1EKZA

Nmr structure of the complex between the third dsrbd from drosophila staufen and a rna hairpin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
76
structure length
76
Chain Sequence
MDEGDKKSPISQVHEIGIKRNMTVHFKVLREEGPAHMKNFITACIVGSIVTEGEGNGKKVSKKRAAEKMLVELQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNA recognition by a Staufen double-stranded RNA-binding domain.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Cell cycle/rna
molecule keywords STAUFEN DOUBLE-STRANDED RNA BINDING DOMAIN
total genus 14
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2000-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1ekzA00
4JI7E 3ADIA 4NXNE 5IWAE 1FJGE 1XMOE 1IBME 2VQEE 1STUA 4JV5E 2UUCE 3ADGA 4K0KE 4NXME 3VYYA 1X49A 1X47A 1EKZA 4DR4E 2MDRA 4LF6E 2L2MA 4DV6E 4DV2E 2L33A 2VQFE 3ADJA 4LFAE 3J7Yp 2UU9E 4LF4E 4DV4E 4B3SE 1XNQE 2LTSA 1UILA 4DV5E 1FKAE 1T4LB 4DR6E 2RS7A 4M30A 4DUYE 5LMNE 2KHXA 1T4OA 3T1YE 2LJHA 1IBKE 2RTXA 2LTRA 4DR1E 2RSMA 3LLHA 3T1HE 4JI0E 4DV1E 4DR5E 2B3TB 2NUGA 4WYQB 4X65E 4DR3E 2LRSA 4YHHE 2HHHE 2L3JA 1O0WA 2NUEA 1QU6A 1J5EE 3C4TA 4DR7E 2L2KB 4DR2E 1X48A 4X8WA 5BR8E 1XNRE 2UUBE 2E5LE 2UXBE 1J26A 4KHPE 4JI4E 4X62E 4LF5E 1HNXE 4GKJE 1YYOA 5LMUE 2EZ6A 2UXCE 4LF9E 4JI1E 1N33E 2JY9A 2B7TA 4JI8E 4LFBE 2RS6A 2N3GA 1WHNA 2L3CA 4B3ME 3HTXA 2UUAE 3VYXA 4X66E 1I94E 4JI2E 2YT4A 1YYKA 1UHZA 1YYWA 1WHQA 2DIXA 4DUZE 2JVAA 2NA2A 1HNWE 1N34E 1HNZE 4X64E 4GKKE 2NUFA 3ADLA 2F4VE 1N36E 2LUQA 1HR0E 4DKKA 4WFTA 3C4BA 2ZM6E 2N3HA 2UXDE 2LBSB 2CPNA 4M2ZA 1T4NA 5CFFE 4DV3E 4OOGC 4JI6E 1XMQE 2L2NA 4LF8E 1RC7A 4B3TE 1GQEA 1N32E 4B3RE 3OTOE 1DI2A 1PKPA 1YZ9A 4LFCE 1ZBTA 2IHR1 4DV7E 4LF7E 2DB2A 1RQ0A 2DMYA 4JI5E 4JYAE 2B7VA 4YY3E 2LUPB 4OX9E 1IBLE 4AQYE 3P1XA 4JI3E 4DV0E
chains in the Genus database with same CATH superfamily
3DJWA 3ADIA 1IQOA 1QNTA 2EQ3A 3HQ1A 1XMOE 2VQEE 2LVHA 2EM7A 2KONA 2HC5A 3ADGA 1EKZA 1X49A 2HGHA 2CT1A 1G2DC 5AASA 1T39A 2MDRA 2J7JA 2Q8UA 1X6HA 2BB8A 5ADZA 3J7Yp 4R2QA 3HPZA 4DV4E 3BF2A 3FIGA 1XNQE 1UILA 4WSGA 2CSHA 3ZOQB 4DR6E 2RS7A 5KL7A 4WPYA 2YU8A 2LJHA 4M9VC 5A69A 2D9HA 4DR1E 4F54A 2LMZA 2LT7A 4DV1E 1RMDA 1UBDC 4DR3E 