1EKZA

Nmr structure of the complex between the third dsrbd from drosophila staufen and a rna hairpin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
76
structure length
76
Chain Sequence
MDEGDKKSPISQVHEIGIKRNMTVHFKVLREEGPAHMKNFITACIVGSIVTEGEGNGKKVSKKRAAEKMLVELQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAUFEN DOUBLE-STRANDED RNA BINDING DOMAIN
publication title RNA recognition by a Staufen double-stranded RNA-binding domain.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Cell cycle/rna
total genus 14
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2000-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1ekzA00
1T4OA 3ADJA 2LUQA 2UXDE 2B7TA 4DR1E 4OOGC 1YZ9A 2L2KB 2L2MA 2DIXA 4GKKE 4DV0E 1XNRE 1UHZA 3P1XA 1HNXE 2EZ6A 2RS6A 4B3ME 4LF8E 4YHHE 4DR4E 2N3GA 1STUA 1RQ0A 2LUPB 1I94E 4DR7E 1XMOE 1J26A 3OTOE 2VQEE 4DUZE 2NUFA 4JI6E 4JI0E 3T1HE 2KHXA 2ZM6E 5LMNE 2LJHA 4M2ZA 2UU9E 1HNWE 1XMQE 4OX9E 2DB2A 4DV3E 2YT4A 1X49A 2B3TB 1XNQE 4JI1E 2IHR1 2JVAA 4JI7E 2JY9A 2RS7A 1N33E 4X8WA 3VYYA 4JYAE 1QU6A 3LLHA 1YYOA 4JI5E 4LF6E 4DKKA 1WHQA 5IWAE 4DV4E 2B7VA 1IBLE 1YYKA 4KHPE 4JV5E 5CFFE 2N3HA 1IBKE 1O0WA 3C4BA 1DI2A 4WYQB 2MDRA 1N32E 2NA2A 2UXBE 1HNZE 4DR3E 4X66E 4AQYE 1ZBTA 4LFCE 1FJGE 1X48A 2F4VE 4JI2E 4X64E 2L2NA 5LMUE 2HHHE 3T1YE 4JI3E 2LRSA 2L3CA 2DMYA 1FKAE 4NXNE 2NUEA 4B3SE 1PKPA 2CPNA 2VQFE 4DR5E 2E5LE 1X47A 4YY3E 4NXME 4DV7E 1HR0E 4GKJE 2L33A 2UUCE 1YYWA 1GQEA 4M30A 4DV1E 1IBME 4LFBE 4WFTA 1N36E 3ADLA 4B3RE 3VYXA 4JI8E 4X65E 2L3JA 4DV5E 4LF7E 3HTXA 4LF4E 1J5EE 1RC7A 4JI4E 2LTSA 3J7Yp 4DR2E 4LF9E 4K0KE 1T4NA 2RSMA 1N34E 3C4TA 3ADIA 2NUGA 2UUAE 2RTXA 2UUBE 4DUYE 4LFAE 2LBSB 4X62E 4DV6E 2LTRA 1UILA 4LF5E 1WHNA 4DR6E 3ADGA 4DV2E 1T4LB 4B3TE 5BR8E 2UXCE 1EKZA
chains in the Genus database with same CATH superfamily
3AUZA 2K7IA 3ADJA 2UXDE 1YZ9A 2DIXA 2LMZA 1GTKA 2YRHA 1UHZA 2L6MA 2RS6A 4B3ME 5AASA 4LF8E 2EMYA 4YHHE 5DNYA 1A1KA 2N3GA 1STUA 4L5NC 3KZYA 3UK3C 1J26A 3OTOE 1X6EA 2ELZA 4JI0E 3IWCA 2KHXA 4TUIA 4N4RB 5LMNE 4J8ZA 3JU0A 2YTPA 1GZ6A 2DB2A 1NCSA 4Q28A 3F6HA 2EN8A 2H36X 4BC7A 4F54A 2BBGA 4R2CA 3F6GA 2G7HA 4WXDA 2CTDA 2IHR1 2EM3A 