1EKZA

Nmr structure of the complex between the third dsrbd from drosophila staufen and a rna hairpin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
76
structure length
76
Chain Sequence
b'MDEGDKKSPISQVHEIGIKRNMTVHFKVLREEGPAHMKNFITACIVGSIVTEGEGNGKKVSKKRAAEKMLVELQKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAUFEN DOUBLE-STRANDED RNA BINDING DOMAIN
publication title RNA recognition by a Staufen double-stranded RNA-binding domain.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Cell cycle/rna
total genus 14
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2000-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1ekzA00
4B3ME 4LF5E 4K0KE 2UUBE 4OX9E 1WHQA 2L2KB 4WYQB 1X48A 2N3GA 4JI6E 2L33A 2LRSA 2LTSA 1J5EE 4DR2E 4DV1E 1UHZA 1O0WA 2EZ6A 1YYWA 3LLHA 4JI0E 4DR4E 4JI8E 5CFFE 2L3CA 1HNZE 2N3HA 4X62E 4DR1E 4DV5E 1YYOA 3OTOE 2UUCE 1RQ0A 4B3RE 1EKZA 1ZBTA 4NXME 4M30A 1FJGE 1X49A 1XMOE 5LMUE 2LJHA 2LUQA 2UU9E 3ADGA 1N32E 4KHPE 4JI4E 2DB2A 4DV7E 1XMQE 1HNXE 3VYYA 2NA2A 3T1HE 3HTXA 2L2MA 2NUGA 2JY9A 2F4VE 3C4TA 4M2ZA 4WFTA 2L2NA 4X65E 2RS7A 2YT4A 2MDRA 2B7VA 1T4NA 4B3TE 4DKKA 4LF7E 4X64E 4GKKE 1IBKE 2UXCE 2LUPB 4JYAE 4LFAE 4DR3E 4YHHE 1HNWE 4X8WA 4DV6E 2LBSB 1PKPA 5LMNE 1J26A 1XNQE 4NXNE 1IBLE 3T1YE 4DR6E 4DV4E 3ADJA 1QU6A 5BR8E 1IBME 4OOGC 2UUAE 4DV2E 2L3JA 1FKAE 5IWAE 2KHXA 2VQEE 1N33E 4JI3E 2DMYA 4B3SE 2JVAA 2UXDE 2B3TB 2DIXA 1RC7A 1WHNA 1X47A 3C4BA 4AQYE 3J7Yp 1N34E 2VQFE 2IHR1 4LF6E 1STUA 3VYXA 4JI1E 2RSMA 4LF9E 2E5LE 4DR7E 3ADIA 1T4OA 1DI2A 1I94E 2ZM6E 4JV5E 1GQEA 2RTXA 2NUFA 4DV0E 1YYKA 4LF4E 4JI7E 2RS6A 4GKJE 1UILA 2B7TA 4DR5E 4YY3E 1XNRE 4LFBE 4DV3E 4LF8E 1YZ9A 2UXBE 4X66E 1N36E 4LFCE 4DUYE 2CPNA 4JI2E 1T4LB 2LTRA 3ADLA 2HHHE 1HR0E 2NUEA 4DUZE 4JI5E 3P1XA
chains in the Genus database with same CATH superfamily
3L00A 4K0KE 2UUBE 4OX9E 1WHQA 1L4SA 2EMCA 2D9HA 3MHHC 3LLHA 5IXMB 2DMIA 2EPXA 5A6KA 4WX9A 1HNZE 2JOXA 1AH5A 2VE7C 2CTDA 2ELYA 1YUJA 4B3RE 3HXLA 2V87A 4ZYGA 1FJGE 1XMOE 2LJHA 5A6BD 2LUQA 2UU9E 2YTFA 4DV7E 4HTGA 2JY9A 2LJUA 2MKNA 2EMAA 2LT7A 2EMFA 2L2NA 4HEIA 4N4RB 2EMIA 2EMGA 4BHBA 2EWLA 2ENHA 4DKKA 2YTDA 4X64E 2UXCE 2V83A 