1PJTA 1MGTA 4BHCA 5KL3A 1O0WA 3IWBA 4R2DA 1G2FC 2NUEA 1QU6A 2KOUA 4BS9A 5A6AA 3VK6A 1UN6B 4FK5C 2EMYA 5DNYA 4GKJE 1A1FA 1AAYA 3K6QA 2UXCE 2EM6A 2EZ6A 2EM2A 4JI1E 4R2SA 1N33E 4P7DA 4O43A 2YU5A 2LCEA 1JK1A 1WHNA 2E72A 4R2RA 2YT4A 4KZSA 1YYKA 1UHZA 3RMPA 2EPLX 5AE2A 4NZVA 2EN4A 2JVAA 5F3WA 1HNZE 2I9IA 1PJSA 1HR0E 2V87A 4ZYDA 1SR9A 2B9DA 1N3GA 3L00A 2ZM6E 2WZOA 2FV4B 4B3TE 2GLIA 4N4RB 2EMGA 2NABA 1EH8A 1PKPA 2K7IA 5AC5A 1BB8A 1ZBTA 1GTKA 4DV7E 1LLMC 1X6EA 2ADRA 4LF7E 2FTXB 4ZYHA 1YFHA 1T38A 1EH6A 4TUGA 4JYAE 4YY3E 5A6JA 5KL2A 2WBSA 1F2IG 4DV0E 3JTZA 3C6MA 4J8ZA 1ZR9A 3EPKA 5TSEA 5IWAE 1NCSA 2YZTA 4NHRA 2EPXA 1YUJA 4K0KE 1ZBQA 1WXRA 2EE8A 2L2MA 2EL6A 1JK2A 4DV6E 4DV2E 2V85A 2M1SA 3ADJA 1ZAAC 4LFAE 2YPNA 3IWDA 2YSPA 2JOBA 2V8QB 4R2PA 2LTSA 1FKAE 1A1JA 2EN2A 4I8OA 1T4OA 5LMNE 1A1GA 1A1LA 2YTEA 3MSWA 3LLHA 1TN9A 2EOYA 2FGGA 4JI0E 2EN6A 3MHHC 4R03A 1GZ6A 2JR1A 2EM3A 2EPKX 1BBGA 2L3JA 3KZZA 2YTOA 1J5EE 2MC5A 4DR7E 3VHTB 5A6BD 1X48A 2EPNA 3EQ1A 2H36X 2JPAA 2UXBE 2EP3A 1Z1BA 2YRKA 4F2JC 1YYOA 2EPOA 2PRTA 4LF9E 4Q28A 4F9CB 3BGHA 5IV8B 4ZYEA 4LTYA 2ELYA 2EPPA 4F9AB 2EJ4A 2YWQA 1IQSA 2RS6A 2N3GA 2UUAE 4F6MA 3VYXA 1I94E 2BBGA 2RSIA 5T6JA 1IMUA 2EOFA 4DUZE 2LV2A 4WX9A 2EOZA 2EMFA 3QG5C 4X64E 1DGCA 2NUFA 3ADLA 4DKKA 1PDAA 4WFTA 3THOB 5AE3A 2EMHA 3C4BA 4F6NA 5A6BA 2UXDE 2CTDA 2LBSB 2M7QA 2EMLA 1T4NA 5CFFE 4OOGC 4JI6E 1KYQA 2EL5A 2MC6A 2L2NA 2MKDA 1GQEA 1X3CA 2HJJA 1YZ9A 4LFCE 2JP9A 2R1FA 2EOIA 4JI5E 2DMIA 2B7VA 2LUPB 2V83A 4OX9E 2G7HA 2EL4A 1IBLE 4JI7E 4IS1C 2YTQA 1IBME 4RH8A 1STUA 1YSAC 4JV5E 2EMCA 5AC4A 2EOQA 3ECRA 4DR4E 2EPZA 4R2EA 4IJDA 2EPAA 2EPRA 1ZU1A 2EM4A 2EORA 1PJQA 2MDGA 4LF4E 4B3SE 3F6HA 4BMJA 3EPHA 4DV5E 1T4LB 2YTFA 3BBGA 2WBTA 4WXDA 2DGCA 4R2CA 3T1YE 5IXMB 1TF6A 2I13A 2RTXA 2LTRA 3KZYA 5LL6R 2RSMA 4R8OA 2WBUA 2V86A 4DR5E 2B3TB 2NUGA 2EOHA 4GZNC 2EOJA 2LRSA 2HHHE 3F6GA 1A1HA 4DMIA 2EPMX 2WCC3 2LO3A 2LE2A 2K4VA 4DR2E 1AH5A 3HXLA 4X8WA 5BR8E 2L92A 1XNRE 2UUBE 2YTDA 2E5LE 2EMXA 1TF3A 1J26A 4JI4E 4LF5E 2DRPA 4BHBA 5IT9C 5LMUE 3M99B 2EPCA 4HTGA 4ZYGA 2ENHA 5KL5A 4LFBE 2ODRD 4BC9A 4B3ME 2EMIA 3HTXA 1SFEA 2MKNA 2EQ0A 2YTIA 5AE1A 1HNWE 3TQMA 2F8BA 2EOSA 4GKKE 