3KZYA

Crystal structure of snap-tag
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
176
structure length
162
Chain Sequence
DCEMKRTTLDSPLGKLELSGCEQGLHEIIFLGAAVLGGPEPLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYSHLAALAGNPAATAAVKTALSGNPVPILIPCHRVVQGDLDVGGYEGGLAVKEWLLAHEGHRLGKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SNAP-tag
publication title SNAP-tag structure
rcsb
source organism Homo sapiens
total genus 47
structure length 162
sequence length 176
chains with identical sequence B
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2009-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3kzyA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 3kzyA01
4YIFA 3HOSA 1I1SA 1W5SA 2IPQX 4BNCA 1LVAA 3I4PA 2ZMEB 1TW2A 3M1EA 1IRFA 4KIGA 3DKWA 4L9NA 5D4SA 2PFBA 5J8CA 1ZLJA 2HTJA 2UXNA 4FX0A 1J75A 2XKOA 1Z1DA 3HHHA 1OYWA 2XAJA 2O61A 5LRRA 4G7ZF 1Q1HA 4L9TA 2V1DA 2VOPA 3BJAA 3SZPA 1PP8F 3FHZA 3FMQA 3GFJA 2F5EA 4GXOA 1KGSA 2F2EA 3CO7C 3RI4A 3TO6A 3R4KA 4HLYA 4M73A 4ENMA 4EQQA 2M45A 1F1ZA 3F6OA 4A0ZA 1ON2A 1XSDA 1B9NA 2ELHA 2KIMA 4KFCA 3JAMZ 1BI3A 2XIGA 3FWEA 5D5WB 1IN8A 1YQAA 4LJZF 3ZQ7A 3VB2A 2CQKA 2F5FA 2PMUA 4BQAA 3C1DA 3E6MA 2A3SA 1PDNC 2X4HA 4CGZA 3HSFA 2PN6A 1TW3A 3JW4A 1U3EM 1I27A 2RGVA 1FSHA 3GEZA 2AXLA 3H3UA 1IW7F 3GO5A 2E7WA 5JVTA 4UXNA 2UZKA 4HX7A 3ZPLA 3KP7A 4H0EA 1IXCA 4HX4A 2VE8A 4MHGA 1TTYA 5JHUA 4M74A 2Z99A 5EEHA 3SQNA 3G73A 1JXSA 4G7HF 2BV6A 4GGGA 3L2CA 4M71A 5HLGA 5J8FA 1J9IA 5H6QA 3F21A 1FSEA 1UHMA 4Q47A 4KN7X 3EDPA 2NAZA 5CVIA 1XN7A 3VOEA 1HW5A 3RKWA 3F72A 4KDPA 5BMZA 5FLXZ 2BGCA 4G6DA 1DPUA 3BJOA 2EB7A 1BI2A 3U2RA 2CWEA 2CO5A 1TBXA 4ZYDA 4KA4A 3TDZC 1O3QA 1U8RA 2Q0OA 2B0LA 5HDKA 4HF1A 2Z9OA 1LDDA 1W7PB 3R0JA 3Q9VA 3BPVA 1P4AA 1WI9A 