1EKZA

Nmr structure of the complex between the third dsrbd from drosophila staufen and a rna hairpin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
76
structure length
76
Chain Sequence
MDEGDKKSPISQVHEIGIKRNMTVHFKVLREEGPAHMKNFITACIVGSIVTEGEGNGKKVSKKRAAEKMLVELQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle/rna
molecule keywords STAUFEN DOUBLE-STRANDED RNA BINDING DOMAIN
publication title RNA recognition by a Staufen double-stranded RNA-binding domain.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 14
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2000-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1ekzA00
4JI1E 2CPNA 4DR5E 2HHHE 2UUBE 1WHQA 4JI2E 4DV5E 4OOGC 2B7VA 1N36E 3HTXA 4JI0E 4JI6E 2B3TB 1X47A 4DR1E 2UUCE 4DV2E 2NUFA 3VYYA 1T4LB 1I94E 2L3CA 2JVAA 4DR2E 5LMNE 3C4BA 2LUPB 4LF5E 1UHZA 2N3HA 4B3TE 4LFBE 4X8WA 4DKKA 1X49A 2DMYA 4DV1E 1T4NA 1HNZE 3J7Yp 4AQYE 1XMOE 2RS7A 4GKJE 4X65E 2UXDE 4YHHE 1X48A 4LF8E 1YZ9A 1IBME 4DR3E 4X64E 4JI4E 2B7TA 2YT4A 4JI3E 2VQEE 4GKKE 5BR8E 2L2MA 2VQFE 4LF6E 4M2ZA 2F4VE 1T4OA 2IHR1 2DIXA 2LTRA 2RTXA 4DUYE 2UUAE 2NUEA 2LTSA 4DUZE 1N32E 4LF4E 1J5EE 1XNRE 4DR4E 1N33E 4B3RE 1RQ0A 4JI8E 2LBSB 2L2KB 3ADJA 1EKZA 4M30A 2LRSA 2KHXA 4X62E 1YYOA 1GQEA 4JYAE 3OTOE 4JI7E 2UXCE 4NXNE 1IBKE 4K0KE 4LFAE 1HR0E 2DB2A 2RSMA 4B3SE 2ZM6E 1DI2A 4DV0E 1HNXE 2NUGA 1N34E 2N3GA 2L2NA 1IBLE 4DV4E 4X66E 4OX9E 4JV5E 4JI5E 1RC7A 2UXBE 4WFTA 4DV6E 3P1XA 2LUQA 1J26A 1XMQE 2UU9E 2RS6A 2L33A 3T1YE 1XNQE 1WHNA 2NA2A 4DR7E 1O0WA 1QU6A 1ZBTA 3LLHA 1HNWE 4LFCE 5CFFE 4LF9E 3ADIA 4YY3E 3ADGA 4WYQB 4NXME 2LJHA 5IWAE 3T1HE 4DV3E 1PKPA 2JY9A 2L3JA 1YYKA 2MDRA 1FKAE 4DR6E 3C4TA 2E5LE 1STUA 4DV7E 5LMUE 1UILA 1YYWA 2EZ6A 3ADLA 4KHPE 4LF7E 3VYXA 1FJGE 4B3ME
chains in the Genus database with same CATH superfamily
1GZ6A 2FTXB 1JK1A 4RH8A 4R2QA 5IV8B 4IJDA 2DSYA 1MGTA 2M1SA 4DV5E 1YUIA 2B7VA 1N36E 2GHFA 4JI6E 2FGGA 2EN6A 5KL2A 3HPSA 4R8OA 2VE7C 2EMCA 4DV2E 3THNA 1T4LB 3VHTB 4DR2E 4RHBB 2LVHA 2H36X 3J80C 1T38A 3MHSC 1X49A 4DV1E 4WXCA 2RS7A 4GKJE 4Q35B 2F8BA 4X65E 4BC9A 4O5GA 1X48A 4MLVA 5A6AA 1X3CA 2ENCA 2EM7A 2LMZA 2EOHA 5BR8E 4FK5C 