1G2DC 2RSIA 4LFAE 2EM6A 2EMWA 4YHHE 1EH7A 4ZYDA 2LBSB 2EMXA 2EN8A 1PDAA 1X6FA 2EN2A 1IBLE 4DV4E 1IBME 4DV2E 2EOXA 2L3JA 2YWQA 3KZZA 2EOHA 1N33E 2EM8A 2DMYA 3DF6A 1KYQA 4O5GA 2DLQA 5AC4A 2EM4A 2UXDE 1TF6A 1EH8A 2DIXA 2EOSA 1RC7A 3HPZA 4X9JA 2MC5A 1N34E 2EPZA 2YTNA 1STUA 4JI1E 2G7HA 2RSMA 3LMLA 4DR7E 2EQ1A 2LCEA 4J8ZA 4F9BB 2DRPA 2FGGA 5KL6A 1GQEA 3EPJA 1G2FC 1SR9A 2J7JA 2L8TA 2NUFA 4IS1C 3F6GA 4LF4E 5A6BA 4DR5E 2EPPA 1YZ9A 2UXBE 2EM5A 4Q35B 2MC6A 1BBOA 2EN4A 3DJWA 3BBGA 4Q28A 4JI5E 1YPNA 2WBUA 2JP9A 5A69A 2N3GA 2EPNA 3ECRA 4GEQB 2H36X 5LL6R 4JI6E 3F6HA 3HPSA 2EOJA 4DR4E 2WCC3 2K7IA 2EJ4A 1WJPA 3H09A 2LO3A 4DR1E 2EL6A 3BF2A 4X62E 1A1HA 1NCSA 1A1FA 2EORA 1IMUA 2EOQA 4NXME 3KZYA 5AE2A 4M30A 1X49A 4BCAA 4F9AB 3ADGA 4O24A 2EPMX 2EPCA 2DB2A 2EMYA 2EOMA 2EPAA 4WXDA 2NA2A 2EL4A 4MLQA 3VYYA 3HTXA 2L2MA 2NUGA 4F54A 4M2ZA 2EOYA 4X65E 1UBDC 2MDRA 2B7VA 1MGTA 2A25A 3IWCA 2EMBA 2ENAA 2L6MA 2EPRA 5A2QC 1IBKE 2DSYA 4I8OA 1UN6B 3BIDA 3VK6A 4DV6E 2VF1A 3RMPA 1MEYC 2MKDA 4R2PA 1J26A 4NXNE 2E72A 2YRHA 1ZU1A 2CSHA 3AUZA 1PJQA 4ZYEA 1P47A 5TSEA 4L8NA 5IT9C 1IQSA 4JI3E 2YTGA 5ADZA 5AASA 2V88A 2EOFA 1Z1BA 2JXPA 1X47A 5AE1A 3J7Yp 1X6EA 4BMJA 4LF6E 2EN7A 3C6MA 3VYXA 1SFEA 2ELZA 5KL5A 4LF9E 2E5LE 3ADIA 2YTIA 3J80C 1RMDA 1I94E 4JV5E 3C6KA 1EH6A 2NABA 2I9IA 3ZOQB 4R2DA 4DV0E 2B9DA 1YYKA 2EMKA 4JI7E 4GKJE 4R2AA 1UILA 2EE8A 2EN3A 1XNRE 4RH8A 2V85A 4DV3E 2EPLX 1N36E 3IWBA 2M7QA 4DUYE 1IQOA 4JI2E 2LTRA 4DUZE 4DR6E 2YRKA 2EM7A 2EN6A 4TUGA 1QNTA 4WYQB 1TF3A 2KONA 2L33A 2LTSA 1J5EE 1LLMC 1UHZA 2EL5A 1O0WA 2EN1A 2EZ6A 4NZVA 4JI0E 4L5NC 4LU9A 3M99B 5AC5A 2YTOA 2L3CA 1N3GA 2N3HA 1YYOA 3OTOE 4KWYA 2UUCE 2EM3A 1ZBQA 1DQ3A 2YSOA 4M0VA 2EQ3A 2WBTA 1X3CA 1N32E 4KHPE 2YTJA 4KZSA 4BS9A 1XMQE 2YRMA 2E1MA 2EMZA 1HNXE 3EPLA 4MLVA 5KL2A 2F4VE 3C4TA 1KJKA 4BC9A 1X6HA 2RS7A 2EM0A 3EPKA 2GHFA 2ENCA 2F8BA 4GKKE 4R2QA 2M4IA 4DR3E 4BBYA 2EMHA 2EOIA 3BGHA 3HQ1A 3THOB 1GTKA 2BB8A 2N8XA 4R2SA 2YPNA 3T1YE 1T38A 2YZTA 5BR8E 2WBSA 4OOGC 1DGCA 1FKAE 5IWAE 2VQEE 2MDGA 3QG5C 4B3SE 3TQMA 1NEIA 2JOBA 1AAYA 3JU0A 2CT1A 1A1IA 3FIGA 2YU5A 3C4BA 4AQYE 2EM9A 4TUIA 1A1KA 2YTQA 2YTEA 2JWOA 2YTPA 2EPUA 4O4KA 5A6AA 1T4OA 