1YW9A 4L9VA 2ZFWA 2WC2A 1B1BA 3F8FA 2VOOA 2M5WA 2NS0A 3GLXA 4A12A 2XAFA 3O2PE 4O6JA 3T8RA 2VT2A 3QP6A 1D8JA 2HOEA 2QQBA 2HGCA 4EGYA 3D5LA 4GCVA 2J5OA 3TO9A 1VTNC 2K86A 2XAHA 4A5MA 3FX3A 1S7OA 1FBUA 3ML6A 2W24A 4Y13A 5HLIA 1FBSA 5D6EA 3NRVA 5CVUA 5L3BA 2FE3A 4M72A 4HDVA 2DU9A 2WV0A 3E5XA 4ZYEA 3ZN1A 3V8JA 5L3DA 3RJPA 1G3SA 4KN4X 4WWCA 3WTWC 2QWWA 4WK8F 1O7FA 3QAHA 3TKYA 3PFIA 1MDMA 1WWXA 4LLLA 2FOKA 3J80K 3KEOA 3F23A 1YW7A 1TQMA 1ZRDA 1FZPB 3TGNA 2BYVE 3CUQB 4IF4A 4Y15A 3J81Z 4WXCA 2RKHA 3HRSA 4A5NA 4U0WA 3ABTA 3WE2A 1G3TA 5FO5A 2QUFA 2QYOA 3ZN0A 1USSA 1ZREA 4NHJA 2OD5A 1J2XA 1SAXA 2LF7A 3I59B 4I7HA 3QU3A 4RAYA 3IL2A 4EM1A 3FM3A 5LLQA 3KLNA 5D8LB 1YLFA 4ZZDA 1IF1A 4OINF 1HSTA 2MLGA 2FF4A 3EYYA 1OYIA 1K79A 1OKRA 5E18F 3FXUA 5HDNA 1XCVA 3T0YA 1LEAA 1MZBA 1IN4A 1ONVA 1SFEA 3V8LA 4HYEA 2Y48A 3KP4A 2HWVA 3TQNA 4G6QA 1MD0A 4B09A 3BY6A 1FBQA 2MBFA 1R7JA 2A61A 3RKXA 3DPTA 1XGSA 3WU1B 3L7WA 1ZHFA 1SFUA 1K78B 3DXJF 5DUIA 5D6FA 2QENA 3U1DA 5K5OA 3KETA 1RUOA 1P92A 2ZMEA 3F6VA 2JPBA 3RTRA 1P4XA 5LGTA 4LG0B 3FMRA 4LFUA 5DYMA 1QZYA 4Q4ZF 1NHAA 4AIJA 3WG9A 2HDCA 4EVIA 4XLPF 1STZA 4ZYGA 3IWFA 3WTTC 3JTHA 3WODF 5K1YA 1A04A 4AWXB 4P9UA 1SMYF 3ELKA 4UVAA 4OU0A 1U5TB 4JQFA 2CW0F 3FM5A 2ETHA 3Q9SA 1KU9A 4L18B 4MNUA 2XVCA 1HBXG 3KP2A 1HKSA 2VBZA 3E97A 3ZMVA 1KU2A 4WF2A 5ERIA 2P7VB 1TQIA 2KRFA 3KCCA 5TJJA 3VODA 5DV5A 4HOBA 2L01A 5D8KB 3DF8A 1H9TA 4ENKA 2QLZA 5ICFA 3PQKA 4EJWA 2H94A 3QOPA 4PGGA 5BPDA 1S7AA 3V7RA 2QBYB 5E8GA 4S04A 1W5TA 1RIOH 4NB5A 4P5OA 2GA2A 2OU2A 2UXXA 3REOA 4EM0B 4PDKA 3QRFF 2K7LA 3IWZA 4IVNA 4O3MA 1D3YA 2W25A 4I09A 5CVJA 2IA1A 2P8TA 3COAC 3WTVC 2Q8KA 3T1BA 1R5HA 1KQ9A 4HV6A 5CYVA 2RC4A 5E1WA 2PQ8A 4WXHA 4ESBA 3NQOA 5FFZA 4IRGA 3M7GA 5BQTA 5A2QK 1ZYRF 2Z33A 2DAOA 3HUGA 5FFXA 