2F4VE 2ELYA 4F9CB 2RTXA 2NUEA 2YSOA 1N32E 1J5EE 2YTPA 5KL3A 3ECRA 4DR4E 2JR1A 1N33E 3ADJA 1PJTA 1EKZA 3F6HA 2LRSA 3HQ1A 2EE8A 4X62E 4F6NA 1YYOA 5KL6A 3OTOE 2JYAA 4BHCA 4O43A 2JP9A 4LTYA 2EPAA 2LJUA 1HR0E 2EOJA 1KJKA 3C6MA 5A2QC 1YPNA 2MKDA 4P78A 4KWYA 2ENHA 3HXLA 2GLIA 3QG5C 2JWOA 2EM8A 4DMIA 5ADZA 3K6QA 2EPRA 2EPXA 5KL4A 4OX9E 4JV5E 2M7QA 2ELZA 3KZYA 1RC7A 3DF6A 4WFTA 1N3GA 1WRJA 2EPPA 4F6MA 5A69A 2JXPA 1J26A 2MC5A 1P47A 1X6FA 2RS6A 3T1YE 2NA2A 1IMUA 4J8ZA 1WJPA 1KYQA 3EPKA 3UK3C 5AE3A 2EN3A 4HEIA 1LLMC 4NXME 2E72A 1A1FA 1PKPA 2EM5A 1YYWA 2E5LE 2V89A 3MSWA 4KHPE 2ODRD 3VK6A 2N8XA 2J7JA 2EPOA 1NCSA 1EH6A 4TUGA 4OOGC 1ZU1A 3THOB 3HTXA 2E1MA 2I9IA 4BCAA 1DQ3A 2EMZA 1L4SA 1EH8A 2UUCE 4M0VA 2LO3A 2JVAA 2YRMA 4LF5E 4MLQA 2R1FA 2ODRC 2MKNA 2EOQA 4N4RB 2HJJA 2WBSA 2WBUA 4X8WA 2DMYA 1T4NA 2EQ1A 1HNZE 2EN4A 1X6EA 3L00A 4F9AB 2V85A 2EOFA 2EMFA 3J7AG 2LCEA 4DR3E 2B7TA 2YT4A 4GKKE 2I13A 4L5NC 2VQFE 1T4OA 4Q28A 1IQSA 4WX9A 2UUAE 4DUZE 2EORA 4WSPA 2EPLX 2K4VA 1T39A 2EMKA 2WZOA 2L2KB 1UBDC 3DJWA 1Z1BA 2EL5A 1AAYA 2CTDA 5IT9C 4F54A 2EN2A 2UXCE 3JU0A 2A25A 2L6MA 4F9BB 3FIGA 5AASA 2DB2A 2EN1A 2ZM6E 1DI2A 4DV0E 2DGCA 2YTGA 2EM2A 3LMLA 2JOBA 2V88A 4L8NA 5T6JA 2EQ0A 3MHHC 2UXBE 1YSAC 4BBYA 1JK2A 2DMIA 3J81C 2LUQA 2EM6A 1A1IA 2L33A 3EPHA 1WHNA 4ZYDA 1A1KA 1QU6A 2EOYA 2RQLA 3HPZA 5TSEA 2YU8A 2EPKX 4YY3E 2VF1A 3T1HE 2JY9A 2EOZA 2MDRA 3IWBA 1SR9A 1STUA 4DV7E 2EZ6A 2KONA 2KOUA 2MC6A 1TF3A 2YTJA 1FJGE 4B3ME 2G7HA 4JI1E 2M4IA 2CPNA 2VRDA 2EMAA 2EPNA 2HHHE 4BC7A 2EP3A 4TUIA 2HC5A 4R03A 3M99B 4WPYA 1X6HA 4JI0E 3F6GA 2DLQA 2EPUA 2B3TB 4R2DA 3VYYA 1I94E 1YFHA 1ZR9A 5LL6R 5LMNE 2Q8UA 4B3TE 2D9HA 5A6KA 1G2FC 3IWCA 1ZAAC 2WCC3 2YWQA 1DGCA 3J7Yp 2LV2A 4YHHE 5AC5A 3JTZA 3IWDA 4O24A 1A1HA 1IBME 4LF8E 1YZ9A 2FV4B 2LT7A 2YU5A 4R2EA 1A1LA 2L2MA 4LF6E 5A6BA 2IHR1 3OMLA 2LTRA 2ENAA 2DRPA 2YRHA 2EM3A 4LF4E 2EMWA 2WBTA 4B3RE 1RQ0A 4JI8E 2RPCA 4M30A 1GQEA 4I8OA 4R2SA 2V8QB 2L92A 4HTGA 4JI7E 4NXNE 2YRKA 4K0KE 5A6BD 1BBGA 4BS9A 3BIDA 2EOXA 4R2RA 1PJSA 2EQ3A 4GEQB 2NUGA 1N34E 2N3GA 3C6KA 1IBLE 4DV4E 2BBGA 4JI5E 1GTKA 2EJ4A 2EN7A 2EL6A 2PRTA 1B69A 2CT1A 1G2DC 3P1XA 2JPAA 3BGHA 5FLXC 2UU9E 3KZZA 