1EKZA

Nmr structure of the complex between the third dsrbd from drosophila staufen and a rna hairpin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
76
structure length
76
Chain Sequence
MDEGDKKSPISQVHEIGIKRNMTVHFKVLREEGPAHMKNFITACIVGSIVTEGEGNGKKVSKKRAAEKMLVELQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNA recognition by a Staufen double-stranded RNA-binding domain.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Cell cycle/rna
molecule keywords STAUFEN DOUBLE-STRANDED RNA BINDING DOMAIN
total genus 14
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2000-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1ekzA00
4DV3E 1J26A 3C4TA 4GKJE 4M2ZA 2L2MA 1I94E 2JY9A 4YHHE 1J5EE 1FKAE 4B3SE 3LLHA 3J7Yp 1IBKE 4NXNE 2F4VE 2IHR1 2UXDE 1UHZA 1XNQE 2L33A 2NA2A 5LMUE 1QU6A 4DR5E 2NUFA 2RSMA 1N34E 1HR0E 1UILA 1HNWE 2B7VA 4LFAE 1XMOE 2UU9E 2L2NA 2LUQA 2N3HA 4X64E 4LF6E 3ADIA 4LFBE 2L2KB 4DV1E 1XMQE 2CPNA 2EZ6A 4LF8E 2RS6A 4JV5E 4DV0E 4LF7E 3ADJA 1ZBTA 1PKPA 5BR8E 1YYOA 4KHPE 1X48A 4DV6E 2DMYA 4DUYE 4DV2E 2L3CA 1T4LB 2B3TB 2UXBE 4JI4E 1N36E 2LTSA 1RQ0A 2JVAA 4OX9E 1DI2A 4LF5E 2YT4A 2LTRA 1YYWA 2NUGA 3ADLA 3VYYA 4DR1E 4DR4E 3ADGA 1X49A 4X66E 3VYXA 2N3GA 2KHXA 1WHQA 2UUAE 1RC7A 4M30A 1HNZE 4K0KE 1T4NA 4DV7E 2E5LE 2RS7A 1IBME 4B3ME 4JI1E 2DIXA 1FJGE 2UUBE 4B3RE 5CFFE 3HTXA 4JYAE 2ZM6E 1HNXE 1O0WA 4DR2E 2VQFE 4X65E 2L3JA 1X47A 4DKKA 4LFCE 4JI5E 1IBLE 2VQEE 4OOGC 5IWAE 4LF4E 4NXME 2DB2A 3C4BA 1EKZA 4LF9E 1STUA 4JI8E 4B3TE 2LBSB 4JI6E 1XNRE 1N33E 4X8WA 2LUPB 1WHNA 4DUZE 2HHHE 2MDRA 1YZ9A 2UUCE 2B7TA 4WFTA 4DR3E 2UXCE 4DR7E 4GKKE 4DR6E 4YY3E 4JI7E 4X62E 3OTOE 1YYKA 4DV4E 4AQYE 3P1XA 1N32E 4DV5E 4JI2E 4WYQB 3T1YE 1T4OA 1GQEA 5LMNE 2NUEA 2LJHA 4JI3E 3T1HE 2LRSA 4JI0E 2RTXA
chains in the Genus database with same CATH superfamily
2V87A 2L2MA 4NXNE 2JY9A 3BF2A 5IT9C 1WRJA 1IBKE 2LV2A 2EMHA 2YPNA 3LMLA 2L33A 4DMIA 4HEIA 5KL3A 1N34E 2ENCA 4WX9A 4LFAE 2YTJA 2JYAA 2N3HA 4LF6E 3ADIA 2JP9A 2DSYA 2L2KB 4DV1E 1PDAA 2EMXA 2EPAA 2YZTA 1PKPA 2LVHA 2YSOA 4F9CB 1YYOA 2ELYA 1X48A 2D9HA 5KL2A 2YTNA 2L3CA 1T4LB 2B3TB 4BC7A 2JR1A 5T6JA 1UBDC 2EORA 2L92A 4OX9E 4R03A 