1EKZA

Nmr structure of the complex between the third dsrbd from drosophila staufen and a rna hairpin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
76
structure length
76
Chain Sequence
MDEGDKKSPISQVHEIGIKRNMTVHFKVLREEGPAHMKNFITACIVGSIVTEGEGNGKKVSKKRAAEKMLVELQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAUFEN DOUBLE-STRANDED RNA BINDING DOMAIN
publication title RNA recognition by a Staufen double-stranded RNA-binding domain.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Cell cycle/rna
total genus 14
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2000-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1ekzA00
4JV5E 2UUAE 4DV6E 4LFCE 3T1HE 1IBKE 3C4BA 3ADIA 4WFTA 1XNQE 2L2MA 1N36E 1XMOE 1X48A 2NUEA 4DV0E 1T4LB 1EKZA 1YZ9A 2NUGA 4KHPE 1ZBTA 2B7VA 3ADGA 2EZ6A 2JVAA 3ADJA 4YY3E 1I94E 2LRSA 5LMUE 1J26A 2HHHE 1T4OA 1XMQE 4LF4E 4X64E 2LJHA 1HNWE 1GQEA 1IBME 2N3GA 1N34E 2F4VE 2CPNA 4LFBE 4LF7E 1STUA 2UXDE 4X65E 3VYXA 4JI7E 5BR8E 1HNXE 4YHHE 2L3CA 4LF8E 1T4NA 5LMNE 4JI1E 4M2ZA 2UUCE 2E5LE 4GKKE 2LBSB 1PKPA 2IHR1 1O0WA 4X66E 1YYOA 4K0KE 2RS7A 2UXCE 2RSMA 2UU9E 4B3TE 3LLHA 4JI8E 4DR5E 4LF5E 2RTXA 2DB2A 3C4TA 4DUZE 2B3TB 2NUFA 4NXME 1FJGE 4DR3E 3VYYA 4DR7E 4WYQB 2VQEE 4DV7E 4DV2E 3HTXA 4X62E 2VQFE 4AQYE 4GKJE 4LFAE 1WHQA 2KHXA 4OOGC 2L2NA 4JI0E 5IWAE 2B7TA 4JI3E 4LF9E 1QU6A 1UILA 4JYAE 4B3RE 4DV4E 2LUPB 1N33E 1FKAE 3OTOE 1RQ0A 2YT4A 2LUQA 2L2KB 1X47A 4DUYE 4DV1E 1HR0E 4JI2E 4LF6E 2RS6A 1XNRE 4JI4E 1HNZE 5CFFE 4DKKA 4NXNE 2MDRA 4OX9E 2LTSA 4M30A 1IBLE 4B3ME 1YYWA 2JY9A 4JI6E 1RC7A 2N3HA 1YYKA 2DIXA 4DV5E 2L3JA 2LTRA 2L33A 2UUBE 4DR4E 4JI5E 4DR1E 1UHZA 2ZM6E 3P1XA 4DR2E 3T1YE 4B3SE 1WHNA 2UXBE 1J5EE 3ADLA 1X49A 4DR6E 2NA2A 2DMYA 1DI2A 4X8WA 1N32E 3J7Yp 4DV3E
chains in the Genus database with same CATH superfamily
1RMDA 2UUAE 1N3GA 3IWDA 1T38A 3T1HE 3J80C 2LO3A 4J8ZA 2EOXA 4RHBB 2NUEA 4F6MA 5AC4A 2V89A 1EKZA 4KHPE 4WX9A 4R2SA 2EM6A 4ZYEA 2EOHA 1GTKA 5LMUE 1XMQE 2LJHA 2EOMA 2LCEA 1YPNA 2EM8A 1YFHA 1TF6A 2EPCA 3EQ1A 4WXDA 4GZNC 1G2DC 2F4VE 3QG5C 2JXPA 1X3CA 2UXDE 4JI7E 4O24A 1HNXE 2V85A 2JOXA 2LV2A 4F9BB 4Q28A 2WZOA 4R2AA 2LBSB 2EP3A 