1TF6A 1XNQE 1MEYC 1F2IG 2EMLA 2YPNA 1WXRA 1O0WA 1ZBTA 2EN8A 3LLHA 1HNWE 4LFCE 5CFFE 2V83A 2DLKA 3ADIA 2K7IA 3ADGA 4O4KA 4P7DA 3EQ1A 2LJHA 5IWAE 2L3JA 2EOIA 2V86A 1FKAE 4DR6E 2CSHA 3C4TA 1UILA 4LF7E 3VYXA 4DR5E 2YSPA 2UUBE 2EMHA 5F3WA 3TQMA 4NHRA 1WHQA 4ZYHA 4ZYEA 4JI2E 4ZYGA 3JAMC 4R2AA 4R2CA 1PJQA 3EPLA 2EMXA 4BHBA 1X47A 1BB8A 5IXMB 4DR1E 3KWRA 2JOXA 2NUFA 2L3CA 3C4BA 2LUPB 5DNYA 1UHZA 5KL7A 2N3HA 5AE1A 4LFBE 4DKKA 1IQOA 5LLQA 1X5WA 2YTDA 4AQYE 1XMOE 3AV0A 2RSIA 2UXDE 2HGHA 2R76A 4X64E 4JI4E 4X9JA 4JI3E 2VQEE 2EM4A 4M2ZA 1UN6B 2DIXA 1QNTA 4DUYE 1A1GA 2LTSA 4KZSA 4GZNC 2YTQA 2LE2A 2EPZA 4LU9A 2EWLA 1XNRE 1EH7A 2LBSB 3BF2A 3H09A 4BMJA 1PDAA 2KHXA 4JYAE 4WSGA 2EM9A 5A6JA 2EMBA 2YTFA 1IBKE 2EOMA 4LFAE 2B9DA 2RSMA 4IS1C 4B3SE 1SFEA 1NEIA 2EOOA 2YTIA 2YTOA 3RMPA 2YTEA 1HNXE 4F2JC 2ADRA 2L2NA 2V87A 2EMYA 1A1JA 4X66E 4NZVA 5AE2A 2EPCA 1ZBQA 4DV6E 2EOEA 5KL5A 1TN9A 2GPIA 2M9AA 2YZTA 1XMQE 1AH5A 3ZOQB 2NABA 4DR7E 4R2PA 4LF9E 2MDGA 4WYQB 2BB8A 3BBGA 1RMDA 2EPMX 4DV3E 2YTNA 4M9VC 1YYKA 2EM0A 2EL4A 2EMGA 3AUZA 2L8TA 5LMUE 5AC4A 3ADLA 1YUJA 4WXDA 1BBOA 2EOSA 2EMIA 3EPJA
chains in the Genus database with same CATH topology
1GZ6A 4JI1E 2FTXB 2M4IA 2CPNA 4DR5E 2HHHE 2UUBE 4BC7A 2DSYA 5F3WA 4TUIA 2M1SA 1WHQA 4JI2E 1YYWA 4R03A 4TUGA 4OOGC 4DV5E 2B7VA 4WPYA 1N36E 3HTXA 3JAMC 4JI0E 4JI6E 3F6GA 2FGGA 2E1MA 4BCAA 3HPSA 1DQ3A 4R8OA 2VE7C 2B3TB 1X47A 4DR1E 3KWRA 2JOXA 4M0VA 4DV2E 3VYYA 1T4LB 1I94E 2L3CA 2NUFA 2UUCE 2JVAA 5LL6R 4DR2E 5LMNE 3C4BA 2LUPB 4LF5E 5DNYA 2ODRC 1UHZA 2N3HA 2H36X 5AE1A 3J80C 4B3TE 4LFBE 4X8WA 3IWCA 1X49A 2DMYA 4DKKA 4DV1E 1T4NA 1HNZE 3J7Yp 4AQYE 1XMOE 2RS7A 4GKJE 2F8BA 3AV0A 2V85A 4BC9A 4F9AB 1X48A 4X65E 4YHHE 2UXDE 3JTZA 3IWDA 4LF8E 1IBME 1YZ9A 2E5LE 3J7AG 4DR3E 2FV4B 4X64E 4JI4E 2B7TA 2YT4A 2LMZA 4JI3E 2VQEE 4GKKE 5BR8E 2L2MA 4L5NC 2VQFE 4LF6E 4M2ZA 2F4VE 1T4OA 4Q28A 2IHR1 2DIXA 3OMLA 2LTRA 2RTXA 4F9CB 4DUYE 2UUAE 2LTSA 4DUZE 2NUEA 1N32E 4KZSA 4LF4E 4WSPA 1J5EE 2LE2A 1XNRE 4LU9A 2EWLA 2K4VA 4DR4E 2JR1A 1N33E 4B3RE 1RQ0A 4JI8E 2WZOA 2L2KB 3ADJA 2LBSB 4KHPE 3DJWA 1EKZA 4M30A 3H09A 3F6HA 2LRSA 3HQ1A 4BMJA 2KHXA 4X62E 1YYOA 1GQEA 4I8OA 4JYAE 3OTOE 5IT9C 