3MHSC 2MDGA 2EOSA 2HC5A 2EMLA 2YRMA 4DR4E 2N8XA 1YUJA 2ADRA 2MC5A 4NHRA 1WHQA 2EMGA 2EN6A 5A6BA 1A1IA 4M30A 3DJWA 4GEQB 2L8TA 2EM4A 4F54A 2FTXB 4ZYGA 2EQ1A 3HTXA 2ZM6E 3EPLA 5AE2A 2VQFE 4X65E 2L3JA 2YRHA 3UK3C 1T38A 2EQ0A 5AE1A 4DKKA 4LFCE 1IBLE 2KONA 2VQEE 4IJDA 4OOGC 4R2RA 4WPYA 2VE7C 2CSHA 4WXCA 2R1FA 3HPZA 4KZSA 3IWBA 2EOFA 2LBSB 2EN8A 3H09A 2EPCA 2BB8A 3MHHC 1A1HA 4DUZE 2EJ4A 2UXCE 3QG5C 5AE3A 1PJSA 2NABA 3BBGA 2EPRA 1G2DC 1YFHA 2EWLA 4WXDA 4DV4E 1N32E 4JI2E 1X6FA 2YTPA 5LMNE 2YTIA 3JU0A 5AC5A 2LJHA 1T39A 1GTKA 2V83A 2LRSA 2RTXA 5AC4A 2M9AA 4TUIA 2JWOA 3AUZA 4O5GA 3IWDA 1I94E 2F4VE 3VYXA 3LLHA 1L4SA 2WZOA 2CTDA 1RMDA 2V8QB 2IHR1 3JTZA 5AASA 5A2QC 4ZYDA 4DR5E 2V85A 2EPXA 1HR0E 3DF6A 2RSIA 4R8OA 2ELZA 1AAYA 4F2JC 5A6BD 4X64E 1DQ3A 5KL4A 1YSAC 4O4KA 2EPPA 1XMQE 2EOYA 3J80C 2EZ6A 3EPKA 4MLQA 4X9JA 4I8OA 4JV5E 2EN7A 2EPMX 2YU8A 2EOXA 1WXRA 4KHPE 4DV6E 2DMYA 5TSEA 1A1JA 3EPJA 2H36X 1IMUA 1RQ0A 2LCEA 3HPSA 1DI2A 2JOXA 2EL5A 2LTRA 1TF3A 1YYWA 2NUGA 4DR1E 2EOJA 3ADGA 2M4IA 2RPCA 5A6KA 2I13A 1P47A 2EOQA 2UUAE 1HNZE 1NCSA 4B3ME 4JI1E 2DIXA 4F9AB 1BBOA 2R76A 2EMKA 2EOHA 1O0WA 2LT7A 1A1FA 1X47A 1ZU1A 2WBUA 4RHBB 2MC6A 3JAMC 2YTFA 5ADZA 5IWAE 4R2AA 4LF4E 1TF6A 2ODRD 4NXME 3C4BA 2EOOA 5F3WA 3MSWA 4LF9E 3TQMA 2KOUA 2V88A 2EMAA 2EM5A 1XNRE 4X8WA 2LUPB 1WHNA 2GLIA 2HGHA 2MDRA 1YZ9A 2UUCE 2EMYA 4NZVA 4P78A 4LU9A 2YRKA 2LO3A 3THNA 1PJTA 4YY3E 2YTDA 1X5WA 4Q35B 3OTOE 3FIGA 2B9DA 2M7QA 3T1YE 3L00A 3C6KA 1ZBQA 1A1KA 2WCC3 4BMJA 1BB8A 1J5EE 2EPUA 3RMPA 1J26A 4O43A 4GKJE 5FLXC 4B3SE 4YHHE 3J7AG 1EH6A 4GZNC 2UXDE 1UHZA 4FK5C 2EN3A 1QU6A 2RSMA 2WBTA 2RQLA 5KL5A 1HNWE 2YTOA 5KL6A 2LUQA 3OMLA 1PJQA 1N3GA 2V86A 3VK6A 1G2FC 2CPNA 2EM7A 2YTQA 1TN9A 2RS6A 1KJKA 2EM0A 4R2EA 4F6NA 2GPIA 2EM6A 3ADJA 1ZBTA 4ZYHA 2PRTA 4DV0E 3F6GA 1B69A 4LF7E 4RH8A 4WSGA 2MKNA 4M9VC 1MGTA 3EQ1A 4DV2E 2UXBE 2JXPA 1ZAAC 2LTSA 2EL4A 3J81C 2EOZA 2ENAA 2YT4A 1KYQA 2EM2A 2EMIA 4L8NA 3ADLA 2M1SA 1X49A 4X66E 2DRPA 2EOIA 1SFEA 2Q8UA 2I9IA 3BIDA 3KZZA 1RC7A 2EN4A 2YSPA 2EE8A 2G7HA 1IQOA 3HQ1A 1T4NA 4DV7E 2E5LE 1IBME 1FJGE 2UUBE 4BCAA 4B3RE 5CFFE 4JYAE 1MEYC 3VHTB 4LTYA 4R2CA 2DGCA 3F6HA 4JI5E 2DLQA 3ZOQB 