3HOTA 4XLNF 1Z7UA 5FD6A 2A6EF 4XBFA 4LB6B 1IAWA 4A6EA 2QM3A 2G7UA 3I58A 4KIFA 2IA2A 1FLIA 4KUMA 2ESHA 3MFKA 1O3SA 2K27A 2ZJ2A 4YFKF 2EA2A 2EFQA 2P7CB 2ISYA 2JTVA 2KJCA 2P6SA 1MJBA 1HQCA 2D2WA 1YYVA 2Z5UA 4ASNA 1W7PA 4MTEA 2NRAC 2FNPA 3CUOA 2A5YB 5LEKA 4G9YA 1SD4A 2XAGA 4XRFA 4ON0A 3RDIA 1LQ1A 3L00A 3PQJA 4BYYA 3BOQA 5HS8A 1ZAOA 2EV6A 5DDGA 3MZHA 2OBPA 3SFZA 3ZMSA 4M6XA 3E6CC 2IA0A 1AOYA 5L3EA 3ZMZA 3AAFA 3WGHA 5D5UB 5LRSA 1TNTA 1R36A 2RV8A 3RYRA 5FLXK 3E5UA 3P7NA 1DDNA 2O8XA 4XSXF 1KYWA 3T8TA 1XMKA 1B59A 1HW2A 1PUEE 5DEQA 1KU7A 2GAUA 4RB2C 1I1GA 2FA5A 2HEOA 4I0AA 4RGSA 1H9GA 3QPHA 4IJAA 4LGWA 2AS5F 2FRHA 4OMYA 1RZ4A 4HBLA 4ESJA 1S6LA 3L9FA 3K69A 5KVRA 4F7ZA 5IT3A 3T5XA 3I54A 1KYZA 2IJLA 2JPCA 3RIRA 3JSOA 1L0OC 4AVPA 5CVRA 1R23A 4FT8A 4B8XA 2MD5A 4HX8A 5ICCA 3VEPA 1ULYA 3KEQA 2VN2A 3LAPA 3MQ0A 3ABUA 1XD7A 3CUQA 4UHTA 5ICGA 3KZZA 3V7CA 5E8IA 4IXAA 3CO6C 3BWGA 1IN5A 5ICEA 2E1NA 1IRGA 2DQRA 2MA3A 3LA3A 3WU0A 1ZH5A 4RB0A 3ECOA 4YIIA 1ZLKA 1S3JA 1J5YA 5LEJA 2VC1A 1BI1A 4GYGA 3JSPA 4FX4A 4N0BA 3K1MA 4YFXF 1R1VA 2VBYA 1D5VA 2VBXA 2QVOA 3LWFA 1U6GA 1S29A 3QU6A 1T2KA 2BE5F 1Y0UA 3BP8A 3N4MA 1E2XA 5ED4A 5DCMB 5BOXA 2ZKZA 3B73A 4IHSA 2JRTA 4U0YA 1TLHB 4BAYA 4RGUA 4G94A 4JK1X 2HFHA 2DW4A 1Z6RA 1YG2A 4CO8A 1XDUA 3ECHA 3FMSA 4CZZA 1USTA 4Y17A 1TQPA 1B4AA 2A68F 2DFIA 1SD7A 5HOOA 1XMAA 1BJAA 3C3WA 1K78A 2KKOA 1WRJA 2DPDA 2LNBA 4NQWA 4AD9A 5IT9K 5E20A 2LKPA 1DPRA 2H6BA 4IRHA 3K1NA 1I6XA 2EV0A 4RB1A 4FHTA 3KE2A 4EV0A 4AIHA 3R61A 2R7FA 1UCRA 4IRIA 4QWQA 1RI7A 2DO7A 1T0FA 3VFZA 3RYPA 1GVJA 3BDDA 1U5TA 3TDUC 3CDHA 4DNCA 3KLOA 4I2OA 3K0LA 1Z9CA 4ZH4F 2ESNA 4I98B 4L0ZB 2H09A 2HQRA 4HA8A 5D5XB 4AIKA 3LQQA 4TV7A 3U9GA 2ISZA 1FPQA 5E1ZB 4ZZLA 1QZZA 4KICA 4P96A 3BZ6A 1AWCA 4EJUA 3WE3A 2J5PA 2OAZA 