4F54A 2V8QB 2L92A 4JI7E 2UXCE 4NXNE 1IBKE 3JU0A 2L6MA 4K0KE 4LTYA 4F9BB 4LFAE 3FIGA 2B9DA 5AASA 1HR0E 2DB2A 2RSMA 4B3SE 4BS9A 2ZM6E 2EZ6A 5A2QC 1DI2A 4P78A 4DV0E 3RMPA 4GEQB 3HXLA 1HNXE 3LMLA 2NUGA 2JWOA 1N34E 2JOBA 2N3GA 4DMIA 2V88A 4L8NA 2L2NA 5ADZA 2V87A 3K6QA 1IBLE 4DV4E 4X66E 4OX9E 5T6JA 4DR6E 4JI5E 4JV5E 5AE2A 2M7QA 1RC7A 3DF6A 2UXBE 4WFTA 4BBYA 1ZBQA 4DV6E 3P1XA 3J81C 2LUQA 5FLXC 1J26A 2MC5A 2YZTA 1XMQE 2RS6A 2UU9E 2L33A 3ZOQB 3T1YE 1XNQE 1WHNA 2NA2A 4DR7E 1WXRA 1O0WA 4J8ZA 1QU6A 1ZBTA 3LLHA 1HNWE 4LFCE 3HPZA 5CFFE 4LF9E 2V83A 3ADIA 4YY3E 3ADGA 5AE3A 4WYQB 4P7DA 4NXME 2VF1A 2LJHA 5IWAE 3T1HE 4DV3E 1PKPA 2JY9A 2L3JA 1YYKA 2MDRA 2V86A 1FKAE 3AUZA 1SR9A 3C4TA 2L8TA 1STUA 2V89A 3IWBA 1UILA 2KONA 2ODRD 3MSWA 3VK6A 5LMUE 4DV7E 2KOUA 2MC6A 3ADLA 4LF7E 3VYXA 1FJGE 4B3ME 2G7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI1 E;  2CPN A;  4DR5 E;  2HHH E;  2UUB E;  1WHQ A;  4JI2 E;  4DV5 E;  4OOG C;  2B7V A;  1N36 E;  3HTX A;  4JI0 E;  4JI6 E;  2B3T B;  1X47 A;  4DR1 E;  2UUC E;  4DV2 E;  2NUF A;  3VYY A;  1T4L B;  1I94 E;  2L3C A;  2JVA A;  4DR2 E;  5LMN E;  3C4B A;  2LUP B;  4LF5 E;  1UHZ A;  2N3H A;  4B3T E;  4LFB E;  4X8W A;  4DKK A;  1X49 A;  2DMY A;  4DV1 E;  1T4N A;  1HNZ E;  3J7Y p;  4AQY E;  1XMO E;  2RS7 A;  4GKJ E;  4X65 E;  2UXD E;  4YHH E;  1X48 A;  4LF8 E;  1YZ9 A;  1IBM E;  4DR3 E;  4X64 E;  4JI4 E;  2B7T A;  2YT4 A;  4JI3 E;  2VQE E;  4GKK E;  5BR8 E;  2L2M A;  2VQF E;  4LF6 E;  4M2Z A;  2F4V E;  1T4O A;  2IHR 1;  2DIX A;  2LTR A;  2RTX A;  4DUY E;  2UUA E;  2NUE A;  2LTS A;  4DUZ E;  1N32 E;  4LF4 E;  1J5E E;  1XNR E;  4DR4 E;  1N33 E;  4B3R E;  1RQ0 A;  4JI8 E;  2LBS B;  2L2K B;  3ADJ A;  1EKZ A;  4M30 A;  2LRS A;  2KHX A;  4X62 E;  1YYO A;  1GQE A;  4JYA E;  3OTO E;  4JI7 E;  2UXC E;  4NXN E;  1IBK E;  4K0K E;  4LFA E;  1HR0 E;  2DB2 A;  2RSM A;  4B3S E;  2ZM6 E;  1DI2 A;  4DV0 E;  1HNX E;  2NUG A;  1N34 E;  2N3G A;  2L2N A;  1IBL E;  4DV4 E;  4X66 E;  4OX9 E;  4JV5 E;  4JI5 E;  1RC7 A;  2UXB E;  4WFT A;  4DV6 E;  3P1X A;  2LUQ A;  1J26 A;  1XMQ E;  2UU9 E;  2RS6 A;  2L33 A;  3T1Y E;  1XNQ E;  1WHN A;  2NA2 A;  4DR7 E;  1O0W