3EPHA 4R2PA 1EH7A 4P7DA 1LLMC 1EKZA 2K7IA 2EPOA 1UN6B 1STUA 4JI8E 4B3TE 2EN1A 2EMFA 2EPNA 2F8BA 1YPNA 1N33E 4M0VA 5A69A 1NEIA 2BBGA 4DR3E 2EPKX 2EL6A 2EM8A 4DR6E 4JI7E 1QNTA 3K6QA 4R2SA 2WBSA 1YYKA 4AQYE 1X6EA 1ZR9A 3P1XA 1WJPA 4DV5E 4WYQB 2DLKA 1T4OA 3T1HE 4J8ZA 2YU5A 2VF1A 2LJUA 1SR9A 2EMBA 2FGGA 4DV3E 2EM9A 1YUIA 4F6MA 2LMZA 3C4TA 4M2ZA 1FKAE 3J7Yp 2YWQA 1GZ6A 4Q28A 2JOBA 2YTEA 1XNQE 4ZYEA 2NA2A 5LMUE 5DNYA 2NUFA 2K4VA 2L6MA 1UILA 3M99B 1A1GA 2B7VA 2LE2A 1XMOE 2UU9E 2L2NA 1A1LA 4LFBE 3THOB 2DMIA 1AH5A 2E1MA 3AV0A 2EM3A 4LF8E 1JK2A 2EMCA 5BR8E 4O24A 4L5NC 4DUYE 2A25A 3ECRA 4JI4E 3BGHA 2EPLX 5KL7A 1N36E 2JVAA 4MLVA 4BBYA 4LF5E 2EN2A 3IWCA 1DGCA 3VYYA 4R2QA 2MKDA 2N3GA 5IXMB 1X3CA 2KHXA 5LLQA 2HJJA 4WSPA 2YTGA 1X6HA 4K0KE 5A6JA 4BHCA 2RS7A 2EOMA 4BHBA 3HXLA 5IV8B 2EMWA 5A6AA 1HNXE 4DR2E 4IS1C 2FV4B 3C6MA 1IQSA 2E72A 2JPAA 1EH8A 2EOEA 2ENHA 4HTGA 1F2IG 3KZYA 1BBGA 2EMZA 2DB2A 4BC9A 4N4RB 4KWYA 2VRDA 4JI6E 2HHHE 2EPZA 2B7TA 2EP3A 4WFTA 2GHFA 4TUGA 4DR7E 4GKKE 5LL6R 1Z1BA 4F9BB 4X62E 2EQ3A 4R2DA 1JK1A 3KWRA 2ODRC 1GQEA 4BS9A 2NUEA 4JI3E 2CT1A 2J7JA 4JI0E 2V89A
chains in the Genus database with same CATH topology
1SR9A 2V87A 2FGGA 4DV3E 4TUIA 2JWOA 3AUZA 3RMPA 1J26A 2LMZA 3C4TA 4GKJE 3IWDA 2L2MA 5FLXC 2JY9A 4YHHE 1J5EE 1I94E 5IT9C 3LLHA 3J7Yp 1IBKE 1FKAE 2WZOA 3J7AG 2V8QB 2IHR1 1GZ6A 3JTZA 4Q28A 3LMLA 2JOBA 2UXDE 1UHZA 5AASA 5A2QC 1XNQE 2L33A 2NA2A 2V89A 5LMUE 4DMIA 1QU6A 5DNYA 2V85A 2K4VA 4DR5E 2RSMA 2NUFA 2L6MA 1N34E 2RTXA 1UILA 1HR0E 3DF6A 1HNWE 2B7VA 4LFAE 2LE2A 1XMOE 4R8OA 2UU9E 2L2NA 2LUQA 2N3HA 1DQ3A 4X64E 4LF6E 3ADIA 2DSYA 3OMLA 4LFBE 2L2KB 3VK6A 2V86A 4DV1E 1XMQE 2CPNA 3J80C 2EZ6A 2E1MA 3AV0A 4LF8E 2RS6A 2YZTA 4I8OA 4JV5E 4DV0E 4LF7E 3ADJA 1ZBTA 1PKPA 5BR8E 3F6GA 4F9CB 1YYOA 4KHPE 1WXRA 1X48A 4DV6E 2DMYA 4L5NC 4DUYE 4DV2E 2L3CA 1T4LB 2B3TB 4BC7A 2UXBE 4JI4E 2H36X 2JR1A 5T6JA 1N36E 2LTSA 1RQ0A 2JVAA 2L92A 3HPSA 4BBYA 3J81C 4LF5E 4OX9E 4R03A 1DI2A 2JOXA 2YT4A 2LTRA 1YYWA 2NUGA 3IWCA 4L8NA 3VYYA 4DR1E 4NXNE 3ADLA 4DR4E 2M1SA 1X49A 3ADGA 4X66E 2M4IA 2MC5A 3VYXA 2N3GA 2KHXA 1WHQA 2UUAE 1RC7A 4M30A 3DJWA 4WSPA 4GEQB 1HNZE 2G7HA 2L8TA 4K0KE 3HQ1A 1T4NA 