2KOUA 1PKPA 2IHR1 1YYOA 4X66E 4WSGA 1YUIA 1ZBQA 2RSMA 4B3TE 2JR1A 2L8TA 1IMUA 4DR5E 1A1JA 2YTDA 4ZYGA 5FLXC 4F6NA 5KL4A 4F2JC 3VK6A 4DR7E 2EPXA 2R76A 3JTZA 2BB8A 3J7AG 2B9DA 2V83A 3HTXA 1A1GA 3BBGA 4AQYE 2EMXA 4LFAE 2ENHA 2G7HA 1L4SA 2ENAA 1A1IA 5AC5A 2V8QB 4JYAE 2M7QA 2ENCA 2DSYA 1N33E 1FKAE 2V87A 1RQ0A 3ECRA 2LUQA 4DMIA 2EM4A 2EMLA 2EPLX 3BIDA 2V88A 1HNZE 3VHTB 4NXNE 5A2QC 2YSPA 2LTSA 4M30A 1A1FA 4O43A 1YYWA 2EOJA 2YTFA 2GHFA 2JY9A 1BBOA 1YYKA 2YTIA 2DIXA 4DV5E 5KL2A 3BF2A 2RSIA 2EQ0A 4DR1E 2YTPA 1WXRA 2EOOA 4B3SE 2UXBE 2EMZA 1X6FA 2CSHA 2FTXB 4ZYDA 3ADLA 4DR6E 2NA2A 2DMYA 2MKDA 2J7JA 4MLVA 3TQMA 4NHRA 1N32E 1X6EA 3J7Yp 1B69A 3C6MA 4DV3E 4DV6E 3J81C 4TUGA 4LFCE 1IBKE 3ADIA 1TF3A 1N36E 3EPHA 4BC9A 4DV0E 5LL6R 2EORA 5TSEA 2B7VA 2EL6A 1MGTA 1GZ6A 4R8OA 2JVAA 2GPIA 4BS9A 2LRSA 1PDAA 2V86A 1UBDC 3OMLA 1IBME 1IQSA 1ZR9A 2EOIA 2YTNA 2ELZA 2H36X 4X65E 2MC5A 4YHHE 3EPJA 1IQOA 4BBYA 3LMLA 4JI1E 1EH7A 4F9CB 3BGHA 5A6KA 5IXMB 2N8XA 2EN3A 4MLQA 1WRJA 2UXCE 4IS1C 4JI8E 2YWQA 5IV8B 2F8BA 5A6BD 2EM7A 2EMCA 4X9JA 4NXME 1FJGE 1AH5A 1A1LA 1QNTA 4BHBA 4L8NA 4I8OA 1JK1A 2EOFA 4KZSA 4DV2E 5F3WA 3FIGA 4X62E 2EPRA 2VQFE 2M4IA 4OOGC 2EPKX 3ZOQB 5AE2A 1ZAAC 1YSAC 2MKNA 4JI3E 2DMIA 2YPNA 3IWBA 1QU6A 1UILA 2YZTA 4B3RE 2DLQA 3THOB 4DUYE 4DV1E 4LF6E 4HTGA 3MHSC 1G2FC 2NABA 1XNRE 2VE7C 5A6BA 2HC5A 1KYQA 2EPZA 4B3ME 4WXCA 2EM0A 4R2PA 1P47A 4JI6E 2YTGA 2EWLA 1RC7A 3KWRA 2L33A 4JI5E 2EPUA 2JWOA 2YTEA 1AAYA 1NEIA 1UHZA 1J5EE 2A25A 3HQ1A 2LJUA 2DRPA 4X8WA 4R03A 5A69A 4OX9E 3AUZA 5ADZA 3H09A 2EPNA 1Z1BA 1PJSA 1XMOE 1T4LB 2EM5A 2LVHA 2NUGA 2M9AA 4IJDA 2EJ4A 3ADJA 1I94E 4RH8A 4R2DA 2HHHE 2FV4B 4HEIA 2RPCA 5KL3A 4X64E 5A6JA 4P7DA 1GQEA 2CT1A 4F9AB 5IT9C 2ADRA 2N3GA 3JU0A 2CPNA 4LFBE 4LF7E 1STUA 4FK5C 3VYXA 4BCAA 2YU5A 5BR8E 4P78A 2L3CA 2FGGA 2WCC3 1T4NA 5LMNE 2VRDA 2UUCE 2VF1A 2E5LE 2BBGA 4GKKE 1O0WA 4K0KE 2RS7A 2JYAA 3LLHA 4L5NC 2YU8A 3KZYA 3AV0A 2RQLA 2DB2A 3C4TA 4N4RB 1A1HA 1WJPA 4LU9A 2MDGA 4DR3E 3VYYA 4WYQB 4DV7E 2D9HA 2EQ1A 1KJKA 2LMZA 3HPSA 4WPYA 3KZZA 2JPAA 2EOQA 2EE8A 4GKJE 2L2NA 3UK3C 1A1KA 2EMBA 2JP9A 3JAMC 2EMIA 2YRMA 4DV4E 2LUPB 2EN7A 5T6JA 3OTOE 2YT4A 4JI2E 1X47A 1MEYC 2WBTA 