A;  1QU6 A;  1ZBT A;  3LLH A;  1HNW E;  4LFC E;  5CFF E;  4LF9 E;  3ADI A;  4YY3 E;  3ADG A;  4WYQ B;  4NXM E;  2LJH A;  5IWA E;  3T1H E;  4DV3 E;  1PKP A;  2JY9 A;  2L3J A;  1YYK A;  2MDR A;  1FKA E;  4DR6 E;  3C4T A;  2E5L E;  1STU A;  4DV7 E;  5LMU E;  1UIL A;  1YYW A;  2EZ6 A;  3ADL A;  4KHP E;  4LF7 E;  3VYX A;  1FJG E;  4B3M E; 
#chains in the Genus database with same CATH topology
 1GZ6 A;  2FTX B;  1JK1 A;  4RH8 A;  4R2Q A;  5IV8 B;  4IJD A;  2DSY A;  1MGT A;  2M1S A;  4DV5 E;  1YUI A;  2B7V A;  1N36 E;  2GHF A;  4JI6 E;  2FGG A;  2EN6 A;  5KL2 A;  3HPS A;  4R8O A;  2VE7 C;  2EMC A;  4DV2 E;  3THN A;  1T4L B;  3VHT B;  4DR2 E;  4RHB B;  2LVH A;  2H36 X;  3J80 C;  1T38 A;  3MHS C;  1X49 A;  4DV1 E;  4WXC A;  2RS7 A;  4GKJ E;  4Q35 B;  2F8B A;  4X65 E;  4BC9 A;  4O5G A;  1X48 A;  4MLV A;  5A6A A;  1X3C A;  2ENC A;  2EM7 A;  2LMZ A;  2EOH A;  5BR8 E;  4FK5 C;  2F4V E;  2ELY A;  4F9C B;  2RTX A;  2NUE A;  2YSO A;  1N32 E;  1J5E E;  2YTP A;  5KL3 A;  3ECR A;  4DR4 E;  2JR1 A;  1N33 E;  3ADJ A;  1PJT A;  1EKZ A;  3F6H A;  2LRS A;  3HQ1 A;  2EE8 A;  4X62 E;  4F6N A;  1YYO A;  5KL6 A;  3OTO E;  2JYA A;  4BHC A;  4O43 A;  2JP9 A;  4LTY A;  2EPA A;  2LJU A;  1HR0 E;  2EOJ A;  1KJK A;  3C6M A;  5A2Q C;  1YPN A;  2MKD A;  4P78 A;  4KWY A;  2ENH A;  3HXL A;  2GLI A;  3QG5 C;  2JWO A;  2EM8 A;  4DMI A;  5ADZ A;  3K6Q A;  2EPR A;  2EPX A;  5KL4 A;  4OX9 E;  4JV5 E;  2M7Q A;  2ELZ A;  3KZY A;  1RC7 A;  3DF6 A;  4WFT A;  1N3G A;  1WRJ A;  2EPP A;  4F6M A;  5A69 A;  2JXP A;  1J26 A;  2MC5 A;  1P47 A;  1X6F A;  2RS6 A;  3T1Y E;  2NA2 A;  1IMU A;  4J8Z A;  1WJP A;  1KYQ A;  3EPK A;  3UK3 C;  5AE3 A;  2EN3 A;  4HEI A;  1LLM C;  4NXM E;  2E72 A;  1A1F A;  1PKP A;  2EM5 A;  1YYW A;  2E5L E;  2V89 A;  3MSW A;  4KHP E;  2ODR D;  3VK6 A;  2N8X A;  2J7J A;  2EPO A;  1NCS A;  1EH6 A;  4TUG A;  4OOG C;  1ZU1 A;  3THO B;  3HTX A;  2E1M A;  2I9I A;  4BCA A;  1DQ3 A;  2EMZ A;  1L4S A;  1EH8 A;  2UUC E;  4M0V A;  2LO3 A;  2JVA A;  2YRM A;  4LF5 E;  4MLQ A;  2R1F A;  2ODR C;  2MKN A;  2EOQ A;  4N4R B;  2HJJ A;  2WBS A;  2WBU A;  4X8W A;  2DMY A;  1T4N A;  2EQ1 A;  1HNZ E;  