4DV7E 2E5LE 2RS7A 1IBME 4B3ME 3HXLA 2DIXA 4F54A 4JI1E 4F9AB 1FJGE 2UUBE 2FTXB 4BCAA 5CFFE 4B3RE 3HTXA 4JYAE 2ZM6E 1HNXE 1O0WA 5AE2A 4DR2E 4M2ZA 2VQFE 4X65E 2L3JA 1X47A 4LTYA 5AE1A 3F6HA 4DKKA 2FV4B 2MC6A 4LFCE 4JI5E 1IBLE 3JAMC 2KONA 2VQEE 3ZOQB 4OOGC 5ADZA 5IWAE 4LF4E 4WPYA 2ODRD 2F4VE 2VE7C 4NXME 4B3SE 4P7DA 2DB2A 3C4BA 5F3WA 4BC9A 1EKZA 3HPZA 3MSWA 1STUA 3IWBA 2KOUA 4KZSA 2V88A 4JI8E 4B3TE 2F8BA 4LF9E 2LBSB 3H09A 4JI6E 1XNRE 1N33E 4X8WA 2LUPB 1WHNA 4DUZE 4M0VA 2MDRA 2HHHE 1YZ9A 2UUCE 2B7TA 4WFTA 4DR3E 4TUGA 4P78A 2UXCE 4LU9A 4DR7E 5LL6R 4DR6E 4GKKE 5AE3A 4JI7E 4YY3E 4F9BB 3K6QA 4X62E 3OTOE 3FIGA 2EWLA 1YYKA 4DV4E 4AQYE 3KWRA 3P1XA 1N32E 2ODRC 4DV5E 4JI2E 2B9DA 4WYQB 2M7QA 3T1YE 1T4OA 1GQEA 4BS9A 5LMNE 2NUEA 3JU0A 1ZBQA 2LJHA 4JI3E 3T1HE 2LRSA 2V83A 4J8ZA 4BMJA 4JI0E 2VF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV3 E;  1J26 A;  3C4T A;  4GKJ E;  4M2Z A;  2L2M A;  1I94 E;  2JY9 A;  4YHH E;  1J5E E;  1FKA E;  4B3S E;  3LLH A;  3J7Y p;  1IBK E;  4NXN E;  2F4V E;  2IHR 1;  2UXD E;  1UHZ A;  1XNQ E;  2L33 A;  2NA2 A;  5LMU E;  1QU6 A;  4DR5 E;  2NUF A;  2RSM A;  1N34 E;  1HR0 E;  1UIL A;  1HNW E;  2B7V A;  4LFA E;  1XMO E;  2UU9 E;  2L2N A;  2LUQ A;  2N3H A;  4X64 E;  4LF6 E;  3ADI A;  4LFB E;  2L2K B;  4DV1 E;  1XMQ E;  2CPN A;  2EZ6 A;  4LF8 E;  2RS6 A;  4JV5 E;  4DV0 E;  4LF7 E;  3ADJ A;  1ZBT A;  1PKP A;  5BR8 E;  1YYO A;  4KHP E;  1X48 A;  4DV6 E;  2DMY A;  4DUY E;  4DV2 E;  2L3C A;  1T4L B;  2B3T B;  2UXB E;  4JI4 E;  1N36 E;  2LTS A;  1RQ0 A;  2JVA A;  4OX9 E;  1DI2 A;  4LF5 E;  2YT4 A;  2LTR A;  1YYW A;  2NUG A;  3ADL A;  3VYY A;  4DR1 E;  4DR4 E;  3ADG A;  1X49 A;  4X66 E;  3VYX A;  2N3G A;  2KHX A;  1WHQ A;  2UUA E;  1RC7 A;  4M30 A;  1HNZ E;  4K0K E;  1T4N A;  4DV7 E;  2E5L E;  2RS7 A;  1IBM E;  4B3M E;  4JI1 E;  2DIX A;  1FJG E;  2UUB E;  4B3R E;  5CFF E;  3HTX A;  4JYA E;  2ZM6 E;  1HNX E;  1O0W A;  4DR2 E;  2VQF E;  4X65 E;  2L3J A;  1X47 A;  4DKK A;  4LFC E;  4JI5 E;  1IBL E;  2VQE E;  4OOG C;  5IWA E;  4LF4 E;  4NXM E;  2DB2 A;  3C4B A;  1EKZ A;  4LF9 E;  1STU A;  4JI8 E;  4B3T E;  2LBS B;  4JI6 E;  1XNR E;  1N33 E;  4X8W