2MC6A 4JI4E 2L6MA 2E1MA 4Q35B 3M99B 5A6AA 5CFFE 1DGCA 4DKKA 4BMJA 5KL6A 2MDRA 2K4VA 2EPMX 1IBLE 4M9VC 2YTQA 2N3HA 3THNA 2LTRA 2L3JA 5DNYA 2UUBE 4DR4E 1BB8A 1SR9A 2EOZA 4DR2E 2EN8A 2EOSA 3T1YE 2R1FA 2DLKA 2EMHA 3C6KA 4R2RA 5AASA 2EQ3A 1DI2A 3MSWA 2EN6A 2LT7A 2GLIA 4JV5E 2EOYA 3C4BA 4WFTA 1XNQE 2L2MA 1X48A 4GEQB 1T39A 2ODRC 1SFEA 1YZ9A 1ZBTA 2EMGA 3ADGA 1PJQA 2EZ6A 2EL5A 4YY3E 1J26A 1T4OA 4LF4E 3DF6A 1HNWE 2EPPA 3IWCA 2ODRD 1N34E 2EN4A 1DQ3A 1F2IG 3DJWA 2EM3A 2HGHA 4ZYHA 2EM9A 2EM2A 4LF8E 1NCSA 1PJTA 4M2ZA 3EPKA 2HJJA 2YTJA 3K6QA 4R2EA 2M1SA 1ZU1A 5KL5A 2WBSA 2EMYA 2L92A 2YRHA 1JK2A 2UU9E 2I9IA 4LF5E 2RTXA 3HXLA 2E72A 2EL4A 4DUZE 2B3TB 2EPAA 2PRTA 5KL7A 2NUFA 2KONA 2JOBA 2YTOA 2VQEE 1LLMC 4KWYA 5AE1A 2EN1A 4BC7A 1X5WA 3RMPA 4WSPA 2I13A 3HPZA 2EOEA 1WHQA 2KHXA 4R2CA 3MHHC 4O4KA 4JI0E 5IWAE 2B7TA 2CTDA 4LF9E 3F6HA 2EMKA 4NZVA 4TUIA 2LE2A 1X6HA 1YUJA 5AE3A 2L2KB 1HR0E 4O5GA 5LLQA 2ELYA 1BBGA 2RS6A 4M0VA 4R2QA 2EMWA 2YRKA 3F6GA 1TN9A 3L00A 2EMAA 2EN2A 2EMFA 2Q8UA 1EH8A 2YSOA 1EH6A 2EPOA 2ZM6E 3P1XA 4LTYA 1WHNA 4BHCA 1X49A 2WBUA 3EPLA 4F54A 1UN6B 2DGCA 2K7IA
chains in the Genus database with same CATH topology
4JV5E 2UUAE 4DV6E 3J81C 3AUZA 3IWDA 5ADZA 3H09A 4TUGA 3T1HE 3C4BA 1IBKE 4LFCE 3ADIA 4WFTA 1XNQE 3J80C 2L2MA 1N36E 4J8ZA 1XMOE 1X48A 4BC9A 2NUEA 4GEQB 4DV0E 5LL6R 1T4LB 2V89A 2ODRC 1EKZA 1YZ9A 2NUGA 4KHPE 1ZBTA 2B7VA 3ADGA 2EZ6A 1GZ6A 4R8OA 2JVAA 3ADJA 4BS9A 4YY3E 1I94E 2LRSA 5LMUE 1J26A 2HHHE 1T4OA 2FV4B 2V86A 3DF6A 4X64E 1XMQE 4LF4E 2LJHA 4P7DA 1GQEA 1HNWE 4F9AB 5IT9C 1N32E 3OMLA 1IBME 2N3GA 2ODRD 3IWCA 2CPNA 3JU0A 1N34E 2F4VE 1DQ3A 3DJWA 4LFBE 4LF7E 1STUA 2H36X 2UXDE 4X65E 2MC5A 3VYXA 4JI7E 4BCAA 5BR8E 1HNXE 4P78A 4YHHE 2L3CA 2FGGA 2V85A 3LMLA 4BBYA 2JOXA 1T4NA 4F9BB 4LF8E 4Q28A 5LMNE 4JI1E 4M2ZA 2UUCE 2VF1A 2WZOA 3K6QA 2E5LE 4GKKE 2LBSB 4F9CB 2M1SA 2KOUA 1PKPA 2IHR1 1O0WA 4X66E 1YYOA 4K0KE 2RS7A 2UXCE 1ZBQA 2RSMA 2L92A 2UU9E 4B3TE 3LLHA 4JI8E 2JR1A 2L8TA 2F8BA 4L5NC 3AV0A 4DR5E 4LF5E 2RTXA 3HXLA 2DB2A 3C4TA 5FLXC 4DUZE 2B3TB 2NUFA 2KONA 4NXME 1FJGE 2JOBA 4LU9A 4DR3E 3VK6A 3VYYA 4DR7E 4L8NA 4WYQB 2VQEE 4DV7E 4I8OA 4KZSA 5AE1A 4DV2E 2LMZA 3HPSA 