2EN4 A;  1X6E A;  3L00 A;  4F9A B;  2V85 A;  2EOF A;  2EMF A;  3J7A G;  2LCE A;  4DR3 E;  2B7T A;  2YT4 A;  4GKK E;  2I13 A;  4L5N C;  2VQF E;  1T4O A;  4Q28 A;  1IQS A;  4WX9 A;  2UUA E;  4DUZ E;  2EOR A;  4WSP A;  2EPL X;  2K4V A;  1T39 A;  2EMK A;  2WZO A;  2L2K B;  1UBD C;  3DJW A;  1Z1B A;  2EL5 A;  1AAY A;  2CTD A;  5IT9 C;  4F54 A;  2EN2 A;  2UXC E;  3JU0 A;  2A25 A;  2L6M A;  4F9B B;  3FIG A;  5AAS A;  2DB2 A;  2EN1 A;  2ZM6 E;  1DI2 A;  4DV0 E;  2DGC A;  2YTG A;  2EM2 A;  3LML A;  2JOB A;  2V88 A;  4L8N A;  5T6J A;  2EQ0 A;  3MHH C;  2UXB E;  1YSA C;  4BBY A;  1JK2 A;  2DMI A;  3J81 C;  2LUQ A;  2EM6 A;  1A1I A;  2L33 A;  3EPH A;  1WHN A;  4ZYD A;  1A1K A;  1QU6 A;  2EOY A;  2RQL A;  3HPZ A;  5TSE A;  2YU8 A;  2EPK X;  4YY3 E;  2VF1 A;  3T1H E;  2JY9 A;  2EOZ A;  2MDR A;  3IWB A;  1SR9 A;  1STU A;  4DV7 E;  2EZ6 A;  2KON A;  2KOU A;  2MC6 A;  1TF3 A;  2YTJ A;  1FJG E;  4B3M E;  2G7H A;  4JI1 E;  2M4I A;  2CPN A;  2VRD A;  2EMA A;  2EPN A;  2HHH E;  4BC7 A;  2EP3 A;  4TUI A;  2HC5 A;  4R03 A;  3M99 B;  4WPY A;  1X6H A;  4JI0 E;  3F6G A;  2DLQ A;  2EPU A;  2B3T B;  4R2D A;  3VYY A;  1I94 E;  1YFH A;  1ZR9 A;  5LL6 R;  5LMN E;  2Q8U A;  4B3T E;  2D9H A;  5A6K A;  1G2F C;  3IWC A;  1ZAA C;  2WCC 3;  2YWQ A;  1DGC A;  3J7Y p;  2LV2 A;  4YHH E;  5AC5 A;  3JTZ A;  3IWD A;  4O24 A;  1A1H A;  1IBM E;  4LF8 E;  1YZ9 A;  2FV4 B;  2LT7 A;  2YU5 A;  4R2E A;  1A1L A;  2L2M A;  4LF6 E;  5A6B A;  2IHR 1;  3OML A;  2LTR A;  2ENA A;  2DRP A;  2YRH A;  2EM3 A;  4LF4 E;  2EMW A;  2WBT A;  4B3R E;  1RQ0 A;  4JI8 E;  2RPC A;  4M30 A;  1GQE A;  4I8O A;  4R2S A;  2V8Q B;  2L92 A;  4HTG A;  4JI7 E;  4NXN E;  2YRK A;  4K0K E;  5A6B D;  1BBG A;  4BS9 A;  3BID A;  2EOX A;  4R2R A;  1PJS A;  2EQ3 A;  4GEQ B;  2NUG A;  1N34 E;  2N3G A;  3C6K A;  1IBL E;  4DV4 E;  2BBG A;  4JI5 E;  1GTK A;  2EJ4 A;  2EN7 A;  2EL6 A;  2PRT A;  1B69 A;  2CT1 A;  1G2D C;  3P1X A;  2JPA A;  3BGH A;  5FLX C;  2UU9 E;  3KZZ A;  1TF6 A;  1XNQ E;  1MEY C;  1F2I G;  2EML A;  2YPN A;  1WXR A;  1O0W A;  1ZBT A;  2EN8 A;  3LLH A;  1HNW E;  4LFC E;  5CFF E;  2V83 A;  2DLK A;  3ADI A;  2K7I A;  3ADG