B3M E;  2J7J A;  2FGG A;  1UN6 B;  2LJH A;  2V86 A;  4LF5 E;  2EOH A;  2NUE A;  4M30 A;  1EH6 A;  3AUZ A;  2L2M A;  2Q8U A;  4KWY A;  4GZN C;  3IWB A;  4GEQ B;  2M7Q A;  4R2R A;  3IWD A;  3AV0 A;  1YYO A;  4JI2 E;  4LF4 E;  2EQ1 A;  5AE3 A;  2RSM A;  2UUC E;  1ZBQ A;  3LLH A;  4F6N A;  1N33 E;  4LTY A;  2JOX A;  3MHS C;  5LMN E;  5A6A A;  5IWA E;  4JV5 E;  2RS7 A;  3KZZ A;  2D9H A;  2YTJ A;  4F2J C;  1J5E E;  2ELY A;  2V85 A;  5A6K A;  1T38 A;  1HNW E;  3BID A;  2VQE E;  3HPS A;  4ZYH A;  4BHC A;  5KL7 A;  2EOF A;  2EM3 A;  2YTI A;  4KHP E;  1L4S A;  4DMI A;  1BB8 A;  3C6M A;  4X9J A;  2EM6 A;  2ENC A;  1GTK A;  2EMI A;  3EPK A;  3ADL A;  2L92 A;  5KL5 A;  2M4I A;  5IXM B;  2JXP A;  4JYA E;  1X48 A;  2E72 A;  1T39 A;  1A1I A;  1ZR9 A;  3JTZ A;  2UUB E;  1ZU1 A;  2EN2 A;  3DJW A;  3J81 C;  1A1J A;  2G7H A;  2B7V A;  4OX9 E;  2N3H A;  2YSP A;  2EPU A;  1P47 A;  3J80 C;  2EOO A;  3EPL A;  4R2P A;  4DV3 E;  3K6Q A;  1UBD C;  2EMF A;  2GHF A;  5KL2 A;  2V89 A;  3RMP A;  2RSI A;  2I13 A;  2EN7 A;  2K4V A;  2L3C A;  1FKA E;  1RQ0 A;  3KWR A;  2LV2 A;  1J26 A;  5A2Q C; 
#chains in the Genus database with same CATH homology
 2DMI A;  1NCS A;  2CSH A;  2EMB A;  2MKN A;  2ENH A;  2EPC A;  4R2Q A;  2GLI A;  2EL4 A;  2EL5 A;  2YU8 A;  5KL3 A;  2LT7 A;  1BBO A;  2WBU A;  4IS1 C;  3MHH C;  2EP3 A;  4R2A A;  2EPX A;  2J7J A;  2EM4 A;  1UN6 B;  2YTG A;  2YTE A;  1WJP A;  2EM8 A;  2EOS A;  2EOH A;  2EN3 A;  1JK1 A;  1G2F C;  2BB8 A;  3VHT B;  4IJD A;  2EN6 A;  1LLM C;  2EMK A;  2R1F A;  5KL4 A;  4GZN C;  1X3C A;  2YSO A;  2DRP A;  4R2R A;  2EQ1 A;  2JP9 A;  2CT1 A;  1X6H A;  3UK3 C;  2ADR A;  2EN1 A;  2EQ3 A;  2EPA A;  2EOZ A;  2YRK A;  4F6N A;  2JPA A;  4FK5 C;  1YUJ A;  2DGC A;  1X6E A;  3MHS C;  2EMX A;  2EL6 A;  1A1F A;  2EM5 A;  1A1K A;  2HGH A;  2M9A A;  1G2D C;  2D9H A;  2YTJ A;  2DLQ A;  4F2J C;  2ELY A;  2EOJ A;  2VRD A;  1MEY C;  2EMH A;  2EOR A;  2LVH A;  1Z1B A;  2EMZ A;  1YUI A;  1KJK A;  1X5W A;  3EPJ A;  2EMC A;  2EJ4 A;  1A1H A;  5KL7 A;  2EOF A;  2EM3 A;  2MDG A;  1ZAA C;  3M99 B;  2EOM A;  2A25 A;  2EMA A;  1TF3 A;  2EMW A;  2YTI A;  2ELZ A;  2WCC 3;  4R2S A;  4R2E A;  3EPH A;  2EQ0 A;  1BB8 A;  2NAB A;  4WSG A;  2EM9 A;  2DLK A;  2EMG A;  2YU5 A;  4X9J A;  2EM6 A;  2ENC A;  2YTQ A;  2YTD A;  4F6M A;  1X6F A;  2EMI A;  2EM2 A;  3EPK A;  5KL5 A;  2WBS A;  2EE8 A;  1F2I G;  2EN8 A;  1TF6 A;  1AAY A;  2E72 A;  1A1I A;  1ZR9 A;  2EOX A;  2PRT A;  2EN2 A;  1ZU1 A;  2RPC A;  1B69 A;  1A1J A;  2YRM A;  2YRH A;  2EM0 A;  2YTN A;  2YTF A;  2EPP A;  2YSP A;  2ENA A;  2EPU A;  4M9V C;  1JK2 A;  1P47 A;  2EMY A;  2EOO A;  3EPL A;  4R2P A;  1A1G A;  2EN4 A;  2YTP A;  2LO3 A;  2EPZ A;  2EPR A;  2EOI A;  4R2C A;  2EML A;  2EOQ A;  4R2D A;  1UBD C;  2EMF A;  1RMD A;  2GHF A;  2YTO A;  5KL2 A;  2RSI A;  1A1L A;  2EOY A;  2LCE A;  2WBT A;  2EOE A;  2I13 A;  2EN7 A;  1YSA C;  5KL6 A;  2MKD A;  1TN9 A;  2LV2 A;  2EM7 A;  2CTD A;  1DGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...