A;  2LUP B;  1WHN A;  4DUZ E;  2HHH E;  2MDR A;  1YZ9 A;  2UUC E;  2B7T A;  4WFT A;  4DR3 E;  2UXC E;  4DR7 E;  4GKK E;  4DR6 E;  4YY3 E;  4JI7 E;  4X62 E;  3OTO E;  1YYK A;  4DV4 E;  4AQY E;  3P1X A;  1N32 E;  4DV5 E;  4JI2 E;  4WYQ B;  3T1Y E;  1T4O A;  1GQE A;  5LMN E;  2NUE A;  2LJH A;  4JI3 E;  3T1H E;  2LRS A;  4JI0 E;  2RTX A; 
#chains in the Genus database with same CATH topology
 2V87 A;  2L2M A;  4NXN E;  2JY9 A;  3BF2 A;  5IT9 C;  1WRJ A;  1IBK E;  2LV2 A;  2EMH A;  2YPN A;  3LML A;  2L33 A;  4DMI A;  4HEI A;  5KL3 A;  1N34 E;  2ENC A;  4WX9 A;  4LFA E;  2YTJ A;  2JYA A;  2N3H A;  4LF6 E;  3ADI A;  2JP9 A;  2DSY A;  2L2K B;  4DV1 E;  1PDA A;  2EMX A;  2EPA A;  2YZT A;  1PKP A;  2LVH A;  2YSO A;  4F9C B;  1YYO A;  2ELY A;  1X48 A;  2D9H A;  5KL2 A;  2YTN A;  2L3C A;  1T4L B;  2B3T B;  4BC7 A;  2JR1 A;  5T6J A;  1UBD C;  2EOR A;  2L92 A;  4OX9 E;  4R03 A;  3MHS C;  2MDG A;  2EOS A;  2HC5 A;  2EML A;  2YRM A;  4DR4 E;  2N8X A;  1YUJ A;  2ADR A;  2MC5 A;  4NHR A;  1WHQ A;  2EMG A;  2EN6 A;  5A6B A;  1A1I A;  4M30 A;  3DJW A;  4GEQ B;  2L8T A;  2EM4 A;  4F54 A;  2FTX B;  4ZYG A;  2EQ1 A;  3HTX A;  2ZM6 E;  3EPL A;  5AE2 A;  2VQF E;  4X65 E;  2L3J A;  2YRH A;  3UK3 C;  1T38 A;  2EQ0 A;  5AE1 A;  4DKK A;  4LFC E;  1IBL E;  2KON A;  2VQE E;  4IJD A;  4OOG C;  4R2R A;  4WPY A;  2VE7 C;  2CSH A;  4WXC A;  2R1F A;  3HPZ A;  4KZS A;  3IWB A;  2EOF A;  2LBS B;  2EN8 A;  3H09 A;  2EPC A;  2BB8 A;  3MHH C;  1A1H A;  4DUZ E;  2EJ4 A;  2UXC E;  3QG5 C;  5AE3 A;  1PJS A;  2NAB A;  3BBG A;  2EPR A;  1G2D C;  1YFH A;  2EWL A;  4WXD A;  4DV4 E;  1N32 E;  4JI2 E;  1X6F A;  2YTP A;  5LMN E;  2YTI A;  3JU0 A;  5AC5 A;  2LJH A;  1T39 A;  1GTK A;  2V83 A;  2LRS A;  2RTX A;  5AC4 A;  2M9A A;  4TUI A;  2JWO A;  3AUZ A;  4O5G A;  3IWD A;  1I94 E;  2F4V E;  3VYX A;  3LLH A;  1L4S A;  2WZO A;  2CTD A;  1RMD A;  2V8Q B;  2IHR 1;  3JTZ A;  5AAS A;  5A2Q C;  4ZYD A;  4DR5 E;  2V85 A;  2EPX A;  1HR0 E;  3DF6 A;  2RSI A;  4R8O A;  2ELZ A;  1AAY A;  4F2J C;  5A6B D;  4X64 E;  1DQ3 A;  5KL4 A;  1YSA C;  4O4K A;  2EPP A;  1XMQ E;  2EOY A;  3J80 C;  2EZ6 A;  3EPK A;  4MLQ A;  