A;  4O4K A;  4P7D A;  3EQ1 A;  2LJH A;  5IWA E;  2L3J A;  2EOI A;  2V86 A;  1FKA E;  4DR6 E;  2CSH A;  3C4T A;  1UIL A;  4LF7 E;  3VYX A;  4DR5 E;  2YSP A;  2UUB E;  2EMH A;  5F3W A;  3TQM A;  4NHR A;  1WHQ A;  4ZYH A;  4ZYE A;  4JI2 E;  4ZYG A;  3JAM C;  4R2A A;  4R2C A;  1PJQ A;  3EPL A;  2EMX A;  4BHB A;  1X47 A;  1BB8 A;  5IXM B;  4DR1 E;  3KWR A;  2JOX A;  2NUF A;  2L3C A;  3C4B A;  2LUP B;  5DNY A;  1UHZ A;  5KL7 A;  2N3H A;  5AE1 A;  4LFB E;  4DKK A;  1IQO A;  5LLQ A;  1X5W A;  2YTD A;  4AQY E;  1XMO E;  3AV0 A;  2RSI A;  2UXD E;  2HGH A;  2R76 A;  4X64 E;  4JI4 E;  4X9J A;  4JI3 E;  2VQE E;  2EM4 A;  4M2Z A;  1UN6 B;  2DIX A;  1QNT A;  4DUY E;  1A1G A;  2LTS A;  4KZS A;  4GZN C;  2YTQ A;  2LE2 A;  2EPZ A;  4LU9 A;  2EWL A;  1XNR E;  1EH7 A;  2LBS B;  3BF2 A;  3H09 A;  4BMJ A;  1PDA A;  2KHX A;  4JYA E;  4WSG A;  2EM9 A;  5A6J A;  2EMB A;  2YTF A;  1IBK E;  2EOM A;  4LFA E;  2B9D A;  2RSM A;  4IS1 C;  4B3S E;  1SFE A;  1NEI A;  2EOO A;  2YTI A;  2YTO A;  3RMP A;  2YTE A;  1HNX E;  4F2J C;  2ADR A;  2L2N A;  2V87 A;  2EMY A;  1A1J A;  4X66 E;  4NZV A;  5AE2 A;  2EPC A;  1ZBQ A;  4DV6 E;  2EOE A;  5KL5 A;  1TN9 A;  2GPI A;  2M9A A;  2YZT A;  1XMQ E;  1AH5 A;  3ZOQ B;  2NAB A;  4DR7 E;  4R2P A;  4LF9 E;  2MDG A;  4WYQ B;  2BB8 A;  3BBG A;  1RMD A;  2EPM X;  4DV3 E;  2YTN A;  4M9V C;  1YYK A;  2EM0 A;  2EL4 A;  2EMG A;  3AUZ A;  2L8T A;  5LMU E;  5AC4 A;  3ADL A;  1YUJ A;  4WXD A;  1BBO A;  2EOS A;  2EMI A;  3EPJ A; 
#chains in the Genus database with same CATH homology
 1GZ6 A;  4JI1 E;  2FTX B;  2M4I A;  2CPN A;  4DR5 E;  2HHH E;  2UUB E;  4BC7 A;  2DSY A;  5F3W A;  4TUI A;  2M1S A;  1WHQ A;  4JI2 E;  1YYW A;  4R03 A;  4TUG A;  4OOG C;  4DV5 E;  2B7V A;  4WPY A;  1N36 E;  3HTX A;  3JAM C;  4JI0 E;  4JI6 E;  3F6G A;  2FGG A;  2E1M A;  4BCA A;  3HPS A;  1DQ3 A;  4R8O A;  2VE7 C;  2B3T B;  1X47 A;  4DR1 E;  3KWR A;  2JOX A;  4M0V A;  4DV2 E;  3VYY A;  1T4L B;  1I94 E;  2L3C A;  2NUF A;  2UUC E;  2JVA A;  5LL6 R;  4DR2 E;  5LMN E;  3C4B A;  2LUP B;  4LF5 E;  5DNY A;  2ODR C;  1UHZ A;  2N3H A;  2H36 X;  5AE1 A;  3J80 C;  4B3T E;  4LFB E;  4X8W A;  