1WRJA 2JYAA 4KWYA 4P78A 2F4VE 1N36E 4MLQA 3J81C 4TUIA 2N3HA 1NEIA 2ENAA 2ELZA 4DV3E 2EM9A 2EMKA 2EMZA 3EPJA 4LF8E 1RC7A 2R76A 3JU0A 3J80C 3JAMC 1DI2A 2VE7C 5LLQA 2IHR1 5A2QC 1KJKA 2L8TA 2EOXA 2VRDA 2YTPA 4HEIA 1RQ0A 4O24A 2DMYA 3BIDA 4AQYE 3P1XA 4Q35B 4L5NC 2JXPA 2EOEA 2LJUA 4NXNE 5A6KA 1FJGE 2M4IA 2UUCE 1DQ3A 3EPLA 2EWLA 4NXME 3OMLA 3VYYA 1X47A 1P47A 3C6KA 1BBOA 4LF6E 2EM0A 2L33A 2VQFE 2V88A 2UU9E 4R2AA 3DF6A 2EM8A 1EH7A 4M0VA 2GPIA 4M30A 4DUYE 4BBYA 1A1IA 2KHXA 4BC7A 1IBKE 4BCAA 4MLVA 3T1HE 1B69A 2EMBA 4WYQB 4X65E 2VF1A 4YHHE 2RPCA 2YSOA 2L6MA 3C4TA 2EMWA 2EOOA 2L2KB 4GEQB 3MHSC 5KL6A 3THNA 3LMLA 4X9JA 4O5GA 2YRHA 2YTGA 3HPSA 4KHPE 2EN7A 4X62E 1HNXE 1MEYC 2A25A 3AV0A 1YPNA 2JY9A 2B7TA 1YUIA 2EM5A 3H09A 4LU9A 4WXCA 2M9AA 4JI8E 1A1KA 2EN1A 2EOMA 2L3CA 2EN8A 2DLQA 2EN3A 4X66E 4JI2E 4L8NA 1YYWA 1WHQA 4O4KA 2DIXA 2RQLA 4WSPA 2ODRC 2NA2A 4RHBB 3J7AG 1N34E 3UK3C 2YTNA 3KWRA 3AUZA 1X5WA 5KL4A 2LUQA 2DSYA 2EMAA 2GHFA 2JWOA 3IWCA 2CPNA 4M2ZA 4F9BB 1XMQE 2V89A 2EQ1A 5FLXC 1X6FA 1N32E 4B3RE 3OTOE 2YTJA 2DLKA 2JOXA 2DB2A 1WJPA 2YRMA 2E1MA 2ENCA 2N8XA 4JI3E 1L4SA 2EPUA
chains in the Genus database with same CATH topology
3DJWA 4J8ZA 4JI7E 3ADIA 3HQ1A 4NXNE 5IWAE 1FJGE 2YZTA 1XMOE 1IBME 2VQEE 1STUA 2M4IA 4JV5E 2KONA 2UUCE 3ADGA 1DQ3A 2EWLA 4K0KE 4NXME 3OMLA 1X49A 1X47A 3VYYA 1EKZA 1ZBQA 4DR4E 1WXRA 5AASA 2MDRA 4LF6E 2L2MA 4DV6E 4DV2E 2L33A 2V85A 2VQFE 2M1SA 3ADJA 2V88A 3J7Yp 5ADZA 4LFAE 2UU9E 4LF4E 3HPZA 4DV4E 3F6HA 3IWDA 3DF6A 4BMJA 3FIGA 2JOBA 2V8QB 4M0VA 4B3SE 2LTSA 1UILA 4DV5E 1FKAE 1T4LB 1XNQE 3ZOQB 4DR6E 2RS7A 4M30A 4DUYE 4BBYA 4I8OA 2KHXA 1T4OA 4BC7A 5LMNE 3T1YE 4WPYA 3MSWA 2LJHA 1IBKE 2RTXA 2LTRA 4DR1E 4JYAE 5LL6R 4BCAA 4F54A 2RSMA 3LLHA 4R8OA 2LMZA 2FGGA 2V86A 3T1HE 4JI0E 4DV1E 4DR5E 2B3TB 2NUGA 4R03A 4WYQB 1GZ6A 2JR1A 4X65E 4DR3E 2VF1A 2LRSA 4YHHE 2HHHE 3F6GA 2L3JA 1O0WA 3IWBA 2L6MA 4DMIA 2NUEA 1QU6A 1J5EE 2MC5A 3C4TA 2KOUA 2LE2A 4DR7E 4BS9A 2K4VA 2L2KB 4DR2E 4GEQB 3HXLA 1X48A 4X8WA 5BR8E 3LMLA 3VK6A 2L92A 1XNRE 2UUBE 2H36X 2E5LE 2UXBE 3HPSA 1J26A 4KHPE 4JI4E 4DV0E 5DNYA 4X62E 4LF5E 1HNXE 4GKJE 1YYOA 5IT9C 3K6QA 5LMUE 2EZ6A 3AV0A 4LF9E 2UXCE 4Q28A 4F9CB 