4X9J A;  4I8O A;  4JV5 E;  2EN7 A;  2EPM X;  2YU8 A;  2EOX A;  1WXR A;  4KHP E;  4DV6 E;  2DMY A;  5TSE A;  1A1J A;  3EPJ A;  2H36 X;  1IMU A;  1RQ0 A;  2LCE A;  3HPS A;  1DI2 A;  2JOX A;  2EL5 A;  2LTR A;  1TF3 A;  1YYW A;  2NUG A;  4DR1 E;  2EOJ A;  3ADG A;  2M4I A;  2RPC A;  5A6K A;  2I13 A;  1P47 A;  2EOQ A;  2UUA E;  1HNZ E;  1NCS A;  4B3M E;  4JI1 E;  2DIX A;  4F9A B;  1BBO A;  2R76 A;  2EMK A;  2EOH A;  1O0W A;  2LT7 A;  1A1F A;  1X47 A;  1ZU1 A;  2WBU A;  4RHB B;  2MC6 A;  3JAM C;  2YTF A;  5ADZ A;  5IWA E;  4R2A A;  4LF4 E;  1TF6 A;  2ODR D;  4NXM E;  3C4B A;  2EOO A;  5F3W A;  3MSW A;  4LF9 E;  3TQM A;  2KOU A;  2V88 A;  2EMA A;  2EM5 A;  1XNR E;  4X8W A;  2LUP B;  1WHN A;  2GLI A;  2HGH A;  2MDR A;  1YZ9 A;  2UUC E;  2EMY A;  4NZV A;  4P78 A;  4LU9 A;  2YRK A;  2LO3 A;  3THN A;  1PJT A;  4YY3 E;  2YTD A;  1X5W A;  4Q35 B;  3OTO E;  3FIG A;  2B9D A;  2M7Q A;  3T1Y E;  3L00 A;  3C6K A;  1ZBQ A;  1A1K A;  2WCC 3;  4BMJ A;  1BB8 A;  1J5E E;  2EPU A;  3RMP A;  1J26 A;  4O43 A;  4GKJ E;  5FLX C;  4B3S E;  4YHH E;  3J7A G;  1EH6 A;  4GZN C;  2UXD E;  1UHZ A;  4FK5 C;  2EN3 A;  1QU6 A;  2RSM A;  2WBT A;  2RQL A;  5KL5 A;  1HNW E;  2YTO A;  5KL6 A;  2LUQ A;  3OML A;  1PJQ A;  1N3G A;  2V86 A;  3VK6 A;  1G2F C;  2CPN A;  2EM7 A;  2YTQ A;  1TN9 A;  2RS6 A;  1KJK A;  2EM0 A;  4R2E A;  4F6N A;  2GPI A;  2EM6 A;  3ADJ A;  1ZBT A;  4ZYH A;  2PRT A;  4DV0 E;  3F6G A;  1B69 A;  4LF7 E;  4RH8 A;  4WSG A;  2MKN A;  4M9V C;  1MGT A;  3EQ1 A;  4DV2 E;  2UXB E;  2JXP A;  1ZAA C;  2LTS A;  2EL4 A;  3J81 C;  2EOZ A;  2ENA A;  2YT4 A;  1KYQ A;  2EM2 A;  2EMI A;  4L8N A;  3ADL A;  2M1S A;  1X49 A;  4X66 E;  2DRP A;  2EOI A;  1SFE A;  2Q8U A;  2I9I A;  3BID A;  3KZZ A;  1RC7 A;  2EN4 A;  2YSP A;  2EE8 A;  2G7H A;  1IQO A;  3HQ1 A;  1T4N A;  4DV7 E;  2E5L E;  1IBM E;  1FJG E;  2UUB E;  4BCA A;  4B3R E;  5CFF E;  4JYA E;  1MEY C;  3VHT B;  4LTY A;  4R2C A;  2DGC A;  3F6H A;  4JI5 E;  2DLQ A;  3ZOQ B;  3EPH A;  4R2P A;  1EH7 A;  4P7D A;  1LLM C;  1EKZ A;  2K7I A;  2EPO A;  1UN6 B;  1STU A;  4JI8 E;  4B3T E;  2EN1 A;  2EMF A;  2EPN A;  2F8B A;  1YPN A;  1N33 E;  4M0V