2WZOA 1DI2A 2DGCA 2LVHA 1YUIA 2JR1A 3K6QA 2RTXA 2R1FA 2YSPA 3VHTB 1YFHA 5LLQA 4YY3E 3J7AG 2RPCA 2EM2A 5AE3A 3AV0A 1JK1A 4LFCE 2HC5A 4F2JC 2M9AA 1T4LB 2EPKX 2HHHE 2NUEA 1JK2A 1ZR9A 4B3ME 4LF5E 2M1SA 2FTXB 2L2KB 4F6MA 4O43A 1X48A 2LRSA 4P78A 4DR2E 4F9CB 4DV1E 2V86A 1YSAC 2ODRC 1YYWA 2EPOA 4GZNC 2EP3A 5KL3A 2L92A 1GZ6A 4JI8E 5CFFE 1T39A 3EQ1A 3EPHA 2LE2A 4R2EA 4DV5E 1RQ0A 1EKZA 1ZBTA 5T6JA 1BBGA 1X5WA 5LMUE 3MHSC 2GLIA 4JI4E 2VRDA 4R03A 3T1HE 4M9VC 2LMZA 3J81C 4BC7A 3UK3C 4WFTA 2EOEA 2EMLA 2YT4A 5IV8B 2V89A 1T4NA 4BHCA 4B3TE 4LF7E 4WXCA 3IWDA 5A6JA 2K4VA 4ZYHA 2PRTA 2LV2A 2LUPB 4JYAE 1HNWE 1TN9A 4X8WA 4R2CA 1PKPA 2I13A 1B69A 5LMNE 2HGHA 1XNQE 4R2RA 2ADRA 3ADJA 1QU6A 4F6NA 1F2IG 2UUAE 2KOUA 2RQLA 2KHXA 4R8OA 4WSGA 1BB8A 2YU8A 2BBGA 2ODRD 2JVAA 1A1JA 3MSWA 1WXRA 2B3TB 5KL7A 1WHNA 2VQFE 2IHR1 4WPYA 5DNYA 4LTYA 1PJSA 2V8QB 2EQ0A 2JYAA 4RHBB 2HJJA 2ZM6E 3JAMC 2GPIA 4FK5C 4IJDA 1WRJA 3JTZA 2EOOA 2EOZA 2RS6A 2R76A 2B7TA 3OMLA 2JPAA 4LFBE 3KWRA 4LF8E 2DLKA 5KL4A 5F3WA 4DMIA 4WSPA 1PJTA 4X66E 1A1GA 2FV4B 1A1LA 2CPNA 5FLXC 2Q8UA 4P7DA 3ADLA 3THNA 1HR0E 4NHRA 1ZAAC 3P1XA
chains in the Genus database with same CATH topology
4B3ME 4LF5E 2M1SA 4K0KE 2FTXB 2UUBE 4OX9E 1WHQA 4TUGA 2L2KB 4WYQB 1X48A 2N3GA 4JI6E 2KONA 2L33A 2H36X 2LRSA 2LTSA 4GEQB 4P78A 3F6HA 1UHZA 2V86A 5LL6R 4F9CB 1O0WA 2ODRC 4DV1E 3HPSA 2EZ6A 1YYWA 3LLHA 4JI0E 4DR4E 2L92A 1GZ6A 4L5NC 4LU9A 4JI8E 5CFFE 2L3CA 1HNZE 3H09A 2JOXA 2LE2A 2N3HA 4X62E 4DR1E 2VE7C 4DV5E 3OTOE 1YYOA 2UUCE 1RQ0A 4B3RE 1EKZA 1ZBTA 3HXLA 5T6JA 2V87A 1ZBQA 4NXME 5AE2A 4M30A 1FJGE 1DQ3A 1X49A 4BCAA 5LMUE 1XMOE 4M0VA 2LJHA 2LUQA 4F9AB 2UU9E 3ADGA 1N32E 4KHPE 4JI4E 4KZSA 4BS9A 2DB2A 4DV7E 2E1MA 1XMQE 1HNXE 4R03A 3VYYA 2NA2A 3T1HE 2LMZA 3J81C 3HTXA 4BC7A 2L2MA 2NUGA 2JY9A 4F54A 2F4VE 3C4TA 4M2ZA 4WFTA 2L2NA 4BC9A 4X65E 2RS7A 2YT4A 2MDRA 2B7VA 2V89A 2EWLA 2L6MA 1T4NA 3IWCA 4B3TE 4DKKA 4LF7E 3IWDA 2F8BA 4X64E 5A2QC 4GKKE 2K4VA 1IBKE 2UXCE 2M4IA 2DSYA 2V83A 2LUPB 4I8OA 4LFAE 4DR3E 4JYAE 4BBYA 4YHHE 4X8WA 3VK6A 1HNWE 4DV6E 2LBSB 2VF1A 1PKPA 3RMPA 3HQ1A 5LMNE 1J26A 1XNQE 4NXNE 1IBLE 3T1YE 4DR6E 3AUZA 4DV4E 2YZTA 1QU6A 3ADJA 5BR8E 1IBME 4OOGC 