4JI1E 1N33E 2JY9A 2B7TA 4LTYA 4P7DA 3H09A 4LU9A 4F9AB 4JI8E 4LFBE 2ODRD 4BC9A 2RS6A 2N3GA 1WHNA 2L3CA 4B3ME 3HTXA 2UUAE 3VYXA 4X66E 1I94E 4JI2E 2YT4A 4L8NA 5T6JA 4KZSA 1YYKA 1UHZA 3RMPA 1YYWA 1WHQA 2DIXA 4DUZE 4WSPA 5AE2A 2JVAA 2NA2A 2ODRC 5AE1A 5F3WA 3J7AG 1HNWE 1N34E 1HNZE 2F8BA 4X64E 3KWRA 4GKKE 2NUFA 3AUZA 3ADLA 4P78A 2F4VE 1N36E 2LUQA 1HR0E 4DKKA 2V87A 4WFTA 5AE3A 1SR9A 2B9DA 2DSYA 3C4BA 3J81C 4TUIA 2ZM6E 2JWOA 2N3HA 2UXDE 3IWCA 2LBSB 2M7QA 2CPNA 4M2ZA 1T4NA 4F9BB 2WZOA 4OOGC 5CFFE 4DV3E 1XMQE 4JI6E 2MC6A 2V89A 2FV4B 2L2NA 1RC7A 4LF8E 5FLXC 1GQEA 4B3TE 3JU0A 1N32E 4B3RE 3OTOE 3J80C 3JAMC 1DI2A 1PKPA 1YZ9A 4LFCE 2JOXA 2VE7C 1ZBTA 2IHR1 4DV7E 5A2QC 2L8TA 2DB2A 4LF7E 2E1MA 2FTXB 1RQ0A 2DMYA 4TUGA 4JI5E 2B7VA 4YY3E 2V83A 2LUPB 4OX9E 2G7HA 1IBLE 4AQYE 3P1XA 4JI3E 4L5NC 3JTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI7 E;  3ADI A;  4NXN E;  5IWA E;  1FJG E;  1XMO E;  1IBM E;  2VQE E;  1STU A;  4JV5 E;  2UUC E;  3ADG A;  4K0K E;  4NXM E;  3VYY A;  1X49 A;  1X47 A;  1EKZ A;  4DR4 E;  2MDR A;  4LF6 E;  2L2M A;  4DV6 E;  4DV2 E;  2L33 A;  2VQF E;  3ADJ A;  4LFA E;  3J7Y p;  2UU9 E;  4LF4 E;  4DV4 E;  4B3S E;  1XNQ E;  2LTS A;  1UIL A;  4DV5 E;  1FKA E;  1T4L B;  4DR6 E;  2RS7 A;  4M30 A;  4DUY E;  5LMN E;  2KHX A;  1T4O A;  3T1Y E;  2LJH A;  1IBK E;  2RTX A;  2LTR A;  4DR1 E;  2RSM A;  3LLH A;  3T1H E;  4JI0 E;  4DV1 E;  4DR5 E;  2B3T B;  2NUG A;  4WYQ B;  4X65 E;  4DR3 E;  2LRS A;  4YHH E;  2HHH E;  2L3J A;  1O0W A;  2NUE A;  1QU6 A;  1J5E E;  3C4T A;  4DR7 E;  2L2K B;  4DR2 E;  1X48 A;  4X8W A;  5BR8 E;  1XNR E;  2UUB E;  2E5L E;  2UXB E;  1J26 A;  4KHP E;  4JI4 E;  4X62 E;  4LF5 E;  1HNX E;  4GKJ E;  1YYO A;  5LMU E;  2EZ6 A;  2UXC E;  4LF9 E;  4JI1 E;  1N33 E;  2JY9 A;  2B7T A;  4JI8 E;  4LFB E;  2RS6 A;  2N3G A;  1WHN A;  2L3C A;  4B3M E;  3HTX A;  2UUA E;  3VYX A;  4X66 E;  1I94 E;  4JI2 E;  2YT4 A;  1YYK A;  1UHZ A;  1YYW A;  1WHQ A;  2DIX A;  4DUZ E;  2JVA A;  2NA2 A;  1HNW E;  1N34 E;  1HNZ E;  4X64 E;  4GKK E;  2NUF A;  3ADL A;  2F4V E;  1N36 E;  2LUQ A;  1HR0 E;  4DKK A;  4WFT A;  3C4B A;  2ZM6 E;  2N3H A;  2UXD E;  2LBS B;  2CPN