2VF1A 2YU5A 2EPKX 2DMIA 4JYAE 4R2PA 1IMUA 4O24A 2EOZA 2YTIA 2PRTA 2M9AA 4WSPA 3K6QA 2EN6A 4IS1C 2MKDA 1YYKA 1KYQA 4KHPE 4JV5E 2EMIA 1ZBQA 1O0WA 2WBTA 4WX9A 5A6BA 2WBSA 1Z1BA 1L4SA 5A6JA 2EPAA 1DI2A 2NA2A 2DRPA 5F3WA 4X66E 4P7DA 2YTFA 1A1LA 4JI2E 1YUIA 5LMUE 2LRSA 1A1GA 3THOB 1A1FA 4B3SE 1TN9A 5AE2A 2EOHA 5IV8B 2EP3A 1X6FA 3KWRA 5LLQA 4ZYDA 2L33A 2KOUA 1YSAC 4MLQA 4DV1E 4O4KA 3ADLA 2DLQA 4B3RE 1X5WA 4R2RA 2YRMA 4X65E 4LF7E 1ZAAC 2EM0A 4R2QA 2I13A 3C4TA 3AV0A 2NUGA 2UUAE 4LFAE 2EE8A 5FLXC 2LT7A 2LBSB 1T39A 4F9CB 2LTRA 2RQLA 1TF6A 2YSOA 2EMKA 2FV4B 2YRKA 2YU8A 2V88A 1G2FC 2V8QB 1KJKA 2HC5A 2EMHA 5BR8E 2V89A 2R76A 1EKZA 2UXCE 2GPIA 3DJWA 2EPCA 2LUQA 1UN6B 2EMZA 1F2IG 4DR1E 4GKKE 4RHBB 2ENHA 1X3CA 2V86A 2EM2A 4DR4E 4BHCA 1EH8A 1RQ0A 2RSIA 4BS9A 2J7JA 1WJPA 2V85A 4DUZE 1PJTA 2DLKA 4JI6E 2ENCA 3T1HE 5A69A 4M2ZA 4R2AA 1N3GA 1HNWE 1XMQE 3ECRA 2B9DA 2D9HA 1PJSA 1IQSA 2CSHA 2EMLA 2EL5A 2GHFA 5A2QC 2EPLX 2MDGA 2CT1A 2JVAA 2M7QA 4R03A 5T6JA 4WXCA 4NHRA 2YTQA 3ZOQB 5KL5A 3HPZA 2EM9A 1YYOA 3L00A 4DKKA 1WHQA 1IBLE 2YTEA 3IWDA 1DGCA 5AE3A 2EL6A 4ZYHA 2N3HA 1IBKE 4DMIA 2EMGA 4WYQB 1EH6A 1QNTA 2EMFA 2FGGA 2UXBE 1HNZE 4DR3E 2EWLA 1ZBTA 4WSGA 3HXLA 1X48A 3EPKA 2F4VE 2EPMX 2L2NA 2EOFA 2MKNA 4BMJA 3T1YE 2YTGA 2L8TA 4TUGA 4BBYA 2DMYA 2DGCA 2NUEA 3BGHA 2VQFE 4MLVA 2EPNA 2JWOA 1HR0E 2EPZA 3FIGA 2EOSA 3KZZA 3MSWA 5AC4A 2WBUA 1AH5A 2EM8A 4KWYA 5A6AA 3C6KA 1JK2A 3VYXA 1RMDA 2LCEA 4NZVA 2JPAA 4BCAA 4R8OA 5ADZA 4O5GA 1BBOA 4JI4E 2ODRC 4K0KE 2EM4A 2RSMA 2RPCA 4I8OA 2EQ3A 3ADIA 2EMCA 1UBDC 4R2EA 2A25A 2EOQA 2YWQA 2EPPA 4DV6E 4LF5E 3DF6A 4Q35B 1G2DC 3OMLA 4GZNC 1MEYC 4DV2E 4KZSA 2EMXA 2ODRD 2V83A 4GEQB 2L2MA 1SR9A 2JOBA 3MHSC 4DV0E 1XNRE 1HNXE 2EZ6A 5KL7A 3LMLA 2EM6A 1B69A 2EPRA 3C6MA 1I94E 2VQEE 2NUFA 1A1IA 2EPXA 2EQ1A 2EN2A 2LJHA 3MHHC 2N8XA 1A1JA 2EJ4A 1YFHA 4DV3E 4M0VA 3EQ1A 3THNA 2EMAA 1X49A 2B3TB 4HTGA 4F9BB 2EPOA 4RH8A 1XNQE 4JI7E 2RS7A 2YZTA 2EQ0A 2HGHA 4X8WA 3VYYA 3JTZA 2VE7C 3LLHA 1WRJA 4JI5E 4LF6E 2B7VA 2YTOA 5A6KA 1BBGA 2JYAA 1JK1A 2EOMA 5CFFE 2HJJA 3BIDA 2EN4A 3C4BA 2EPUA 1LLMC 1YPNA 1TF3A 1N32E 2EMWA 3HPSA 4M9VC 4AQYE 4O43A 2DSYA 4X64E 5A6BD 4JI3E 2L3CA 4NXNE 2LO3A 1PKPA 