4U88A 2C6YA 3FF5A 1OYYA 4XSZF 3SHFA 1YW8A 2QBYA 2GZWA 5HS7A 2ZNZA 2RVCA 3KP6A 4ESFA 2CG4A 1LNWA 4M9SA 1Z6TA 2E7XA 4BHBA 2IVMA 2W57A 2CGPA 4R1HA 3WGIA 3E6BA 1ZG1A 4JBAA 4Z2YA 3F3XA 1RUNA 2HS5A 1JHHA 4L5JA 1J59A 4MGRA 2PMHA 3GWZA 2F5DA 2FEZA 4PCQA 2TDXA 2STWA 4RGRA 1K6OA 2PBIA 4KYWA 4G7OF 1IZ1A 1S8NA 2OQRA 2ZXJA 3FXRA 5HLHA 3FXQA 1PP7U 1WSUA 2RQPA 1IN6A 4CXFA 1LEBA 2DLLA 3IRRA 4ETSA 4L0YB 1P6RA 4LK0F 2KIFA 5E1XA 2EA4A 3J80Z 4R79A 1HW1A 2NNNA 3FZVA 2P5KA 2DBBA 4A0XA 1FYMA 2VODA 5ILVA 3QPTA 3IKTA 2EFNA 4I0BA 3WTUC 1G3WA 2HKOA 2PI0A 2YX4A 1G6NA 1R22A 5HDGA 2HKXA 1QNTA 3CJNA 3P9KA 4RAZA 1O7LA 2E1CA 1LDJA 2V6CA 5BS6A 2PJPA 2F5CA 2VXZA 2FU4A 1D8KA 2A6HF 2IRFG 1K7AA 3E6DA 3DQVC 4OIQF 4IPAA 2O3FA 3DPLC 1MDMB 1XGMA 4E70A 2EWNA 2HTSA 2ACJA 2KIUA 3MCZA 3EQLF 2HR3A 3O6BB 3DFGA 1TNSA 2ZNYA 1CGPA 1ZARA 4HLXA 4HV5A 5FGMA 4N9IA 1QPMA 2OQGA 1FYLA 4M6YA 4KMFA 2RDPA 5AIPA 1B6AA 1OPCA 2QQAA 2K02A 4U7DA 5DD4A 3B02A 1W4MA 2FXAA 5FD5A 4ZYHA 2FBHA 4OIPF 5F1RA 2PEXA 3O3KA 2VBWA 1BOAA 3K2ZA 1YO5C 1MJAA 3E3VA 1V4RA 3D0SA 3WGGA 1JE8A 4I01A 2XAQA 1WQ2A 1IXRC 3LFKA 1EV7A 3JAMK 3W6KB 3LQRA 3HRTA 1T98A 5ILSA 2RN7A 4N9HA 4KNYA 1SD5A 1T6SA 2K4BA 3J7AO 1IN7A 4UVBA 2L3DA 3HRMA 1IUYA 2IT0A 2PLYA 3LSTA 3GVAA 3HRUA 4MEYF 1FYKA 4LB5A 4U7BA 2HYFA 1RNLA 3IRQA 1BI0A 3DV8A 3WTSC 4UV9A 2Y0MA 2DI3A 3H92A 2VONA 1FP1D 3ROUA 3NEUA 2D1HA 2DTRA 4HDUA 1YS7A 2VE9A 4Q48A 1HKTA 3M8FA 3GFIA 3KFWX 2D45A 3ZMTA 2BBYA 3P9IA 5DCMA 1ZG3A 2Q2EA 3QP5A 4PGHA 4GO1A 2YX7A 3WTYC 4A2UA 4I02A 4IHTA 4MTDA 5TRDA 1QBJA 3R60A 2MH2A 1CF7B 1W7PD 3F22A 2NYXA 3BPXA 1F5TA 1ZG5A 2DK5A 5CJ9A 3JTGA 3GXOA 3S2WA 5KK1A 5A2QZ 1GXPA 1J7KA 2LDUA 1QGPA 1REPC 3GZ5A 4L5IA 1U5TC 4KMUX 2FMYA 2XRNA 5D5VB 3V7SA 2LSOA 1EH6A 2DK8A 2GWRA 2P4WA 4U0VA 1O3TA 2OZ6A 1UHWA 2CYYA 3ZP5A 4EJVA 3K1PA 5J6XA 3RPUA 5LHGA 3ZMUA 1EH7A 3MEXA 1O57A 2XROA 5F6FA 3M8EA 3OV8A 5EEGA 2R3SA 1DP7P 3GUDA 5LGNA 3KP3A 5L3FA 3K9TA 3P9CA 1B9MA 2EFPA 4BHCA 1XGOA 4RS8A 1WKMA 5CVVA 1FP2A 2GXGA 4EMSA 5FB2A 3TO7A 3F8NA 3GFMA 3L09A 1QQIA 2G7HA 3SZTA 1G4DA 1ZRFA 1X3UA 1MJ9A 2NNYA 4MQ9F 3I59A 1GXQA 3MAJA 5LHIA 3SXYA 1L3LA 2XHKA 3HSRA 1R5GA 3HYIA 4EJTA 2YR2A 2QQ9A 2LF8A 4BHPA 3OOPA 1UB9A 2W85A 1ODDA 5HS9A 4HQMA 3W6JB 1KA8A 1SD6A 1LDKB 1KU3A 3I5UA 3J81K 3WTZA 4HW0A 1XSXA 4WXDA 3RPQA 2VC0A 1P4WA 4K2EA 2VT3A 5H20A 3ZMDA 2L02A 3Q5FA 2FNAA 2A07F 3KZYA 1GHCA 4GYIA 2P6TA 3C7JA 1XDSA 4CYDA 2GXBA 1F4KA 1HXDA 2FBKA 2GIVA 2M1BA 4QLCU 2FSWA 4WCGA 2IP2A 5LGUA 5CLSA 3IC7A 3MWMA 2G9WA 3GF2A 1F9NA 4LG0A 1FX7A 1SFXA 2XUBA 4KT5C 3IHUA 1T38A 2EV5A 4MQVA 4UUVA 2XASA 2FBIA 4LLNA 2MLKA 3E5QA 1HSJA 4DQ2A 1XB4A 5K5QA 1YS6A 2V1XA 2XKPA 2DPUA 1R1UA 2D1VA 2R7DA 2O0YA 2JT1A 4CHUA 5H6RA 2V1UA 1R00A 3F8MA 1LJ9A 2Y75A 4OIOF 2P5VA 5L3GA 4HQEA 3HIFA 3I0TA 4LMYA 2STTA 3M9AA 3DP7A 2ADUA 4UVCA 2HYGD 4O5VA 1MGTA 2X0LA 1ZN2A 2YU3A 2L4AA 3EETA 5K5RA 1BC8C 1BBYA 2IW5A 1H0MA 6PAXA 1I5ZA 5E17F 2YPRA 1OR7A 3R0AA 3V4GA 2V9VA 4M9XA 2OZUA 1XCBA 4EM2A 1R1TA 2CSOA 4A6DA 1E17A 2O6GE 2DT5A 1FWZA 1J0RA 1KQ0A 2JZYA 4ENNA 2KJBA 3CLOA 3BROA 5HVQC 1ON1A 2COMA 1U2WA 3HTUA 1BIAA 2FQ3A 2MH9A 1JGSA 3R6SA 4WX9A 1G3YA 2ZCWA 2HQNA 2BEOA 5DCFA 4BH9A 5LHHA 5IT9Z 2GQQA 1BM9A 3N97A 2K4JA 4OOIA 4S05A 3GFLA 1O3RA 4D0PA 2EK5A 5AONA 3CTAA 3GX4X 3ERED 2FMLA 1T39A 3I53A 1Z91A 3WTXC 4LK1F 1YIOA 3V8KA 2V79A 4Q5SF 4HAMA 2XV4S 2YSRA 1C0WA 5JI6A 4L9JA 5F64A 1FT9A 4OIRF 2L54A 1EH8A 3EYIA 4YG2F 3I64A 2WTEA 1JHFA 2O03A 4G8XA 4RGXA 3LAJA 3C18A 5D4RA 4R8HA 2MC3A 3KP5A 2A69F 3MZYA 1OMIA 4YFNF 1ZGAA 2EJRA 2PG4A 5AIQA 2OA4A 3LA2A 2EFWA 3HSEA 2Z3YA 4RB3C 