A;  4M2Z A;  1T4N A;  5CFF E;  4DV3 E;  4OOG C;  4JI6 E;  1XMQ E;  2L2N A;  4LF8 E;  1RC7 A;  4B3T E;  1GQE A;  1N32 E;  4B3R E;  3OTO E;  1DI2 A;  1PKP A;  1YZ9 A;  4LFC E;  1ZBT A;  2IHR 1;  4DV7 E;  4LF7 E;  2DB2 A;  1RQ0 A;  2DMY A;  4JI5 E;  4JYA E;  2B7V A;  4YY3 E;  2LUP B;  4OX9 E;  1IBL E;  4AQY E;  3P1X A;  4JI3 E;  4DV0 E; 
#chains in the Genus database with same CATH topology
 3DJW A;  3ADI A;  1IQO A;  1QNT A;  2EQ3 A;  3HQ1 A;  1XMO E;  2VQE E;  2LVH A;  2EM7 A;  2KON A;  2HC5 A;  3ADG A;  1EKZ A;  1X49 A;  2HGH A;  2CT1 A;  1G2D C;  5AAS A;  1T39 A;  2MDR A;  2J7J A;  2Q8U A;  1X6H A;  2BB8 A;  5ADZ A;  3J7Y p;  4R2Q A;  3HPZ A;  4DV4 E;  3BF2 A;  3FIG A;  1XNQ E;  1UIL A;  4WSG A;  2CSH A;  3ZOQ B;  4DR6 E;  2RS7 A;  5KL7 A;  4WPY A;  2YU8 A;  2LJH A;  4M9V C;  5A69 A;  2D9H A;  4DR1 E;  4F54 A;  2LMZ A;  2LT7 A;  4DV1 E;  1RMD A;  1UBD C;  4DR3 E;  1PJT A;  1MGT A;  4BHC A;  5KL3 A;  1O0W A;  3IWB A;  4R2D A;  1G2F C;  2NUE A;  1QU6 A;  2KOU A;  4BS9 A;  5A6A A;  3VK6 A;  1UN6 B;  4FK5 C;  2EMY A;  5DNY A;  4GKJ E;  1A1F A;  1AAY A;  3K6Q A;  2UXC E;  2EM6 A;  2EZ6 A;  2EM2 A;  4JI1 E;  4R2S A;  1N33 E;  4P7D A;  4O43 A;  2YU5 A;  2LCE A;  1JK1 A;  1WHN A;  2E72 A;  4R2R A;  2YT4 A;  4KZS A;  1YYK A;  1UHZ A;  3RMP A;  2EPL X;  5AE2 A;  4NZV A;  2EN4 A;  2JVA A;  5F3W A;  1HNZ E;  2I9I A;  1PJS A;  1HR0 E;  2V87 A;  4ZYD A;  1SR9 A;  2B9D A;  1N3G A;  3L00 A;  2ZM6 E;  2WZO A;  2FV4 B;  4B3T E;  2GLI A;  4N4R B;  2EMG A;  2NAB A;  1EH8 A;  1PKP A;  2K7I A;  5AC5 A;  1BB8 A;  1ZBT A;  1GTK A;  4DV7 E;  1LLM C;  1X6E A;  2ADR A;  4LF7 E;  2FTX B;  4ZYH A;  1YFH A;  1T38 A;  1EH6 A;  4TUG A;  4JYA E;  4YY3 E;  5A6J A;  5KL2 A;  2WBS A;  1F2I G;  4DV0 E;  3JTZ A;  3C6M A;  4J8Z A;  1ZR9 A;  3EPK A;  5TSE A;  5IWA E;  1NCS A;  2YZT A;  4NHR A;  2EPX A;  1YUJ A;  4K0K E;  1ZBQ A;  1WXR A;  2EE8 A;  2L2M A;  2EL6 A;  1JK2 A;  4DV6 E;  4DV2 E;  2V85 A;  2M1S A;  3ADJ A;  1ZAA C;  4LFA E;  2YPN A;  3IWD A;  2YSP A;  2JOB A;  2V8Q B;  4R2P A;  2LTS A;  1FKA E;  1A1J A;  2EN2 A;  4I8O A;  1T4O A;  5LMN E;  1A1G A;  1A1L A;  2YTE A;  3MSW A;  