3JTZA 3FIGA 4WPYA 4BC7A 2B9DA 2V83A 4X62E 5F3WA 3J7AG 3RMPA 3HTXA 4WSPA 2VQFE 4AQYE 3HPZA 4GKJE 4LFAE 1WHQA 2KHXA 2M4IA 4LF6E 4OOGC 2L2NA 2G7HA 4JI0E 5IWAE 2B7TA 3ZOQB 5AE2A 4JI3E 4LF9E 3IWBA 1QU6A 1UILA 3F6HA 2YZTA 3JAMC 4TUIA 4JYAE 2V8QB 2LE2A 4B3RE 2M7QA 2DSYA 5AE3A 4DV4E 2LUPB 1FKAE 1N33E 5T6JA 2V87A 1RQ0A 2YT4A 2LUQA 4DMIA 1X47A 2L2KB 3OTOE 4DUYE 4DV1E 1HR0E 2RS6A 4JI2E 4M0VA 1XNRE 2VE7C 2MC6A 4JI4E 2V88A 2L6MA 2E1MA 3F6GA 1HNZE 5CFFE 4DKKA 4BMJA 4NXNE 2MDRA 5A2QC 2K4VA 4OX9E 2LTSA 4M30A 1IBLE 4B3ME 1YYWA 2JY9A 4JI6E 2EWLA 1RC7A 2N3HA 1YYKA 2DIXA 3KWRA 4DV5E 2LTRA 2L3JA 2L33A 5DNYA 2UUBE 4DR4E 4JI5E 2JWOA 4DR1E 1SR9A 1UHZA 1WXRA 2ZM6E 3P1XA 4DR2E 3T1YE 4LTYA 1WHNA 4B3SE 2FTXB 1J5EE 3ADLA 2UXBE 1X49A 4DR6E 3HQ1A 2NA2A 2DMYA 4F54A 1DI2A 5AASA 3MSWA 4X8WA 4R03A 3J7Yp 4DV3E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JV5 E;  2UUA E;  4DV6 E;  4LFC E;  3T1H E;  1IBK E;  3C4B A;  3ADI A;  4WFT A;  1XNQ E;  2L2M A;  1N36 E;  1XMO E;  1X48 A;  2NUE A;  4DV0 E;  1T4L B;  1EKZ A;  1YZ9 A;  2NUG A;  4KHP E;  1ZBT A;  2B7V A;  3ADG A;  2EZ6 A;  2JVA A;  3ADJ A;  4YY3 E;  1I94 E;  2LRS A;  5LMU E;  1J26 A;  2HHH E;  1T4O A;  1XMQ E;  4LF4 E;  4X64 E;  2LJH A;  1HNW E;  1GQE A;  1IBM E;  2N3G A;  1N34 E;  2F4V E;  2CPN A;  4LFB E;  4LF7 E;  1STU A;  2UXD E;  4X65 E;  3VYX A;  4JI7 E;  5BR8 E;  1HNX E;  4YHH E;  2L3C A;  4LF8 E;  1T4N A;  5LMN E;  4JI1 E;  4M2Z A;  2UUC E;  2E5L E;  4GKK E;  2LBS B;  1PKP A;  2IHR 1;  1O0W A;  4X66 E;  1YYO A;  4K0K E;  2RS7 A;  2UXC E;  2RSM A;  2UU9 E;  4B3T E;  3LLH A;  4JI8 E;  4DR5 E;  4LF5 E;  2RTX A;  2DB2 A;  3C4T A;  4DUZ E;  2B3T B;  2NUF A;  4NXM E;  1FJG E;  4DR3 E;  3VYY A;  4DR7 E;  4WYQ B;  2VQE E;  4DV7 E;  4DV2 E;  3HTX A;  4X62 E;  2VQF E;  4AQY E;  4GKJ E;  4LFA E;  1WHQ A;  2KHX A;  4OOG C;  2L2N A;  4JI0 E;  5IWA E;  2B7T A;  4JI3 E;  4LF9 E;  1QU6 A;  1UIL A;  4JYA E;  4B3R E;  4DV4 E;  2LUP B;  1N33 E;  1FKA E;  3OTO E;  1RQ0 A;  2YT4 A;  2LUQ A;  2L2K B;  1X47 A;  4DUY E;  4DV1 E;  1HR0 E;  4JI2 E;  4LF6 E;  2RS6 A;  1XNR E;  4JI4 E;  1HNZ E;  5CFF E;  4DKK A;  4NXN E;  2MDR A;  4OX9 E;  2LTS