2ZO4A 4UV8A 4CDGA 4A0YA 5DUKA 5JR3A 1KQ8A 4PZJA 3HTSB 4UNOA 4P55A 2UWMA 1R58A 1XGNA 1U78A 1FY7A 5L3CA 5DD8A 1BN5A 1DUXC 2QZ8A 1QO0D 4LLGF 3F8CA 1BC7C 1V3FA 2M30A 1CF7A 2HZTA 1FNNA 4LD5A 3HHGA 3GYHX 2W84A 2L4MA 2M8EA 2DQLA 2WWYA 3GZ6A 4HF0A 3TOAA 1ZGJA 1UFMA 4OMZA 3RKYA 4EGZA 3ISPA 3GW2A 3I71A 1SMTA 4M9ZA 4BXUA 1FC3A 2H6CA 3F8BA 5BPIA 1HKQA 4KIBA 2P5LC 2JSCA 1Z05A 3CUQC 4MEXF 3IKVA 1LB2A 1P2FA 4ENJA 2CFXA 4HF2A 2GA1A 1XSVA 4EJOA 5ILUA 3DEUA 4HZFA 2M87A 3G3ZA 5LBQA 1FOKA 3H3ZA 2EFOA 3TOBA 1IXSB 2H27A 2XGXA 1ZRCA 1BIBA 3BJ6A 3LA7A 3EUHA 2ZBKA 4P9FA 1YTYA 1YFHA 1MKMA 2RNJA 3ULQB 4CICA 5JFRA
chains in the Genus database with same CATH superfamily
4YIFA 3HOSA 4BBSJ 1I1SA 5J1UA 1A31A 4UUSB 2QKMB 1MSFC 2EM2A 1MSEC 5HNHA 1W5SA 1ETVA 2CFOA 2IPQX 3OYCA 2GBYA 4M30A 2PRTA 2IGOA 4BNCA 3ZQLA 2VQFE 1LVAA 4ZDPA 2MD0A 2Y31A 5C44J 1QHHD 3G1OA 3I4PA 3OYLA 4BE1A 1CQTA 2ECBA 2ZMEB 2KT0A 1TW2A 4A3IJ 2YTNA 3M1EA 1HCRA 1IRFA 4KIGA 1T8IA 3GTQJ 1YUJA 3DKWA 4L9NA 5E3NA 5D4SA 2NVQJ 2PFBA 1I3QJ 5J8CA 4NXNE 1ZLJA 2HTJA 2UXNA 2X1CA 4FX0A 4ZYAA 3OSFA 1J75A 2LJUA 3M8JA 1LFPA 2RNGA 2IGKA 3VPRA 2XKOA 2LP0A 2MC6A 4B3AA 3MN2A 1I3AA 1Z1DA 3HHHA 1WGXA 1OYWA 3ZCOA 2XAJA 2O61A 3TP3A 5LRRA 4UB8C 2R7SA 4G7ZF 3OIOA 1WPKA 3KIOA 3HGYA 3HPHA 3WHCA 3CF5F 1E0EA 1Q1HA 4L9TA 2V9KA 2V1DA 2VOPA 3BJAA 1MMNA 3G71I 2E34A 3SZPA 1PP8F 3FHZA 1ZU1A 3FMQA 3CESA 3GFJA 4C30A 3SYTA 1AKHA 5T6JA 2F5EA 2CUJA 4GXOA 4AQYE 1KGSA 3FXOA 1T4LB 2I10A 3O8HA 2F2EA 2VUMJ 3CO7C 1SAUA 3RI4A 1APLC 2XDVA 3TO6A 2OF7A 3R4KA 4NC8A 1ETOA 1MBJA 4HLYA 4M73A 2BW3A 4FETA 3HOXJ 4ENMA 4A3KJ 4EQQA 2M45A 2Z2SB 5IYDJ 1F1ZA 2CS3A 1TWFJ 1XX5A 3F6OA 4A0ZA 1ON2A 1BBOA 1XSDA 1UG2A 3OMLA 1B9NA 2VQHA 3FXLA 2ELHA 2KIMA 2VIXA 4KFCA 3JAMZ 1BI3A 2VRDA 2XIGA 3B6AA 4HNTA 2L2KB 