2E5LE 1A1HA 4DR5E 2EMBA 1X47A 2EOIA 4F6MA 1MGTA 4F9AB 4WPYA 1YYWA 4M30A 4BHBA 1T38A 2YSPA 1IBME 4LFBE 2EOEA 4L8NA 1N36E 3EPHA 4JI8E 5IXMB 2L3JA 2ELYA 4LU9A 1J5EE 1RC7A 2LTSA 2VRDA 5TSEA 3J7Yp 2EN1A 3VHTB 1N34E 3TQMA 2JOXA 2UUBE 2LE2A 2MC6A 2YPNA 2BB8A 4X62E 2YTNA 4LTYA 2E1MA 2EOJA 2LJUA 2E72A 2EOYA 3ADGA 3H09A 2WCC3 3IWBA 5IT9C 4B3TE 2EN3A 2EORA 2V87A 1T4OA 4ZYEA 2B7TA 4P78A 4OOGC 5AC5A 2L2KB 2EN7A 5LL6R 1AAYA 2ENAA 3BF2A 3P1XA 5KL2A 1ZR9A 1X6HA 2LUPB 4DR7E 1XMOE 1IQOA 2JR1A 2K4VA 2ZM6E 3EPLA 2R1FA 3BBGA 2UU9E 4OX9E 1EH7A 1PDAA 2YT4A 2LVHA 1BB8A 2JXPA 4JI1E 2WZOA 2JY9A 4ZYGA 2M4IA 1N33E 3M99B 3RMPA 2LV2A 4F2JC 1QU6A 2EOOA 4HEIA 1DQ3A 5IWAE 4DV4E 3HQ1A 1ZU1A 2EL4A 2MDRA 5KL6A 2L92A 2M1SA 1SFEA 4LFCE 1FJGE 3QG5C 4IJDA 2F8BA 2HHHE 2KONA 2I9IA 4FK5C 1FKAE 1PJQA 2CPNA 4YY3E 1WXRA 4NXME 4DV7E 4GKJE 2UUCE 1GQEA 2ADRA 2Q8UA 1P47A 2YTJA 4WFTA 3EPJA 1YUJA 2GLIA 2MC5A 5AE1A 4DV5E 3HTXA 4LF4E 3JAMC 2YTDA 3J81C 3VK6A 4DR2E 4LF9E 1T4NA 2NABA 2RTXA 4DUYE 2EM7A 2EM5A 4F6NA 1NEIA 1UILA 3J7AG 1WHNA 5KL3A 4DR6E 2EOXA 4X9JA 4BC9A 3J80C 4R2DA 1T4LB 2FTXB 4R2SA 5KL4A 2JP9A
chains in the Genus database with same CATH topology
1T4OA 3DJWA 3AUZA 3ADJA 2LUQA 2UXDE 2B7TA 4P78A 2ODRD 4DR1E 4OOGC 2V83A 1YZ9A 4GEQB 2L2MA 2DIXA 2LMZA 1SR9A 2JOBA 2L2KB 4DV0E 5LL6R 4GKKE 1XNRE 1UHZA 3P1XA 2L6MA 1HNXE 2EZ6A 2RS6A 2V86A 4B3ME 5AASA 4LF8E 3LMLA 5DNYA 4YHHE 4DR4E 2N3GA 1STUA 4L5NC 1RQ0A 4BS9A 2LUPB 1I94E 1XMOE 4DR7E 3OTOE 2V85A 2VQEE 4DUZE 2NUFA 1J26A 4JI6E 2JR1A 4JI0E 3IWCA 3T1HE 2K4VA 2KHXA 4TUIA 2ZM6E 5LMNE 4J8ZA 2LJHA 4M2ZA 3JU0A 2UU9E 1HNWE 1XMQE 4OX9E 1GZ6A 2DB2A 2B9DA 4M0VA 4Q28A 3F6HA 4DV3E 2H36X 2YT4A 4BC7A 1X49A 4F54A 2B3TB 5A2QC 4F9BB 1XNQE 4JI1E 3F6GA 2G7HA 2WZOA 2IHR1 2VF1A 2JVAA 2M7QA 4JI7E 2JY9A 2RS7A 2YZTA 4R03A 2M4IA 5T6JA 1N33E 3RMPA 4X8WA 3VYYA 4JYAE 1QU6A 3JTZA 2UXCE 3ZOQB 2VE7C 3HPZA 3LLHA 4WSPA 1YYOA 4JI5E 3K6QA 4LF6E 1DQ3A 4DKKA 1WHQA 5IWAE 4DV4E 2B7VA 3HQ1A 3IWDA 1IBLE 5AE3A 1YYKA 4KHPE 4JV5E 5CFFE 2N3HA 1ZBQA 1O0WA 1IBKE 4DMIA 3C4BA 1DI2A 4WYQB 2MDRA 1N32E 2NA2A 5F3WA 2FGGA 2UXBE 2L92A 3HPSA 1HNZE 4DR3E 2EWLA 4P7DA 4X66E 2M1SA 1ZBTA 4AQYE 4LFCE 1FJGE 3HXLA 