A;  5A69 A;  1NEI A;  2BBG A;  4DR3 E;  2EPK X;  2EL6 A;  2EM8 A;  4DR6 E;  4JI7 E;  1QNT A;  3K6Q A;  4R2S A;  2WBS A;  1YYK A;  4AQY E;  1X6E A;  1ZR9 A;  3P1X A;  1WJP A;  4DV5 E;  4WYQ B;  2DLK A;  1T4O A;  3T1H E;  4J8Z A;  2YU5 A;  2VF1 A;  2LJU A;  1SR9 A;  2EMB A;  2FGG A;  4DV3 E;  2EM9 A;  1YUI A;  4F6M A;  2LMZ A;  3C4T A;  4M2Z A;  1FKA E;  3J7Y p;  2YWQ A;  1GZ6 A;  4Q28 A;  2JOB A;  2YTE A;  1XNQ E;  4ZYE A;  2NA2 A;  5LMU E;  5DNY A;  2NUF A;  2K4V A;  2L6M A;  1UIL A;  3M99 B;  1A1G A;  2B7V A;  2LE2 A;  1XMO E;  2UU9 E;  2L2N A;  1A1L A;  4LFB E;  3THO B;  2DMI A;  1AH5 A;  2E1M A;  3AV0 A;  2EM3 A;  4LF8 E;  1JK2 A;  2EMC A;  5BR8 E;  4O24 A;  4L5N C;  4DUY E;  2A25 A;  3ECR A;  4JI4 E;  3BGH A;  2EPL X;  5KL7 A;  1N36 E;  2JVA A;  4MLV A;  4BBY A;  4LF5 E;  2EN2 A;  3IWC A;  1DGC A;  3VYY A;  4R2Q A;  2MKD A;  2N3G A;  5IXM B;  1X3C A;  2KHX A;  5LLQ A;  2HJJ A;  4WSP A;  2YTG A;  1X6H A;  4K0K E;  5A6J A;  4BHC A;  2RS7 A;  2EOM A;  4BHB A;  3HXL A;  5IV8 B;  2EMW A;  5A6A A;  1HNX E;  4DR2 E;  4IS1 C;  2FV4 B;  3C6M A;  1IQS A;  2E72 A;  2JPA A;  1EH8 A;  2EOE A;  2ENH A;  4HTG A;  1F2I G;  3KZY A;  1BBG A;  2EMZ A;  2DB2 A;  4BC9 A;  4N4R B;  4KWY A;  2VRD A;  4JI6 E;  2HHH E;  2EPZ A;  2B7T A;  2EP3 A;  4WFT A;  2GHF A;  4TUG A;  4DR7 E;  4GKK E;  5LL6 R;  1Z1B A;  4F9B B;  4X62 E;  2EQ3 A;  4R2D A;  1JK1 A;  3KWR A;  2ODR C;  1GQE A;  4BS9 A;  2NUE A;  4JI3 E;  2CT1 A;  2J7J A;  4JI0 E;  2V89 A; 
#chains in the Genus database with same CATH homology
 1SR9 A;  2V87 A;  2FGG A;  4DV3 E;  4TUI A;  2JWO A;  3AUZ A;  3RMP A;  1J26 A;  2LMZ A;  3C4T A;  4GKJ E;  3IWD A;  2L2M A;  5FLX C;  2JY9 A;  4YHH E;  1J5E E;  1I94 E;  5IT9 C;  3LLH A;  3J7Y p;  1IBK E;  1FKA E;  2WZO A;  3J7A G;  2V8Q B;  2IHR 1;  1GZ6 A;  3JTZ A;  4Q28 A;  3LML A;  2JOB A;  2UXD E;  1UHZ A;  5AAS A;  5A2Q C;  1XNQ E;  2L33 A;  2NA2 A;  2V89 A;  5LMU E;  4DMI A;  1QU6 A;  5DNY A;  2V85 A;  2K4V A;  4DR5 E;  2RSM A;  2NUF A;  2L6M A;  1N34 E;  2RTX A;  1UIL A;  1HR0 E;  3DF6 A;  1HNW E;  2B7V A;  4LFA E;  2LE2 A;  1XMO E;  4R8O A;  2UU9 E;  2L2N A;  2LUQ A;  