2KOUA 4DV2E 2UUAE 2L3JA 1FKAE 5IWAE 2KHXA 4R8OA 2VQEE 4L8NA 1N33E 5IT9C 1J5EE 4JI3E 2DMYA 3DF6A 4B3SE 2JOBA 5ADZA 2ODRD 5AASA 3JU0A 2JVAA 2V88A 3FIGA 3MSWA 2UXDE 1WXRA 2B3TB 2DIXA 1RC7A 1WHNA 1X47A 3C4BA 2MC5A 3HPZA 5AE1A 3J7Yp 4BMJA 2VQFE 4TUIA 2IHR1 4WPYA 4AQYE 1N34E 4LF6E 5DNYA 1STUA 3VYXA 4LTYA 4JI1E 2JWOA 2G7HA 2RSMA 4LF9E 2E5LE 3LMLA 2V8QB 3ADIA 3J80C 4DUZE 4DR7E 1T4OA 2WZOA 1DI2A 4J8ZA 4F9BB 1I94E 2ZM6E 3JAMC 2FGGA 4DR2E 1GQEA 2JR1A 3K6QA 3ZOQB 4JV5E 2RTXA 1SR9A 2L8TA 3JTZA 2NUFA 4DV0E 2B9DA 1YYKA 3F6GA 4LF4E 4JI7E 2RS6A 4GKJE 1UILA 2B7TA 3OMLA 4DR5E 4YY3E 1XNRE 3J7AG 4DV3E 2V85A 3KWRA 4LF8E 1YZ9A 4LFBE 2UXBE 5F3WA 4DMIA 5AE3A 4WSPA 2MC6A 3AV0A 4X66E 1N36E 2FV4B 3IWBA 2M7QA 4LFCE 4DUYE 2CPNA 5FLXC 3DJWA 4JI2E 1T4LB 4P7DA 2LTRA 3ADLA 2HHHE 1HR0E 2NUEA 4Q28A 4JI5E 3P1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3M E;  4LF5 E;  4K0K E;  2UUB E;  4OX9 E;  1WHQ A;  2L2K B;  4WYQ B;  1X48 A;  2N3G A;  4JI6 E;  2L33 A;  2LRS A;  2LTS A;  1J5E E;  4DR2 E;  4DV1 E;  1UHZ A;  1O0W A;  2EZ6 A;  1YYW A;  3LLH A;  4JI0 E;  4DR4 E;  4JI8 E;  5CFF E;  2L3C A;  1HNZ E;  2N3H A;  4X62 E;  4DR1 E;  4DV5 E;  1YYO A;  3OTO E;  2UUC E;  1RQ0 A;  4B3R E;  1EKZ A;  1ZBT A;  4NXM E;  4M30 A;  1FJG E;  1X49 A;  1XMO E;  5LMU E;  2LJH A;  2LUQ A;  2UU9 E;  3ADG A;  1N32 E;  4KHP E;  4JI4 E;  2DB2 A;  4DV7 E;  1XMQ E;  1HNX E;  3VYY A;  2NA2 A;  3T1H E;  3HTX A;  2L2M A;  2NUG A;  2JY9 A;  2F4V E;  3C4T A;  4M2Z A;  4WFT A;  2L2N A;  4X65 E;  2RS7 A;  2YT4 A;  2MDR A;  2B7V A;  1T4N A;  4B3T E;  4DKK A;  4LF7 E;  4X64 E;  4GKK E;  1IBK E;  2UXC E;  2LUP B;  4JYA E;  4LFA E;  4DR3 E;  4YHH E;  1HNW E;  4X8W A;  4DV6 E;  2LBS B;  1PKP A;  5LMN E;  1J26 A;  1XNQ E;  4NXN E;  1IBL E;  3T1Y E;  4DR6 E;  4DV4 E;  3ADJ A;  1QU6 A;  5BR8 E;  1IBM E;  4OOG C;  2UUA E;  4DV2 E;  2L3J A;  1FKA E;  5IWA E;  2KHX A;  2VQE E;  1N33 E;  4JI3 E;  2DMY A;  4B3S E;  2JVA A;  2UXD E;  2B3T B;  2DIX A;  1RC7 A;  1WHN A;  1X47 A;  3C4B A;  4AQY E;  3J7Y p;  1N34 E;  2VQF E;  2IHR 1;  4LF6 E;  1STU A;  3VYX A;  4JI1 E;  2RSM A;  4LF9 E;  2E5L E;  4DR7 E;  3ADI A;  1T4O A;  1DI2 