1X48A 2DSYA 2F4VE 4JI2E 4X64E 2L2NA 5LMUE 2F8BA 4BMJA 3T1YE 2HHHE 4JI3E 2KONA 2L8TA 2LRSA 4BBYA 2DMYA 4TUGA 2L3CA 1FKAE 4NXNE 2NUEA 4B3SE 5AE2A 1PKPA 2CPNA 2VQFE 4DR5E 2E5LE 1X47A 2JWOA 4YY3E 1WXRA 3KWRA 4DV7E 1HR0E 4NXME 4GKJE 2L33A 2UUCE 2KOUA 4F9AB 4WPYA 1YYWA 1GQEA 3FIGA 4M30A 4DV1E 1IBME 4LFBE 3MSWA 4L8NA 4WFTA 1N36E 3ADLA 4B3RE 3VYXA 4JI8E 4X65E 2MC5A 5AE1A 2L3JA 4DV5E 4BCAA 4R8OA 4LF7E 3HTXA 5ADZA 4LF4E 3JAMC 4LU9A 1J5EE 3J81C 1RC7A 3VK6A 2LTSA 2ODRC 4JI4E 3J7Yp 4DR2E 4LF9E 4K0KE 1T4NA 2RSMA 1N34E 4I8OA 3C4TA 3ADIA 3AV0A 2NUGA 2UUAE 2JOXA 2RTXA 2UUBE 2LE2A 4DUYE 4LFAE 2MC6A 5FLXC 2LBSB 4X62E 4DV6E 4F9CB 2LTRA 1UILA 2E1MA 4LTYA 1WHNA 3DF6A 4LF5E 3J7AG 4DR6E 2FV4B 3ADGA 3OMLA 2V88A 3H09A 3IWBA 4BC9A 5IT9C 3J80C 2V8QB 4DV2E 2FTXB 4KZSA 1T4LB 4B3TE 5BR8E 2V89A 1EKZA 2V87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T4O A;  3ADJ A;  2LUQ A;  2UXD E;  2B7T A;  4DR1 E;  4OOG C;  1YZ9 A;  2L2K B;  2L2M A;  2DIX A;  4GKK E;  4DV0 E;  1XNR E;  1UHZ A;  3P1X A;  1HNX E;  2EZ6 A;  2RS6 A;  4B3M E;  4LF8 E;  4YHH E;  4DR4 E;  2N3G A;  1STU A;  1RQ0 A;  2LUP B;  1I94 E;  4DR7 E;  1XMO E;  1J26 A;  3OTO E;  2VQE E;  4DUZ E;  2NUF A;  4JI6 E;  4JI0 E;  3T1H E;  2KHX A;  2ZM6 E;  5LMN E;  2LJH A;  4M2Z A;  2UU9 E;  1HNW E;  1XMQ E;  4OX9 E;  2DB2 A;  4DV3 E;  2YT4 A;  1X49 A;  2B3T B;  1XNQ E;  4JI1 E;  2IHR 1;  2JVA A;  4JI7 E;  2JY9 A;  2RS7 A;  1N33 E;  4X8W A;  3VYY A;  4JYA E;  1QU6 A;  3LLH A;  1YYO A;  4JI5 E;  4LF6 E;  4DKK A;  1WHQ A;  5IWA E;  4DV4 E;  2B7V A;  1IBL E;  1YYK A;  4KHP E;  4JV5 E;  5CFF E;  2N3H A;  1IBK E;  1O0W A;  3C4B A;  1DI2 A;  4WYQ B;  2MDR A;  1N32 E;  2NA2 A;  2UXB E;  1HNZ E;  4DR3 E;  4X66 E;  4AQY E;  1ZBT A;  4LFC E;  1FJG E;  1X48 A;  2F4V E;  4JI2 E;  4X64 E;  2L2N A;  5LMU E;  2HHH E;  3T1Y E;  4JI3 E;  2LRS A;  2L3C A;  2DMY A;  1FKA E;  4NXN E;  2NUE A;  4B3S E;  1PKP A;  2CPN A;  2VQF E;  4DR5 E;  2E5L E;  1X47 A;  4YY3 E;  4NXM E;  4DV7 E;  1HR0 E;  4GKJ E;  2L33 A;  2UUC E;  1YYW A;  1GQE A;  4M30 A;  4DV1 E;  1IBM E;  4LFB E;  4WFT A;  1N36 E;  3ADL A;  4B3R E;  3VYX A;  4JI8 E;  4X65 E;  2L3J A;  4DV5 