3LLH A;  1TN9 A;  2EOY A;  2FGG A;  4JI0 E;  2EN6 A;  3MHH C;  4R03 A;  1GZ6 A;  2JR1 A;  2EM3 A;  2EPK X;  1BBG A;  2L3J A;  3KZZ A;  2YTO A;  1J5E E;  2MC5 A;  4DR7 E;  3VHT B;  5A6B D;  1X48 A;  2EPN A;  3EQ1 A;  2H36 X;  2JPA A;  2UXB E;  2EP3 A;  1Z1B A;  2YRK A;  4F2J C;  1YYO A;  2EPO A;  2PRT A;  4LF9 E;  4Q28 A;  4F9C B;  3BGH A;  5IV8 B;  4ZYE A;  4LTY A;  2ELY A;  2EPP A;  4F9A B;  2EJ4 A;  2YWQ A;  1IQS A;  2RS6 A;  2N3G A;  2UUA E;  4F6M A;  3VYX A;  1I94 E;  2BBG A;  2RSI A;  5T6J A;  1IMU A;  2EOF A;  4DUZ E;  2LV2 A;  4WX9 A;  2EOZ A;  2EMF A;  3QG5 C;  4X64 E;  1DGC A;  2NUF A;  3ADL A;  4DKK A;  1PDA A;  4WFT A;  3THO B;  5AE3 A;  2EMH A;  3C4B A;  4F6N A;  5A6B A;  2UXD E;  2CTD A;  2LBS B;  2M7Q A;  2EML A;  1T4N A;  5CFF E;  4OOG C;  4JI6 E;  1KYQ A;  2EL5 A;  2MC6 A;  2L2N A;  2MKD A;  1GQE A;  1X3C A;  2HJJ A;  1YZ9 A;  4LFC E;  2JP9 A;  2R1F A;  2EOI A;  4JI5 E;  2DMI A;  2B7V A;  2LUP B;  2V83 A;  4OX9 E;  2G7H A;  2EL4 A;  1IBL E;  4JI7 E;  4IS1 C;  2YTQ A;  1IBM E;  4RH8 A;  1STU A;  1YSA C;  4JV5 E;  2EMC A;  5AC4 A;  2EOQ A;  3ECR A;  4DR4 E;  2EPZ A;  4R2E A;  4IJD A;  2EPA A;  2EPR A;  1ZU1 A;  2EM4 A;  2EOR A;  1PJQ A;  2MDG A;  4LF4 E;  4B3S E;  3F6H A;  4BMJ A;  3EPH A;  4DV5 E;  1T4L B;  2YTF A;  3BBG A;  2WBT A;  4WXD A;  2DGC A;  4R2C A;  3T1Y E;  5IXM B;  1TF6 A;  2I13 A;  2RTX A;  2LTR A;  3KZY A;  5LL6 R;  2RSM A;  4R8O A;  2WBU A;  2V86 A;  4DR5 E;  2B3T B;  2NUG A;  2EOH A;  4GZN C;  2EOJ A;  2LRS A;  2HHH E;  3F6G A;  1A1H A;  4DMI A;  2EPM X;  2WCC 3;  2LO3 A;  2LE2 A;  2K4V A;  4DR2 E;  1AH5 A;  3HXL A;  4X8W A;  5BR8 E;  2L92 A;  1XNR E;  2UUB E;  2YTD A;  2E5L E;  2EMX A;  1TF3 A;  1J26 A;  4JI4 E;  4LF5 E;  2DRP A;  4BHB A;  5IT9 C;  5LMU E;  3M99 B;  2EPC A;  4HTG A;  4ZYG A;  2ENH A;  5KL5 A;  4LFB E;  2ODR D;  4BC9 A;  4B3M E;  2EMI A;  3HTX A;  1SFE A;  2MKN A;  2EQ0 A;  2YTI A;  5AE1 A;  1HNW E;  3TQM A;  2F8B A;  2EOS A;  4GKK E;  1WRJ A;  2JYA A;  4KWY A;  4P78 A;  2F4V E;  1N36 E;  4MLQ A;  3J81 C;  4TUI A;  2N3H A;  1NEI A;  2ENA A;  2ELZ A;  4DV3 E;  2EM9 A;  2EMK A;  2EMZ A;  3EPJ A;  4LF8 