A;  1I94 E;  2ZM6 E;  4JV5 E;  1GQE A;  2RTX A;  2NUF A;  4DV0 E;  1YYK A;  4LF4 E;  4JI7 E;  2RS6 A;  4GKJ E;  1UIL A;  2B7T A;  4DR5 E;  4YY3 E;  1XNR E;  4LFB E;  4DV3 E;  4LF8 E;  1YZ9 A;  2UXB E;  4X66 E;  1N36 E;  4LFC E;  4DUY E;  2CPN A;  4JI2 E;  1T4L B;  2LTR A;  3ADL A;  2HHH E;  1HR0 E;  2NUE A;  4DUZ E;  4JI5 E;  3P1X A; 
#chains in the Genus database with same CATH topology
 3L00 A;  4K0K E;  2UUB E;  4OX9 E;  1WHQ A;  1L4S A;  2EMC A;  2D9H A;  3MHH C;  3LLH A;  5IXM B;  2DMI A;  2EPX A;  5A6K A;  4WX9 A;  1HNZ E;  2JOX A;  1AH5 A;  2VE7 C;  2CTD A;  2ELY A;  1YUJ A;  4B3R E;  3HXL A;  2V87 A;  4ZYG A;  1FJG E;  1XMO E;  2LJH A;  5A6B D;  2LUQ A;  2UU9 E;  2YTF A;  4DV7 E;  4HTG A;  2JY9 A;  2LJU A;  2MKN A;  2EMA A;  2LT7 A;  2EMF A;  2L2N A;  4HEI A;  4N4R B;  2EMI A;  2EMG A;  4BHB A;  2EWL A;  2ENH A;  4DKK A;  2YTD A;  4X64 E;  2UXC E;  2V83 A;  1G2D C;  2RSI A;  4LFA E;  2EM6 A;  2EMW A;  4YHH E;  1EH7 A;  4ZYD A;  2LBS B;  2EMX A;  2EN8 A;  1PDA A;  1X6F A;  2EN2 A;  1IBL E;  4DV4 E;  1IBM E;  4DV2 E;  2EOX A;  2L3J A;  2YWQ A;  3KZZ A;  2EOH A;  1N33 E;  2EM8 A;  2DMY A;  3DF6 A;  1KYQ A;  4O5G A;  2DLQ A;  5AC4 A;  2EM4 A;  2UXD E;  1TF6 A;  1EH8 A;  2DIX A;  2EOS A;  1RC7 A;  3HPZ A;  4X9J A;  2MC5 A;  1N34 E;  2EPZ A;  2YTN A;  1STU A;  4JI1 E;  2G7H A;  2RSM A;  3LML A;  4DR7 E;  2EQ1 A;  2LCE A;  4J8Z A;  4F9B B;  2DRP A;  2FGG A;  5KL6 A;  1GQE A;  3EPJ A;  1G2F C;  1SR9 A;  2J7J A;  2L8T A;  2NUF A;  4IS1 C;  3F6G A;  4LF4 E;  5A6B A;  4DR5 E;  2EPP A;  1YZ9 A;  2UXB E;  2EM5 A;  4Q35 B;  2MC6 A;  1BBO A;  2EN4 A;  3DJW A;  3BBG A;  4Q28 A;  4JI5 E;  1YPN A;  2WBU A;  2JP9 A;  5A69 A;  2N3G A;  2EPN A;  3ECR A;  4GEQ B;  2H36 X;  5LL6 R;  4JI6 E;  3F6H A;  3HPS A;  2EOJ A;  4DR4 E;  2WCC 3;  2K7I A;  2EJ4 A;  1WJP A;  3H09 A;  2LO3 A;  4DR1 E;  2EL6 A;  3BF2 A;  4X62 E;  1A1H A;  1NCS A;  1A1F A;  2EOR A;  1IMU A;  2EOQ A;  4NXM E;  3KZY A;  5AE2 A;  4M30 A;  1X49 A;  4BCA A;  4F9A B;  3ADG A;  4O24 A;  2EPM X;  2EPC A;  2DB2 A;  2EMY A;  2EOM A;  2EPA A;  4WXD A;  2NA2 A;  2EL4 A;  4MLQ A;  3VYY A;  3HTX A;  2L2M A;  