E;  4LF7 E;  3HTX A;  4LF4 E;  1J5E E;  1RC7 A;  4JI4 E;  2LTS A;  3J7Y p;  4DR2 E;  4LF9 E;  4K0K E;  1T4N A;  2RSM A;  1N34 E;  3C4T A;  3ADI A;  2NUG A;  2UUA E;  2RTX A;  2UUB E;  4DUY E;  4LFA E;  2LBS B;  4X62 E;  4DV6 E;  2LTR A;  1UIL A;  4LF5 E;  1WHN A;  4DR6 E;  3ADG A;  4DV2 E;  1T4L B;  4B3T E;  5BR8 E;  2UXC E;  1EKZ A; 
#chains in the Genus database with same CATH topology
 3AUZ A;  2K7I A;  3ADJ A;  2UXD E;  1YZ9 A;  2DIX A;  2LMZ A;  1GTK A;  2YRH A;  1UHZ A;  2L6M A;  2RS6 A;  4B3M E;  5AAS A;  4LF8 E;  2EMY A;  4YHH E;  5DNY A;  1A1K A;  2N3G A;  1STU A;  4L5N C;  3KZY A;  3UK3 C;  1J26 A;  3OTO E;  1X6E A;  2ELZ A;  4JI0 E;  3IWC A;  2KHX A;  4TUI A;  4N4R B;  5LMN E;  4J8Z A;  3JU0 A;  2YTP A;  1GZ6 A;  2DB2 A;  1NCS A;  4Q28 A;  3F6H A;  2EN8 A;  2H36 X;  4BC7 A;  4F54 A;  2BBG A;  4R2C A;  3F6G A;  2G7H A;  4WXD A;  2CTD A;  2IHR 1;  2EM3 A;  2VF1 A;  2YU5 A;  2EPK X;  2DMI A;  4JYA E;  4R2P A;  1IMU A;  4O24 A;  2EOZ A;  2YTI A;  2PRT A;  2M9A A;  4WSP A;  3K6Q A;  2EN6 A;  4IS1 C;  2MKD A;  1YYK A;  1KYQ A;  4KHP E;  4JV5 E;  2EMI A;  1ZBQ A;  1O0W A;  2WBT A;  4WX9 A;  5A6B A;  2WBS A;  1Z1B A;  1L4S A;  5A6J A;  2EPA A;  1DI2 A;  2NA2 A;  2DRP A;  5F3W A;  4X66 E;  4P7D A;  2YTF A;  1A1L A;  4JI2 E;  1YUI A;  5LMU E;  2LRS A;  1A1G A;  3THO B;  1A1F A;  4B3S E;  1TN9 A;  5AE2 A;  2EOH A;  5IV8 B;  2EP3 A;  1X6F A;  3KWR A;  5LLQ A;  4ZYD A;  2L33 A;  2KOU A;  1YSA C;  4MLQ A;  4DV1 E;  4O4K A;  3ADL A;  2DLQ A;  4B3R E;  1X5W A;  4R2R A;  2YRM A;  4X65 E;  4LF7 E;  1ZAA C;  2EM0 A;  4R2Q A;  2I13 A;  3C4T A;  3AV0 A;  2NUG A;  2UUA E;  4LFA E;  2EE8 A;  5FLX C;  2LT7 A;  2LBS B;  1T39 A;  4F9C B;  2LTR A;  2RQL A;  1TF6 A;  2YSO A;  2EMK A;  2FV4 B;  2YRK A;  2YU8 A;  2V88 A;  1G2F C;  2V8Q B;  1KJK A;  2HC5 A;  2EMH A;  5BR8 E;  2V89 A;  2R76 A;  1EKZ A;  2UXC E;  2GPI A;  3DJW A;  2EPC A;  2LUQ A;  1UN6 B;  2EMZ A;  1F2I G;  4DR1 E;  4GKK E;  4RHB B;  2ENH A;  1X3C A;  2V86 A;  2EM2 A;  4DR4 E;  4BHC A;  1EH8 A;  1RQ0 A;  2RSI A;  4BS9 A;  2J7J A;  1WJP A;  2V85 A;  4DUZ E;  1PJT A;  2DLK A;  4JI6 E;  2ENC A;  3T1H E;  