3IWC A;  1X49 A;  2DMY A;  4DKK A;  4DV1 E;  1T4N A;  1HNZ E;  3J7Y p;  4AQY E;  1XMO E;  2RS7 A;  4GKJ E;  2F8B A;  3AV0 A;  2V85 A;  4BC9 A;  4F9A B;  1X48 A;  4X65 E;  4YHH E;  2UXD E;  3JTZ A;  3IWD A;  4LF8 E;  1IBM E;  1YZ9 A;  2E5L E;  3J7A G;  4DR3 E;  2FV4 B;  4X64 E;  4JI4 E;  2B7T A;  2YT4 A;  2LMZ A;  4JI3 E;  2VQE E;  4GKK E;  5BR8 E;  2L2M A;  4L5N C;  2VQF E;  4LF6 E;  4M2Z A;  2F4V E;  1T4O A;  4Q28 A;  2IHR 1;  2DIX A;  3OML A;  2LTR A;  2RTX A;  4F9C B;  4DUY E;  2UUA E;  2LTS A;  4DUZ E;  2NUE A;  1N32 E;  4KZS A;  4LF4 E;  4WSP A;  1J5E E;  2LE2 A;  1XNR E;  4LU9 A;  2EWL A;  2K4V A;  4DR4 E;  2JR1 A;  1N33 E;  4B3R E;  1RQ0 A;  4JI8 E;  2WZO A;  2L2K B;  3ADJ A;  2LBS B;  4KHP E;  3DJW A;  1EKZ A;  4M30 A;  3H09 A;  3F6H A;  2LRS A;  3HQ1 A;  4BMJ A;  2KHX A;  4X62 E;  1YYO A;  1GQE A;  4I8O A;  4JYA E;  3OTO E;  5IT9 C;  4F54 A;  2V8Q B;  2L92 A;  4JI7 E;  2UXC E;  4NXN E;  1IBK E;  3JU0 A;  2L6M A;  4K0K E;  4LTY A;  4F9B B;  4LFA E;  3FIG A;  2B9D A;  5AAS A;  1HR0 E;  2DB2 A;  2RSM A;  4B3S E;  4BS9 A;  2ZM6 E;  2EZ6 A;  5A2Q C;  1DI2 A;  4P78 A;  4DV0 E;  3RMP A;  4GEQ B;  3HXL A;  1HNX E;  3LML A;  2NUG A;  2JWO A;  1N34 E;  2JOB A;  2N3G A;  4DMI A;  2V88 A;  4L8N A;  2L2N A;  5ADZ A;  2V87 A;  3K6Q A;  1IBL E;  4DV4 E;  4X66 E;  4OX9 E;  5T6J A;  4DR6 E;  4JI5 E;  4JV5 E;  5AE2 A;  2M7Q A;  1RC7 A;  3DF6 A;  2UXB E;  4WFT A;  4BBY A;  1ZBQ A;  4DV6 E;  3P1X A;  3J81 C;  2LUQ A;  5FLX C;  1J26 A;  2MC5 A;  2YZT A;  1XMQ E;  2RS6 A;  2UU9 E;  2L33 A;  3ZOQ B;  3T1Y E;  1XNQ E;  1WHN A;  2NA2 A;  4DR7 E;  1WXR A;  1O0W A;  4J8Z A;  1QU6 A;  1ZBT A;  3LLH A;  1HNW E;  4LFC E;  3HPZ A;  5CFF E;  4LF9 E;  2V83 A;  3ADI A;  4YY3 E;  3ADG A;  5AE3 A;  4WYQ B;  4P7D A;  4NXM E;  2VF1 A;  2LJH A;  5IWA E;  3T1H E;  4DV3 E;  1PKP A;  2JY9 A;  2L3J A;  1YYK A;  2MDR A;  2V86 A;  1FKA E;  3AUZ A;  1SR9 A;  3C4T A;  2L8T A;  1STU A;  2V89 A;  3IWB A;  1UIL A;  2KON A;  2ODR D;  3MSW A;  3VK6 A;  5LMU E;  4DV7 E;  2KOU A;  2MC6 A;  3ADL A;  4LF7 E;  3VYX A;  1FJG E;  4B3M E;  2G7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...