2NUG A;  4F54 A;  4M2Z A;  2EOY A;  4X65 E;  1UBD C;  2MDR A;  2B7V A;  1MGT A;  2A25 A;  3IWC A;  2EMB A;  2ENA A;  2L6M A;  2EPR A;  5A2Q C;  1IBK E;  2DSY A;  4I8O A;  1UN6 B;  3BID A;  3VK6 A;  4DV6 E;  2VF1 A;  3RMP A;  1MEY C;  2MKD A;  4R2P A;  1J26 A;  4NXN E;  2E72 A;  2YRH A;  1ZU1 A;  2CSH A;  3AUZ A;  1PJQ A;  4ZYE A;  1P47 A;  5TSE A;  4L8N A;  5IT9 C;  1IQS A;  4JI3 E;  2YTG A;  5ADZ A;  5AAS A;  2V88 A;  2EOF A;  1Z1B A;  2JXP A;  1X47 A;  5AE1 A;  3J7Y p;  1X6E A;  4BMJ A;  4LF6 E;  2EN7 A;  3C6M A;  3VYX A;  1SFE A;  2ELZ A;  5KL5 A;  4LF9 E;  2E5L E;  3ADI A;  2YTI A;  3J80 C;  1RMD A;  1I94 E;  4JV5 E;  3C6K A;  1EH6 A;  2NAB A;  2I9I A;  3ZOQ B;  4R2D A;  4DV0 E;  2B9D A;  1YYK A;  2EMK A;  4JI7 E;  4GKJ E;  4R2A A;  1UIL A;  2EE8 A;  2EN3 A;  1XNR E;  4RH8 A;  2V85 A;  4DV3 E;  2EPL X;  1N36 E;  3IWB A;  2M7Q A;  4DUY E;  1IQO A;  4JI2 E;  2LTR A;  4DUZ E;  4DR6 E;  2YRK A;  2EM7 A;  2EN6 A;  4TUG A;  1QNT A;  4WYQ B;  1TF3 A;  2KON A;  2L33 A;  2LTS A;  1J5E E;  1LLM C;  1UHZ A;  2EL5 A;  1O0W A;  2EN1 A;  2EZ6 A;  4NZV A;  4JI0 E;  4L5N C;  4LU9 A;  3M99 B;  5AC5 A;  2YTO A;  2L3C A;  1N3G A;  2N3H A;  1YYO A;  3OTO E;  4KWY A;  2UUC E;  2EM3 A;  1ZBQ A;  1DQ3 A;  2YSO A;  4M0V A;  2EQ3 A;  2WBT A;  1X3C A;  1N32 E;  4KHP E;  2YTJ A;  4KZS A;  4BS9 A;  1XMQ E;  2YRM A;  2E1M A;  2EMZ A;  1HNX E;  3EPL A;  4MLV A;  5KL2 A;  2F4V E;  3C4T A;  1KJK A;  4BC9 A;  1X6H A;  2RS7 A;  2EM0 A;  3EPK A;  2GHF A;  2ENC A;  2F8B A;  4GKK E;  4R2Q A;  2M4I A;  4DR3 E;  4BBY A;  2EMH A;  2EOI A;  3BGH A;  3HQ1 A;  3THO B;  1GTK A;  2BB8 A;  2N8X A;  4R2S A;  2YPN A;  3T1Y E;  1T38 A;  2YZT A;  5BR8 E;  2WBS A;  4OOG C;  1DGC A;  1FKA E;  5IWA E;  2VQE E;  2MDG A;  3QG5 C;  4B3S E;  3TQM A;  1NEI A;  2JOB A;  1AAY A;  3JU0 A;  2CT1 A;  1A1I A;  3FIG A;  2YU5 A;  3C4B A;  4AQY E;  2EM9 A;  4TUI A;  1A1K A;  2YTQ A;  2YTE A;  2JWO A;  2YTP A;  2EPU A;  4O4K A;  5A6A A;  1T4O A;  2WZO A;  1DI2 A;  2DGC A;  2LVH A;  1YUI A;  2JR1 A;  3K6Q A;  2RTX A;  2R1F A;  2YSP A;  3VHT B;  1YFH A;  5LLQ A;  4YY3 E;  3J7A G;  2RPC A;  2EM2 A;  5AE3 A;  3AV0 