5A69 A;  4M2Z A;  4R2A A;  1N3G A;  1HNW E;  1XMQ E;  3ECR A;  2B9D A;  2D9H A;  1PJS A;  1IQS A;  2CSH A;  2EML A;  2EL5 A;  2GHF A;  5A2Q C;  2EPL X;  2MDG A;  2CT1 A;  2JVA A;  2M7Q A;  4R03 A;  5T6J A;  4WXC A;  4NHR A;  2YTQ A;  3ZOQ B;  5KL5 A;  3HPZ A;  2EM9 A;  1YYO A;  3L00 A;  4DKK A;  1WHQ A;  1IBL E;  2YTE A;  3IWD A;  1DGC A;  5AE3 A;  2EL6 A;  4ZYH A;  2N3H A;  1IBK E;  4DMI A;  2EMG A;  4WYQ B;  1EH6 A;  1QNT A;  2EMF A;  2FGG A;  2UXB E;  1HNZ E;  4DR3 E;  2EWL A;  1ZBT A;  4WSG A;  3HXL A;  1X48 A;  3EPK A;  2F4V E;  2EPM X;  2L2N A;  2EOF A;  2MKN A;  4BMJ A;  3T1Y E;  2YTG A;  2L8T A;  4TUG A;  4BBY A;  2DMY A;  2DGC A;  2NUE A;  3BGH A;  2VQF E;  4MLV A;  2EPN A;  2JWO A;  1HR0 E;  2EPZ A;  3FIG A;  2EOS A;  3KZZ A;  3MSW A;  5AC4 A;  2WBU A;  1AH5 A;  2EM8 A;  4KWY A;  5A6A A;  3C6K A;  1JK2 A;  3VYX A;  1RMD A;  2LCE A;  4NZV A;  2JPA A;  4BCA A;  4R8O A;  5ADZ A;  4O5G A;  1BBO A;  4JI4 E;  2ODR C;  4K0K E;  2EM4 A;  2RSM A;  2RPC A;  4I8O A;  2EQ3 A;  3ADI A;  2EMC A;  1UBD C;  4R2E A;  2A25 A;  2EOQ A;  2YWQ A;  2EPP A;  4DV6 E;  4LF5 E;  3DF6 A;  4Q35 B;  1G2D C;  3OML A;  4GZN C;  1MEY C;  4DV2 E;  4KZS A;  2EMX A;  2ODR D;  2V83 A;  4GEQ B;  2L2M A;  1SR9 A;  2JOB A;  3MHS C;  4DV0 E;  1XNR E;  1HNX E;  2EZ6 A;  5KL7 A;  3LML A;  2EM6 A;  1B69 A;  2EPR A;  3C6M A;  1I94 E;  2VQE E;  2NUF A;  1A1I A;  2EPX A;  2EQ1 A;  2EN2 A;  2LJH A;  3MHH C;  2N8X A;  1A1J A;  2EJ4 A;  1YFH A;  4DV3 E;  4M0V A;  3EQ1 A;  3THN A;  2EMA A;  1X49 A;  2B3T B;  4HTG A;  4F9B B;  2EPO A;  4RH8 A;  1XNQ E;  4JI7 E;  2RS7 A;  2YZT A;  2EQ0 A;  2HGH A;  4X8W A;  3VYY A;  3JTZ A;  2VE7 C;  3LLH A;  1WRJ A;  4JI5 E;  4LF6 E;  2B7V A;  2YTO A;  5A6K A;  1BBG A;  2JYA A;  1JK1 A;  2EOM A;  5CFF E;  2HJJ A;  3BID A;  2EN4 A;  3C4B A;  2EPU A;  1LLM C;  1YPN A;  1TF3 A;  1N32 E;  2EMW A;  3HPS A;  4M9V C;  4AQY E;  4O43 A;  2DSY A;  4X64 E;  5A6B D;  4JI3 E;  2L3C A;  4NXN E;  2LO3 A;  1PKP A;  2E5L E;  1A1H A;  4DR5 E;  2EMB A;  1X47 A;  2EOI A;  4F6M A;  1MGT A;  4F9A B;  4WPY A;  1YYW A;  4M30 A;  4BHB A;  1T38 A;  2YSP A;  1IBM E;  4LFB E;  2EOE