A;  4M30 A;  1IBL E;  4B3M E;  1YYW A;  2JY9 A;  4JI6 E;  1RC7 A;  2N3H A;  1YYK A;  2DIX A;  4DV5 E;  2L3J A;  2LTR A;  2L33 A;  2UUB E;  4DR4 E;  4JI5 E;  4DR1 E;  1UHZ A;  2ZM6 E;  3P1X A;  4DR2 E;  3T1Y E;  4B3S E;  1WHN A;  2UXB E;  1J5E E;  3ADL A;  1X49 A;  4DR6 E;  2NA2 A;  2DMY A;  1DI2 A;  4X8W A;  1N32 E;  3J7Y p;  4DV3 E; 
#chains in the Genus database with same CATH topology
 1RMD A;  2UUA E;  1N3G A;  3IWD A;  1T38 A;  3T1H E;  3J80 C;  2LO3 A;  4J8Z A;  2EOX A;  4RHB B;  2NUE A;  4F6M A;  5AC4 A;  2V89 A;  1EKZ A;  4KHP E;  4WX9 A;  4R2S A;  2EM6 A;  4ZYE A;  2EOH A;  1GTK A;  5LMU E;  1XMQ E;  2LJH A;  2EOM A;  2LCE A;  1YPN A;  2EM8 A;  1YFH A;  1TF6 A;  2EPC A;  3EQ1 A;  4WXD A;  4GZN C;  1G2D C;  2F4V E;  3QG5 C;  2JXP A;  1X3C A;  2UXD E;  4JI7 E;  4O24 A;  1HNX E;  2V85 A;  2JOX A;  2LV2 A;  4F9B B;  4Q28 A;  2WZO A;  4R2A A;  2LBS B;  2EP3 A;  2KOU A;  1PKP A;  2IHR 1;  1YYO A;  4X66 E;  4WSG A;  1YUI A;  1ZBQ A;  2RSM A;  4B3T E;  2JR1 A;  2L8T A;  1IMU A;  4DR5 E;  1A1J A;  2YTD A;  4ZYG A;  5FLX C;  4F6N A;  5KL4 A;  4F2J C;  3VK6 A;  4DR7 E;  2EPX A;  2R76 A;  3JTZ A;  2BB8 A;  3J7A G;  2B9D A;  2V83 A;  3HTX A;  1A1G A;  3BBG A;  4AQY E;  2EMX A;  4LFA E;  2ENH A;  2G7H A;  1L4S A;  2ENA A;  1A1I A;  5AC5 A;  2V8Q B;  4JYA E;  2M7Q A;  2ENC A;  2DSY A;  1N33 E;  1FKA E;  2V87 A;  1RQ0 A;  3ECR A;  2LUQ A;  4DMI A;  2EM4 A;  2EML A;  2EPL X;  3BID A;  2V88 A;  1HNZ E;  3VHT B;  4NXN E;  5A2Q C;  2YSP A;  2LTS A;  4M30 A;  1A1F A;  4O43 A;  1YYW A;  2EOJ A;  2YTF A;  2GHF A;  2JY9 A;  1BBO A;  1YYK A;  2YTI A;  2DIX A;  4DV5 E;  5KL2 A;  3BF2 A;  2RSI A;  2EQ0 A;  4DR1 E;  2YTP A;  1WXR A;  2EOO A;  4B3S E;  2UXB E;  2EMZ A;  1X6F A;  2CSH A;  2FTX B;  4ZYD A;  3ADL A;  4DR6 E;  2NA2 A;  2DMY A;  2MKD A;  2J7J A;  4MLV A;  3TQM A;  4NHR A;  1N32 E;  1X6E A;  3J7Y p;  1B69 A;  3C6M A;  4DV3 E;  4DV6 E;  3J81 C;  4TUG A;  4LFC E;  1IBK E;  3ADI A;  1TF3 A;  1N36 E;  3EPH A;  4BC9 A;  4DV0 E;  5LL6 R;  2EOR A;  5TSE A;  2B7V A;  2EL6 A;  1MGT A;  1GZ6 A;  4R8O A;  2JVA A;  2GPI A;  4BS9 A;  2LRS A;  1PDA A;  2V86 A;  1UBD C;  