3OMYA 2Y69H 3FWEA 5D5WB 1IN8A 1YQAA 2JN6A 4LJZF 3ZQ7A 3VB2A 2FX0A 2EJ4A 3OR1C 2CQKA 2F5FA 2DOFA 2H36X 2PMUA 4BQAA 1N25A 1BBGA 4L8NA 1XMOE 4PK4A 1HDDC 3C1DA 3DF6A 2VKDA 5B5EC 4CCNA 3E6MA 2A3SA 1PDNC 2X4HA 4G12A 4CGZA 3HSFA 1IQOA 4K0KE 2PN6A 1TW3A 1VI0A 3JW4A 3A01A 2LV2A 3ABLH 4CYCA 3OY9A 2ZB9A 1U3EM 2K5CA 2OCCH 4WFTA 1I27A 2RGVA 5F1JA 4ZTJA 1FSHA 3GEZA 4O24A 4PFPA 1Z3XA 2AXLA 3H3UA 1IW7F 1YUIA 3VK6A 3GO5A 1FTTA 2E7WA 5JVTA 4UXNA 2UZKA 3JRHA 3HJEA 3CJTB 4DV1E 4HX7A 4JX5A 3ZPLA 2KLOA 2ICWG 3KP7A 4H0EA 3BTIA 1R49A 1IXCA 1YE9A 2E1MA 4DJAA 2BY3A 2L33A 4HX4A 2VE8A 1OR7C 4MHGA 3I3LA 1NEIA 1A36A 1N33E 3L2VA 1TTYA 1BB8A 3H0GJ 1UJ8A 2DDBA 4J19A 4LFCE 5JHUA 2JMWA 3G2BA 3H1CA 3CDLA 4M74A 3L2WA 1X4OA 2Z99A 5EEHA 3SQNA 3G73A 1JXSA 2LUPB 4X0GA 2UUBE 1YRNB 1ZR4A 1XPXA 1A1KA 4RA2A 4BQOA 4G7HF 4XR6A 3SZGA 3JRGA 2BV6A 2D5VA 2DFFA 2EM4A 1IRXA 4GGGA 3L2CA 4M71A 5HLGA 4HRIA 4II3A 5J8FA 1I6HJ 1F43A 1TWCJ 5H6QA 3F21A 3HUGB 2AQFA 1J9IA 1FSEA 1UHMA 1MMSA 1V5GA 4KN7X 4Q47A 5EEAA 3EDPA 2KISA 2NAZA 3GMEA 5CVIA 3ADLA 5K7FA 2XRLA 3GTGJ 1XN7A 3VOEA 1HW5A 3RKWA 3DEWA 1RC9A 1Y39A 2H1LA 3F72A 2Y9ZA 4FASD 4KDPA 5BMZA 5FLXZ 2BGCA 2EMZA 4G6DA 1DPUA 4LG3A 3BJOA 1GV5A 3Q0WA 2EB7A 1WCMJ 1BI2A 1X47A 2LKXA 3CJQB 1N36E 3U2RA 2K3PA 2MDGA 2CWEA 1ZQ3P 2CO5A 5M5WJ 1TBXA 1VNDA 4ZYDA 4KA4A 2L3JA 1P9QC 2ZSIB 1WJAA 3TDZC 1O3QA 1Z77A 4FISA 3FHNA 1U8RA 2B7VA 4XKVA 2Q0OA 1DQUA 2B0LA 4OX9E 5HDKA 2ADRA 3MVPA 4HF1A 2E72A 2VQEE 2R7VA 3GTLJ 2E36A 2Z9OA 1PJRA 4LFAE 2VKEA 3QWLA 1LDDA 4BQQA 1W7PB 1T08B 2TRTA 3WHBA 2V87A 3R0JA 3Q9VA 2Y0SA 3BPVA 3BQYA 4HSTA 1P4AA 1WI9A 2YU8A 3ONQA 1WJBA 1YW9A 4AYBN 1X1BA 4L9VA 1OCCH 2ZFWA 1NTCA 2WC2A 3SDGA 3TQMA 1B1BA 4A3DJ 3F8FA 2VOOA 1MIJA 2M5WA 4NDLA 2RTXA 4DW6A 5IOYA 2NS0A 3GLXA 2EPKX 4A12A 4XORA 