A;  4L8N A;  1N36 E;  3EPH A;  4JI8 E;  5IXM B;  2L3J A;  2ELY A;  4LU9 A;  1J5E E;  1RC7 A;  2LTS A;  2VRD A;  5TSE A;  3J7Y p;  2EN1 A;  3VHT B;  1N34 E;  3TQM A;  2JOX A;  2UUB E;  2LE2 A;  2MC6 A;  2YPN A;  2BB8 A;  4X62 E;  2YTN A;  4LTY A;  2E1M A;  2EOJ A;  2LJU A;  2E72 A;  2EOY A;  3ADG A;  3H09 A;  2WCC 3;  3IWB A;  5IT9 C;  4B3T E;  2EN3 A;  2EOR A;  2V87 A;  1T4O A;  4ZYE A;  2B7T A;  4P78 A;  4OOG C;  5AC5 A;  2L2K B;  2EN7 A;  5LL6 R;  1AAY A;  2ENA A;  3BF2 A;  3P1X A;  5KL2 A;  1ZR9 A;  1X6H A;  2LUP B;  4DR7 E;  1XMO E;  1IQO A;  2JR1 A;  2K4V A;  2ZM6 E;  3EPL A;  2R1F A;  3BBG A;  2UU9 E;  4OX9 E;  1EH7 A;  1PDA A;  2YT4 A;  2LVH A;  1BB8 A;  2JXP A;  4JI1 E;  2WZO A;  2JY9 A;  4ZYG A;  2M4I A;  1N33 E;  3M99 B;  3RMP A;  2LV2 A;  4F2J C;  1QU6 A;  2EOO A;  4HEI A;  1DQ3 A;  5IWA E;  4DV4 E;  3HQ1 A;  1ZU1 A;  2EL4 A;  2MDR A;  5KL6 A;  2L92 A;  2M1S A;  1SFE A;  4LFC E;  1FJG E;  3QG5 C;  4IJD A;  2F8B A;  2HHH E;  2KON A;  2I9I A;  4FK5 C;  1FKA E;  1PJQ A;  2CPN A;  4YY3 E;  1WXR A;  4NXM E;  4DV7 E;  4GKJ E;  2UUC E;  1GQE A;  2ADR A;  2Q8U A;  1P47 A;  2YTJ A;  4WFT A;  3EPJ A;  1YUJ A;  2GLI A;  2MC5 A;  5AE1 A;  4DV5 E;  3HTX A;  4LF4 E;  3JAM C;  2YTD A;  3J81 C;  3VK6 A;  4DR2 E;  4LF9 E;  1T4N A;  2NAB A;  2RTX A;  4DUY E;  2EM7 A;  2EM5 A;  4F6N A;  1NEI A;  1UIL A;  3J7A G;  1WHN A;  5KL3 A;  4DR6 E;  2EOX A;  4X9J A;  4BC9 A;  3J80 C;  4R2D A;  1T4L B;  2FTX B;  4R2S A;  5KL4 A;  2JP9 A; 
#chains in the Genus database with same CATH homology
 1T4O A;  3DJW A;  3AUZ A;  3ADJ A;  2LUQ A;  2UXD E;  2B7T A;  4P78 A;  2ODR D;  4DR1 E;  4OOG C;  2V83 A;  1YZ9 A;  4GEQ B;  2L2M A;  2DIX A;  2LMZ A;  1SR9 A;  2JOB A;  2L2K B;  4DV0 E;  5LL6 R;  4GKK E;  1XNR E;  1UHZ A;  3P1X A;  2L6M A;  1HNX E;  2EZ6 A;  2RS6 A;  2V86 A;  4B3M E;  5AAS A;  4LF8 E;  3LML A;  5DNY A;  4YHH E;  4DR4 E;  2N3G A;  1STU A;  4L5N C;  1RQ0 A;  4BS9 A;  2LUP B;  1I94 E;  1XMO E;  4DR7 E;  3OTO E;  2V85 A;  2VQE E;  4DUZ E;  2NUF A;  1J26 A;  4JI6 E;  2JR1 A;  4JI0 E;  3IWC A;  3T1H E;  2K4V A;  2KHX A;  4TUI A;  2ZM6 E;  5LMN E;  4J8Z A;  2LJH A;  