A;  1JK1 A;  4LFC E;  2HC5 A;  4F2J C;  2M9A A;  1T4L B;  2EPK X;  2HHH E;  2NUE A;  1JK2 A;  1ZR9 A;  4B3M E;  4LF5 E;  2M1S A;  2FTX B;  2L2K B;  4F6M A;  4O43 A;  1X48 A;  2LRS A;  4P78 A;  4DR2 E;  4F9C B;  4DV1 E;  2V86 A;  1YSA C;  2ODR C;  1YYW A;  2EPO A;  4GZN C;  2EP3 A;  5KL3 A;  2L92 A;  1GZ6 A;  4JI8 E;  5CFF E;  1T39 A;  3EQ1 A;  3EPH A;  2LE2 A;  4R2E A;  4DV5 E;  1RQ0 A;  1EKZ A;  1ZBT A;  5T6J A;  1BBG A;  1X5W A;  5LMU E;  3MHS C;  2GLI A;  4JI4 E;  2VRD A;  4R03 A;  3T1H E;  4M9V C;  2LMZ A;  3J81 C;  4BC7 A;  3UK3 C;  4WFT A;  2EOE A;  2EML A;  2YT4 A;  5IV8 B;  2V89 A;  1T4N A;  4BHC A;  4B3T E;  4LF7 E;  4WXC A;  3IWD A;  5A6J A;  2K4V A;  4ZYH A;  2PRT A;  2LV2 A;  2LUP B;  4JYA E;  1HNW E;  1TN9 A;  4X8W A;  4R2C A;  1PKP A;  2I13 A;  1B69 A;  5LMN E;  2HGH A;  1XNQ E;  4R2R A;  2ADR A;  3ADJ A;  1QU6 A;  4F6N A;  1F2I G;  2UUA E;  2KOU A;  2RQL A;  2KHX A;  4R8O A;  4WSG A;  1BB8 A;  2YU8 A;  2BBG A;  2ODR D;  2JVA A;  1A1J A;  3MSW A;  1WXR A;  2B3T B;  5KL7 A;  1WHN A;  2VQF E;  2IHR 1;  4WPY A;  5DNY A;  4LTY A;  1PJS A;  2V8Q B;  2EQ0 A;  2JYA A;  4RHB B;  2HJJ A;  2ZM6 E;  3JAM C;  2GPI A;  4FK5 C;  4IJD A;  1WRJ A;  3JTZ A;  2EOO A;  2EOZ A;  2RS6 A;  2R76 A;  2B7T A;  3OML A;  2JPA A;  4LFB E;  3KWR A;  4LF8 E;  2DLK A;  5KL4 A;  5F3W A;  4DMI A;  4WSP A;  1PJT A;  4X66 E;  1A1G A;  2FV4 B;  1A1L A;  2CPN A;  5FLX C;  2Q8U A;  4P7D A;  3ADL A;  3THN A;  1HR0 E;  4NHR A;  1ZAA C;  3P1X A; 
#chains in the Genus database with same CATH homology
 4B3M E;  4LF5 E;  2M1S A;  4K0K E;  2FTX B;  2UUB E;  4OX9 E;  1WHQ A;  4TUG A;  2L2K B;  4WYQ B;  1X48 A;  2N3G A;  4JI6 E;  2KON A;  2L33 A;  2H36 X;  2LRS A;  2LTS A;  4GEQ B;  4P78 A;  3F6H A;  1UHZ A;  2V86 A;  5LL6 R;  4F9C B;  1O0W A;  2ODR C;  4DV1 E;  3HPS A;  2EZ6 A;  1YYW A;  3LLH A;  4JI0 E;  4DR4 E;  2L92 A;  1GZ6 A;  4L5N C;  4LU9 A;  4JI8 E;  5CFF E;  2L3C A;  1HNZ E;  3H09 A;  2JOX A;  2LE2 A;  2N3H A;  4X62 E;  4DR1 E;  2VE7 C;  4DV5 E;  3OTO E;  1YYO A;  2UUC E;  1RQ0 A;  4B3R E;  1EKZ A;  1ZBT A;  3HXL A;  5T6J A;  2V87 A;  1ZBQ A;  4NXM E;  5AE2 A;  4M30 A;  