2N3H A;  1DQ3 A;  4X64 E;  4LF6 E;  3ADI A;  2DSY A;  3OML A;  4LFB E;  2L2K B;  3VK6 A;  2V86 A;  4DV1 E;  1XMQ E;  2CPN A;  3J80 C;  2EZ6 A;  2E1M A;  3AV0 A;  4LF8 E;  2RS6 A;  2YZT A;  4I8O A;  4JV5 E;  4DV0 E;  4LF7 E;  3ADJ A;  1ZBT A;  1PKP A;  5BR8 E;  3F6G A;  4F9C B;  1YYO A;  4KHP E;  1WXR A;  1X48 A;  4DV6 E;  2DMY A;  4L5N C;  4DUY E;  4DV2 E;  2L3C A;  1T4L B;  2B3T B;  4BC7 A;  2UXB E;  4JI4 E;  2H36 X;  2JR1 A;  5T6J A;  1N36 E;  2LTS A;  1RQ0 A;  2JVA A;  2L92 A;  3HPS A;  4BBY A;  3J81 C;  4LF5 E;  4OX9 E;  4R03 A;  1DI2 A;  2JOX A;  2YT4 A;  2LTR A;  1YYW A;  2NUG A;  3IWC A;  4L8N A;  3VYY A;  4DR1 E;  4NXN E;  3ADL A;  4DR4 E;  2M1S A;  1X49 A;  3ADG A;  4X66 E;  2M4I A;  2MC5 A;  3VYX A;  2N3G A;  2KHX A;  1WHQ A;  2UUA E;  1RC7 A;  4M30 A;  3DJW A;  4WSP A;  4GEQ B;  1HNZ E;  2G7H A;  2L8T A;  4K0K E;  3HQ1 A;  1T4N A;  4DV7 E;  2E5L E;  2RS7 A;  1IBM E;  4B3M E;  3HXL A;  2DIX A;  4F54 A;  4JI1 E;  4F9A B;  1FJG E;  2UUB E;  2FTX B;  4BCA A;  5CFF E;  4B3R E;  3HTX A;  4JYA E;  2ZM6 E;  1HNX E;  1O0W A;  5AE2 A;  4DR2 E;  4M2Z A;  2VQF E;  4X65 E;  2L3J A;  1X47 A;  4LTY A;  5AE1 A;  3F6H A;  4DKK A;  2FV4 B;  2MC6 A;  4LFC E;  4JI5 E;  1IBL E;  3JAM C;  2KON A;  2VQE E;  3ZOQ B;  4OOG C;  5ADZ A;  5IWA E;  4LF4 E;  4WPY A;  2ODR D;  2F4V E;  2VE7 C;  4NXM E;  4B3S E;  4P7D A;  2DB2 A;  3C4B A;  5F3W A;  4BC9 A;  1EKZ A;  3HPZ A;  3MSW A;  1STU A;  3IWB A;  2KOU A;  4KZS A;  2V88 A;  4JI8 E;  4B3T E;  2F8B A;  4LF9 E;  2LBS B;  3H09 A;  4JI6 E;  1XNR E;  1N33 E;  4X8W A;  2LUP B;  1WHN A;  4DUZ E;  4M0V A;  2MDR A;  2HHH E;  1YZ9 A;  2UUC E;  2B7T A;  4WFT A;  4DR3 E;  4TUG A;  4P78 A;  2UXC E;  4LU9 A;  4DR7 E;  5LL6 R;  4DR6 E;  4GKK E;  5AE3 A;  4JI7 E;  4YY3 E;  4F9B B;  3K6Q A;  4X62 E;  3OTO E;  3FIG A;  2EWL A;  1YYK A;  4DV4 E;  4AQY E;  3KWR A;  3P1X A;  1N32 E;  2ODR C;  4DV5 E;  4JI2 E;  2B9D A;  4WYQ B;  2M7Q A;  3T1Y E;  1T4O A;  1GQE A;  4BS9 A;  5LMN E;  2NUE A;  3JU0 A;  1ZBQ A;  2LJH A;  4JI3 E;  3T1H E;  2LRS A;  2V83 A;  4J8Z A;  4BMJ A;  4JI0 E;  2VF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...