4M2Z A;  3JU0 A;  2UU9 E;  1HNW E;  1XMQ E;  4OX9 E;  1GZ6 A;  2DB2 A;  2B9D A;  4M0V A;  4Q28 A;  3F6H A;  4DV3 E;  2H36 X;  2YT4 A;  4BC7 A;  1X49 A;  4F54 A;  2B3T B;  5A2Q C;  4F9B B;  1XNQ E;  4JI1 E;  3F6G A;  2G7H A;  2WZO A;  2IHR 1;  2VF1 A;  2JVA A;  2M7Q A;  4JI7 E;  2JY9 A;  2RS7 A;  2YZT A;  4R03 A;  2M4I A;  5T6J A;  1N33 E;  3RMP A;  4X8W A;  3VYY A;  4JYA E;  1QU6 A;  3JTZ A;  2UXC E;  3ZOQ B;  2VE7 C;  3HPZ A;  3LLH A;  4WSP A;  1YYO A;  4JI5 E;  3K6Q A;  4LF6 E;  1DQ3 A;  4DKK A;  1WHQ A;  5IWA E;  4DV4 E;  2B7V A;  3HQ1 A;  3IWD A;  1IBL E;  5AE3 A;  1YYK A;  4KHP E;  4JV5 E;  5CFF E;  2N3H A;  1ZBQ A;  1O0W A;  1IBK E;  4DMI A;  3C4B A;  1DI2 A;  4WYQ B;  2MDR A;  1N32 E;  2NA2 A;  5F3W A;  2FGG A;  2UXB E;  2L92 A;  3HPS A;  1HNZ E;  4DR3 E;  2EWL A;  4P7D A;  4X66 E;  2M1S A;  1ZBT A;  4AQY E;  4LFC E;  1FJG E;  3HXL A;  1X48 A;  2DSY A;  2F4V E;  4JI2 E;  4X64 E;  2L2N A;  5LMU E;  2F8B A;  4BMJ A;  3T1Y E;  2HHH E;  4JI3 E;  2KON A;  2L8T A;  2LRS A;  4BBY A;  2DMY A;  4TUG A;  2L3C A;  1FKA E;  4NXN E;  2NUE A;  4B3S E;  5AE2 A;  1PKP A;  2CPN A;  2VQF E;  4DR5 E;  2E5L E;  1X47 A;  2JWO A;  4YY3 E;  1WXR A;  3KWR A;  4DV7 E;  1HR0 E;  4NXM E;  4GKJ E;  2L33 A;  2UUC E;  2KOU A;  4F9A B;  4WPY A;  1YYW A;  1GQE A;  3FIG A;  4M30 A;  4DV1 E;  1IBM E;  4LFB E;  3MSW A;  4L8N A;  4WFT A;  1N36 E;  3ADL A;  4B3R E;  3VYX A;  4JI8 E;  4X65 E;  2MC5 A;  5AE1 A;  2L3J A;  4DV5 E;  4BCA A;  4R8O A;  4LF7 E;  3HTX A;  5ADZ A;  4LF4 E;  3JAM C;  4LU9 A;  1J5E E;  3J81 C;  1RC7 A;  3VK6 A;  2LTS A;  2ODR C;  4JI4 E;  3J7Y p;  4DR2 E;  4LF9 E;  4K0K E;  1T4N A;  2RSM A;  1N34 E;  4I8O A;  3C4T A;  3ADI A;  3AV0 A;  2NUG A;  2UUA E;  2JOX A;  2RTX A;  2UUB E;  2LE2 A;  4DUY E;  4LFA E;  2MC6 A;  5FLX C;  2LBS B;  4X62 E;  4DV6 E;  4F9C B;  2LTR A;  1UIL A;  2E1M A;  4LTY A;  1WHN A;  3DF6 A;  4LF5 E;  3J7A G;  4DR6 E;  2FV4 B;  3ADG A;  3OML A;  2V88 A;  3H09 A;  3IWB A;  4BC9 A;  5IT9 C;  3J80 C;  2V8Q B;  4DV2 E;  2FTX B;  4KZS A;  1T4L B;  4B3T E;  5BR8 E;  2V89 A;  1EKZ A;  2V87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...