3OML A;  1IBM E;  1IQS A;  1ZR9 A;  2EOI A;  2YTN A;  2ELZ A;  2H36 X;  4X65 E;  2MC5 A;  4YHH E;  3EPJ A;  1IQO A;  4BBY A;  3LML A;  4JI1 E;  1EH7 A;  4F9C B;  3BGH A;  5A6K A;  5IXM B;  2N8X A;  2EN3 A;  4MLQ A;  1WRJ A;  2UXC E;  4IS1 C;  4JI8 E;  2YWQ A;  5IV8 B;  2F8B A;  5A6B D;  2EM7 A;  2EMC A;  4X9J A;  4NXM E;  1FJG E;  1AH5 A;  1A1L A;  1QNT A;  4BHB A;  4L8N A;  4I8O A;  1JK1 A;  2EOF A;  4KZS A;  4DV2 E;  5F3W A;  3FIG A;  4X62 E;  2EPR A;  2VQF E;  2M4I A;  4OOG C;  2EPK X;  3ZOQ B;  5AE2 A;  1ZAA C;  1YSA C;  2MKN A;  4JI3 E;  2DMI A;  2YPN A;  3IWB A;  1QU6 A;  1UIL A;  2YZT A;  4B3R E;  2DLQ A;  3THO B;  4DUY E;  4DV1 E;  4LF6 E;  4HTG A;  3MHS C;  1G2F C;  2NAB A;  1XNR E;  2VE7 C;  5A6B A;  2HC5 A;  1KYQ A;  2EPZ A;  4B3M E;  4WXC A;  2EM0 A;  4R2P A;  1P47 A;  4JI6 E;  2YTG A;  2EWL A;  1RC7 A;  3KWR A;  2L33 A;  4JI5 E;  2EPU A;  2JWO A;  2YTE A;  1AAY A;  1NEI A;  1UHZ A;  1J5E E;  2A25 A;  3HQ1 A;  2LJU A;  2DRP A;  4X8W A;  4R03 A;  5A69 A;  4OX9 E;  3AUZ A;  5ADZ A;  3H09 A;  2EPN A;  1Z1B A;  1PJS A;  1XMO E;  1T4L B;  2EM5 A;  2LVH A;  2NUG A;  2M9A A;  4IJD A;  2EJ4 A;  3ADJ A;  1I94 E;  4RH8 A;  4R2D A;  2HHH E;  2FV4 B;  4HEI A;  2RPC A;  5KL3 A;  4X64 E;  5A6J A;  4P7D A;  1GQE A;  2CT1 A;  4F9A B;  5IT9 C;  2ADR A;  2N3G A;  3JU0 A;  2CPN A;  4LFB E;  4LF7 E;  1STU A;  4FK5 C;  3VYX A;  4BCA A;  2YU5 A;  5BR8 E;  4P78 A;  2L3C A;  2FGG A;  2WCC 3;  1T4N A;  5LMN E;  2VRD A;  2UUC E;  2VF1 A;  2E5L E;  2BBG A;  4GKK E;  1O0W A;  4K0K E;  2RS7 A;  2JYA A;  3LLH A;  4L5N C;  2YU8 A;  3KZY A;  3AV0 A;  2RQL A;  2DB2 A;  3C4T A;  4N4R B;  1A1H A;  1WJP A;  4LU9 A;  2MDG A;  4DR3 E;  3VYY A;  4WYQ B;  4DV7 E;  2D9H A;  2EQ1 A;  1KJK A;  2LMZ A;  3HPS A;  4WPY A;  3KZZ A;  2JPA A;  2EOQ A;  2EE8 A;  4GKJ E;  2L2N A;  3UK3 C;  1A1K A;  2EMB A;  2JP9 A;  3JAM C;  2EMI A;  2YRM A;  4DV4 E;  2LUP B;  2EN7 A;  5T6J A;  3OTO E;  2YT4 A;  4JI2 E;  1X47 A;  1MEY C;  2WBT A;  2MC6 A;  4JI4 E;  2L6M A;  2E1M A;  4Q35 B;  3M99 B;  5A6A A;  5CFF E;  1DGC A;  4DKK A;  4BMJ A;  5KL6 A;  2MDR A;  2K4V A;  2EPM X;  1IBL E;  4M9V C;  2YTQ A;  2N3H A;  3THN A;  2LTR A;  2L3J A;  5DNY A;  2UUB E;  4DR4 E;  1BB8 A;  1SR9 A;  2EOZ A;  4DR2 E;  2EN8 A;  2EOS A;  3T1Y E;  2R1F A;  2DLK A;  2EMH A;  3C6K A;  4R2R A;  5AAS A;  2EQ3 A;  1DI2 A;  3MSW A;  2EN6 A;  2LT7 A;  2GLI A;  4JV5 E;  2EOY A;  3C4B A;  4WFT A;  1XNQ E;  2L2M A;  1X48 A;  4GEQ B;  1T39 A;  2ODR C;  1SFE A;  1YZ9 A;  1ZBT A;  2EMG A;  3ADG A;  1PJQ A;  2EZ6 A;  2EL5 A;  4YY3 E;  1J26 A;  1T4O A;  4LF4 E;  3DF6 A;  1HNW E;  2EPP A;  3IWC A;  2ODR D;  1N34 E;  2EN4 A;  1DQ3 A;  1F2I G;  3DJW A;  2EM3 A;  2HGH A;  4ZYH A;  2EM9 A;  2EM2 A;  4LF8 E;  1NCS A;  1PJT A;  4M2Z A;  3EPK A;  2HJJ A;  2YTJ A;  3K6Q A;  4R2E A;  2M1S A;  1ZU1 A;  5KL5 A;  2WBS A;  2EMY A;  2L92 A;  2YRH A;  1JK2 A;  2UU9 E;  2I9I A;  4LF5 E;  2RTX A;  3HXL A;  2E72 A;  2EL4 A;  4DUZ E;  2B3T B;  2EPA A;  2PRT A;  5KL7 A;  2NUF A;  2KON A;  2JOB A;  2YTO A;  2VQE E;  1LLM C;  4KWY A;  5AE1 A;  2EN1 A;  4BC7 A;  1X5W A;  3RMP A;  4WSP A;  2I13 A;  3HPZ A;  2EOE A;  1WHQ A;  2KHX A;  4R2C A;  3MHH C;  4O4K A;  4JI0 E;  5IWA E;  2B7T A;  2CTD A;  4LF9 E;  3F6H A;  2EMK A;  4NZV A;  4TUI A;  2LE2 A;  1X6H A;  1YUJ A;  5AE3 A;  2L2K B;  1HR0 E;  4O5G A;  5LLQ A;  2ELY A;  1BBG A;  2RS6 A;  4M0V A;  4R2Q A;  2EMW A;  2YRK A;  3F6G A;  1TN9 A;  3L00 A;  2EMA A;  2EN2 A;  2EMF A;  2Q8U A;  1EH8 A;  2YSO A;  1EH6 A;  2EPO A;  2ZM6 E;  3P1X A;  4LTY A;  1WHN A;  4BHC A;  1X49 A;  2WBU A;  3EPL A;  4F54 A;  1UN6 B;  2DGC A;  2K7I A; 
#chains in the Genus database with same CATH homology
 4JV5 E;  2UUA E;  4DV6 E;  3J81 C;  3AUZ A;  3IWD A;  5ADZ A;  3H09 A;  4TUG A;  3T1H E;  3C4B A;  1IBK E;  4LFC E;  3ADI A;  4WFT A;  1XNQ E;  3J80 C;  2L2M A;  1N36 E;  4J8Z A;  1XMO E;  1X48 A;  4BC9 A;  2NUE A;  4GEQ B;  4DV0 E;  5LL6 R;  1T4L B;  2V89 A;  2ODR C;  1EKZ A;  1YZ9 A;  2NUG A;  4KHP E;  1ZBT A;  2B7V A;  3ADG A;  2EZ6 A;  1GZ6 A;  4R8O A;  2JVA A;  3ADJ A;  4BS9 A;  4YY3 E;  1I94 E;  2LRS A;  5LMU E;  1J26 A;  2HHH E;  1T4O A;  2FV4 B;  2V86 A;  3DF6 A;  4X64 E;  1XMQ E;  4LF4 E;  2LJH A;  4P7D A;  1GQE A;  1HNW E;  4F9A B;  5IT9 C;  1N32 E;  3OML A;  1IBM E;  