E;  1RC7 A;  2R76 A;  3JU0 A;  3J80 C;  3JAM C;  1DI2 A;  2VE7 C;  5LLQ A;  2IHR 1;  5A2Q C;  1KJK A;  2L8T A;  2EOX A;  2VRD A;  2YTP A;  4HEI A;  1RQ0 A;  4O24 A;  2DMY A;  3BID A;  4AQY E;  3P1X A;  4Q35 B;  4L5N C;  2JXP A;  2EOE A;  2LJU A;  4NXN E;  5A6K A;  1FJG E;  2M4I A;  2UUC E;  1DQ3 A;  3EPL A;  2EWL A;  4NXM E;  3OML A;  3VYY A;  1X47 A;  1P47 A;  3C6K A;  1BBO A;  4LF6 E;  2EM0 A;  2L33 A;  2VQF E;  2V88 A;  2UU9 E;  4R2A A;  3DF6 A;  2EM8 A;  1EH7 A;  4M0V A;  2GPI A;  4M30 A;  4DUY E;  4BBY A;  1A1I A;  2KHX A;  4BC7 A;  1IBK E;  4BCA A;  4MLV A;  3T1H E;  1B69 A;  2EMB A;  4WYQ B;  4X65 E;  2VF1 A;  4YHH E;  2RPC A;  2YSO A;  2L6M A;  3C4T A;  2EMW A;  2EOO A;  2L2K B;  4GEQ B;  3MHS C;  5KL6 A;  3THN A;  3LML A;  4X9J A;  4O5G A;  2YRH A;  2YTG A;  3HPS A;  4KHP E;  2EN7 A;  4X62 E;  1HNX E;  1MEY C;  2A25 A;  3AV0 A;  1YPN A;  2JY9 A;  2B7T A;  1YUI A;  2EM5 A;  3H09 A;  4LU9 A;  4WXC A;  2M9A A;  4JI8 E;  1A1K A;  2EN1 A;  2EOM A;  2L3C A;  2EN8 A;  2DLQ A;  2EN3 A;  4X66 E;  4JI2 E;  4L8N A;  1YYW A;  1WHQ A;  4O4K A;  2DIX A;  2RQL A;  4WSP A;  2ODR C;  2NA2 A;  4RHB B;  3J7A G;  1N34 E;  3UK3 C;  2YTN A;  3KWR A;  3AUZ A;  1X5W A;  5KL4 A;  2LUQ A;  2DSY A;  2EMA A;  2GHF A;  2JWO A;  3IWC A;  2CPN A;  4M2Z A;  4F9B B;  1XMQ E;  2V89 A;  2EQ1 A;  5FLX C;  1X6F A;  1N32 E;  4B3R E;  3OTO E;  2YTJ A;  2DLK A;  2JOX A;  2DB2 A;  1WJP A;  2YRM A;  2E1M A;  2ENC A;  2N8X A;  4JI3 E;  1L4S A;  2EPU A; 
#chains in the Genus database with same CATH homology
 3DJW A;  4J8Z A;  4JI7 E;  3ADI A;  3HQ1 A;  4NXN E;  5IWA E;  1FJG E;  2YZT A;  1XMO E;  1IBM E;  2VQE E;  1STU A;  2M4I A;  4JV5 E;  2KON A;  2UUC E;  3ADG A;  1DQ3 A;  2EWL A;  4K0K E;  4NXM E;  3OML A;  1X49 A;  1X47 A;  3VYY A;  1EKZ A;  1ZBQ A;  4DR4 E;  1WXR A;  5AAS A;  2MDR A;  4LF6 E;  2L2M A;  4DV6 E;  4DV2 E;  2L33 A;  2V85 A;  2VQF E;  2M1S A;  3ADJ A;  2V88 A;  3J7Y p;  5ADZ A;  4LFA E;  2UU9 E;  4LF4 E;  3HPZ A;  4DV4 E;  3F6H A;  3IWD A;  3DF6 A;  4BMJ A;  3FIG A;  2JOB A;  2V8Q B;  4M0V A;  4B3S E;  2LTS A;  1UIL A;  4DV5 E;  1FKA E;  1T4L B;  1XNQ E;  3ZOQ B;  