1FJG E;  1DQ3 A;  1X49 A;  4BCA A;  5LMU E;  1XMO E;  4M0V A;  2LJH A;  2LUQ A;  4F9A B;  2UU9 E;  3ADG A;  1N32 E;  4KHP E;  4JI4 E;  4KZS A;  4BS9 A;  2DB2 A;  4DV7 E;  2E1M A;  1XMQ E;  1HNX E;  4R03 A;  3VYY A;  2NA2 A;  3T1H E;  2LMZ A;  3J81 C;  3HTX A;  4BC7 A;  2L2M A;  2NUG A;  2JY9 A;  4F54 A;  2F4V E;  3C4T A;  4M2Z A;  4WFT A;  2L2N A;  4BC9 A;  4X65 E;  2RS7 A;  2YT4 A;  2MDR A;  2B7V A;  2V89 A;  2EWL A;  2L6M A;  1T4N A;  3IWC A;  4B3T E;  4DKK A;  4LF7 E;  3IWD A;  2F8B A;  4X64 E;  5A2Q C;  4GKK E;  2K4V A;  1IBK E;  2UXC E;  2M4I A;  2DSY A;  2V83 A;  2LUP B;  4I8O A;  4LFA E;  4DR3 E;  4JYA E;  4BBY A;  4YHH E;  4X8W A;  3VK6 A;  1HNW E;  4DV6 E;  2LBS B;  2VF1 A;  1PKP A;  3RMP A;  3HQ1 A;  5LMN E;  1J26 A;  1XNQ E;  4NXN E;  1IBL E;  3T1Y E;  4DR6 E;  3AUZ A;  4DV4 E;  2YZT A;  1QU6 A;  3ADJ A;  5BR8 E;  1IBM E;  4OOG C;  2KOU A;  4DV2 E;  2UUA E;  2L3J A;  1FKA E;  5IWA E;  2KHX A;  4R8O A;  2VQE E;  4L8N A;  1N33 E;  5IT9 C;  1J5E E;  4JI3 E;  2DMY A;  3DF6 A;  4B3S E;  2JOB A;  5ADZ A;  2ODR D;  5AAS A;  3JU0 A;  2JVA A;  2V88 A;  3FIG A;  3MSW A;  2UXD E;  1WXR A;  2B3T B;  2DIX A;  1RC7 A;  1WHN A;  1X47 A;  3C4B A;  2MC5 A;  3HPZ A;  5AE1 A;  3J7Y p;  4BMJ A;  2VQF E;  4TUI A;  2IHR 1;  4WPY A;  4AQY E;  1N34 E;  4LF6 E;  5DNY A;  1STU A;  3VYX A;  4LTY A;  4JI1 E;  2JWO A;  2G7H A;  2RSM A;  4LF9 E;  2E5L E;  3LML A;  2V8Q B;  3ADI A;  3J80 C;  4DUZ E;  4DR7 E;  1T4O A;  2WZO A;  1DI2 A;  4J8Z A;  4F9B B;  1I94 E;  2ZM6 E;  3JAM C;  2FGG A;  4DR2 E;  1GQE A;  2JR1 A;  3K6Q A;  3ZOQ B;  4JV5 E;  2RTX A;  1SR9 A;  2L8T A;  3JTZ A;  2NUF A;  4DV0 E;  2B9D A;  1YYK A;  3F6G A;  4LF4 E;  4JI7 E;  2RS6 A;  4GKJ E;  1UIL A;  2B7T A;  3OML A;  4DR5 E;  4YY3 E;  1XNR E;  3J7A G;  4DV3 E;  2V85 A;  3KWR A;  4LF8 E;  1YZ9 A;  4LFB E;  2UXB E;  5F3W A;  4DMI A;  5AE3 A;  4WSP A;  2MC6 A;  3AV0 A;  4X66 E;  1N36 E;  2FV4 B;  3IWB A;  2M7Q A;  4LFC E;  4DUY E;  2CPN A;  5FLX C;  3DJW A;  4JI2 E;  1T4L B;  4P7D A;  2LTR A;  3ADL A;  2HHH E;  1HR0 E;  2NUE A;  4Q28 A;  4JI5 E;  3P1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...