2N3G A;  2ODR D;  3IWC A;  2CPN A;  3JU0 A;  1N34 E;  2F4V E;  1DQ3 A;  3DJW A;  4LFB E;  4LF7 E;  1STU A;  2H36 X;  2UXD E;  4X65 E;  2MC5 A;  3VYX A;  4JI7 E;  4BCA A;  5BR8 E;  1HNX E;  4P78 A;  4YHH E;  2L3C A;  2FGG A;  2V85 A;  3LML A;  4BBY A;  2JOX A;  1T4N A;  4F9B B;  4LF8 E;  4Q28 A;  5LMN E;  4JI1 E;  4M2Z A;  2UUC E;  2VF1 A;  2WZO A;  3K6Q A;  2E5L E;  4GKK E;  2LBS B;  4F9C B;  2M1S A;  2KOU A;  1PKP A;  2IHR 1;  1O0W A;  4X66 E;  1YYO A;  4K0K E;  2RS7 A;  2UXC E;  1ZBQ A;  2RSM A;  2L92 A;  2UU9 E;  4B3T E;  3LLH A;  4JI8 E;  2JR1 A;  2L8T A;  2F8B A;  4L5N C;  3AV0 A;  4DR5 E;  4LF5 E;  2RTX A;  3HXL A;  2DB2 A;  3C4T A;  5FLX C;  4DUZ E;  2B3T B;  2NUF A;  2KON A;  4NXM E;  1FJG E;  2JOB A;  4LU9 A;  4DR3 E;  3VK6 A;  3VYY A;  4DR7 E;  4L8N A;  4WYQ B;  2VQE E;  4DV7 E;  4I8O A;  4KZS A;  5AE1 A;  4DV2 E;  2LMZ A;  3HPS A;  3JTZ A;  3FIG A;  4WPY A;  4BC7 A;  2B9D A;  2V83 A;  4X62 E;  5F3W A;  3J7A G;  3RMP A;  3HTX A;  4WSP A;  2VQF E;  4AQY E;  3HPZ A;  4GKJ E;  4LFA E;  1WHQ A;  2KHX A;  2M4I A;  4LF6 E;  4OOG C;  2L2N A;  2G7H A;  4JI0 E;  5IWA E;  2B7T A;  3ZOQ B;  5AE2 A;  4JI3 E;  4LF9 E;  3IWB A;  1QU6 A;  1UIL A;  3F6H A;  2YZT A;  3JAM C;  4TUI A;  4JYA E;  2V8Q B;  2LE2 A;  4B3R E;  2M7Q A;  2DSY A;  5AE3 A;  4DV4 E;  2LUP B;  1FKA E;  1N33 E;  5T6J A;  2V87 A;  1RQ0 A;  2YT4 A;  2LUQ A;  4DMI A;  1X47 A;  2L2K B;  3OTO E;  4DUY E;  4DV1 E;  1HR0 E;  2RS6 A;  4JI2 E;  4M0V A;  1XNR E;  2VE7 C;  2MC6 A;  4JI4 E;  2V88 A;  2L6M A;  2E1M A;  3F6G A;  1HNZ E;  5CFF E;  4DKK A;  4BMJ A;  4NXN E;  2MDR A;  5A2Q C;  2K4V A;  4OX9 E;  2LTS A;  4M30 A;  1IBL E;  4B3M E;  1YYW A;  2JY9 A;  4JI6 E;  2EWL A;  1RC7 A;  2N3H A;  1YYK A;  2DIX A;  3KWR A;  4DV5 E;  2LTR A;  2L3J A;  2L33 A;  5DNY A;  2UUB E;  4DR4 E;  4JI5 E;  2JWO A;  4DR1 E;  1SR9 A;  1UHZ A;  1WXR A;  2ZM6 E;  3P1X A;  4DR2 E;  3T1Y E;  4LTY A;  1WHN A;  4B3S E;  2FTX B;  1J5E E;  3ADL A;  2UXB E;  1X49 A;  4DR6 E;  3HQ1 A;  2NA2 A;  2DMY A;  4F54 A;  1DI2 A;  5AAS A;  3MSW A;  4X8W A;  4R03 A;  3J7Y p;  4DV3 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...