4DR6 E;  2RS7 A;  4M30 A;  4DUY E;  4BBY A;  4I8O A;  2KHX A;  1T4O A;  4BC7 A;  5LMN E;  3T1Y E;  4WPY A;  3MSW A;  2LJH A;  1IBK E;  2RTX A;  2LTR A;  4DR1 E;  4JYA E;  5LL6 R;  4BCA A;  4F54 A;  2RSM A;  3LLH A;  4R8O A;  2LMZ A;  2FGG A;  2V86 A;  3T1H E;  4JI0 E;  4DV1 E;  4DR5 E;  2B3T B;  2NUG A;  4R03 A;  4WYQ B;  1GZ6 A;  2JR1 A;  4X65 E;  4DR3 E;  2VF1 A;  2LRS A;  4YHH E;  2HHH E;  3F6G A;  2L3J A;  1O0W A;  3IWB A;  2L6M A;  4DMI A;  2NUE A;  1QU6 A;  1J5E E;  2MC5 A;  3C4T A;  2KOU A;  2LE2 A;  4DR7 E;  4BS9 A;  2K4V A;  2L2K B;  4DR2 E;  4GEQ B;  3HXL A;  1X48 A;  4X8W A;  5BR8 E;  3LML A;  3VK6 A;  2L92 A;  1XNR E;  2UUB E;  2H36 X;  2E5L E;  2UXB E;  3HPS A;  1J26 A;  4KHP E;  4JI4 E;  4DV0 E;  5DNY A;  4X62 E;  4LF5 E;  1HNX E;  4GKJ E;  1YYO A;  5IT9 C;  3K6Q A;  5LMU E;  2EZ6 A;  3AV0 A;  4LF9 E;  2UXC E;  4Q28 A;  4F9C B;  4JI1 E;  1N33 E;  2JY9 A;  2B7T A;  4LTY A;  4P7D A;  3H09 A;  4LU9 A;  4F9A B;  4JI8 E;  4LFB E;  2ODR D;  4BC9 A;  2RS6 A;  2N3G A;  1WHN A;  2L3C A;  4B3M E;  3HTX A;  2UUA E;  3VYX A;  4X66 E;  1I94 E;  4JI2 E;  2YT4 A;  4L8N A;  5T6J A;  4KZS A;  1YYK A;  1UHZ A;  3RMP A;  1YYW A;  1WHQ A;  2DIX A;  4DUZ E;  4WSP A;  5AE2 A;  2JVA A;  2NA2 A;  2ODR C;  5AE1 A;  5F3W A;  3J7A G;  1HNW E;  1N34 E;  1HNZ E;  2F8B A;  4X64 E;  3KWR A;  4GKK E;  2NUF A;  3AUZ A;  3ADL A;  4P78 A;  2F4V E;  1N36 E;  2LUQ A;  1HR0 E;  4DKK A;  2V87 A;  4WFT A;  5AE3 A;  1SR9 A;  2B9D A;  2DSY A;  3C4B A;  3J81 C;  4TUI A;  2ZM6 E;  2JWO A;  2N3H A;  2UXD E;  3IWC A;  2LBS B;  2M7Q A;  2CPN A;  4M2Z A;  1T4N A;  4F9B B;  2WZO A;  4OOG C;  5CFF E;  4DV3 E;  1XMQ E;  4JI6 E;  2MC6 A;  2V89 A;  2FV4 B;  2L2N A;  1RC7 A;  4LF8 E;  5FLX C;  1GQE A;  4B3T E;  3JU0 A;  1N32 E;  4B3R E;  3OTO E;  3J80 C;  3JAM C;  1DI2 A;  1PKP A;  1YZ9 A;  4LFC E;  2JOX A;  2VE7 C;  1ZBT A;  2IHR 1;  4DV7 E;  5A2Q C;  2L8T A;  2DB2 A;  4LF7 E;  2E1M A;  2FTX B;  1RQ0 A;  2DMY A;  4TUG A;  4JI5 E;  2B7V A;  4YY3 E;  2V83 A;  2LUP B;  4OX9 E;  2G7H A;  1IBL E;  4AQY E;  3P1X A;  4JI3 E;  4L5N C;  3JTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...