1MNMC 2XAFA 3O2PE 2EN8A 4ZDOA 4V2GA 2Y2ZA 3DLAA 4O6JA 1TF6A 4OAZA 3T8RA 2VASA 1T33A 2VT2A 3BG6A 3S93A 3QP6A 1R9TJ 1D8JA 2HOEA 4BJTA 2QQBA 2HGCA 2VJ5A 2A25A 1R5ID 3H0DA 4Z6YA 4EGYA 4M3GA 3UK3C 3THNA 3D5LA 4GCVA 2F6CA 1X19A 2LBFA 4BE2A 2J5OA 3OYMA 3TO9A 1VTNC 4PFOA 4TUGA 2K86A 2VXDA 2XAHA 4A5MA 3FX3A 1S7OA 1E3HA 1FBUA 1X1CA 2O5RA 3ML6A 2ENAA 4R2RA 3OIPA 2R1FA 4ZDLA 3OYJA 2Y30A 4XKWA 1WJCA 2JK3A 3BT9A 2EM0A 3DJWA 2W24A 5EGOB 4Y13A 3GTKJ 1DP3A 5HLIA 2DB2A 2GPIA 1FBSA 5D6EA 3NRVA 1VQ8I 3MZ8A 5CVUA 2R93J 1JUMA 4DV5E 1E3PA 5L3BA 4XICA 2FE3A 2K9QA 2EOIA 5GADJ 4M72A 4MLOA 4DV2E 1HA8A 3BR5A 4HDVA 2DU9A 4MO7A 4EEFG 3IAS2 3LMMA 4B3RE 1YIJI 5A69A 2WB1N 2WV0A 1Z0XA 3E5XA 3LSPA 4ZYEA 4MLQA 5FKLA 4KHPE 3ZN1A 3K70D 2HXOA 3V8JA 5L3DA 3DWLE 3RJPA 4IO9F 2YZTA 5IYCJ 2DYSH 2AXTC 4E4HA 2LYCA 1VQ9I 4LF8E 2EPUA 1G3SA 2W00A 4KN4X 3D5RC 4WWCA 3WTWC 2QWWA 1O7FA 3QAHA 4WK8F 2EMXA 3TKYA 3PFIA 2UXCE 2TCTA 2EP3A 3S3MA 2WCC3 2EOQA 2M7AA 1MDMA 4F91B 1WWXA 4LLLA 2M4KA 2EPNA 2FOKA 3KEYA 3J80K 3KEOA 3F23A 1N3GA 2MGQA 1YW7A 1TQMA 5CQGA 1B8IB 1ZRDA 1FZPB 2HOAA 1K61A 3TGNA 2KRHA 2BYVE 1JGGA 2DMTA 3CUQB 4XKBA 2WY8Q 2ODRD 4IF4A 4Y15A 3J81Z 2DA6A 4WXCA 3ZQIA 3LSJA 1OCRH 4UB6C 2KFDA 3PNYA 4II2A 2RKHA 3HRSA 2RQQA 4DV3E 1BW5A 4DIQA 3ZQCA 4A5NA 3I4NJ 4U0WA 2R7RA 1PJQA 2HOTA 3I9V2 3ABTA 2EOYA 3WE2A 1G3TA 2DTZA 2L0KA 5FO5A 2YU9J 2QUFA 1A1JA 2QYOA 3ZN0A 1USSA 1ZREA 1QVTA 1U0JA 2GOMA 2OD5A 4RBOA 4NHJA 4PJNA 1J2XA 1TL8A 1SAXA 2EPPA 4X65E 4A3MJ 2LF7A 3I59B 4I7HA 3ZRGA 4Y7NJ 3C4BA 3QU3A 4P1WA 4RAYA 3IL2A 2R7XA 3CDIA 5IXMB 4EM1A 3FM3A 4RLFA 5LLQA 4B1RA 3KLNA 5D8LB 1YJWI 1YLFA 4JI2E 3VDXA 4ZTFA 1DI2A 2L2NA 2EM9A 2YT4A 5A6KA 3I55I 3M07A 5GPCA 4ZZDA 1IF1A 4OINF 4DZJA 1HSTA 2MLGA 2EMYA 4RM2A 1PUFB 2FF4A 3EYYA 3RQ4A 1OYIA 2CQQA 2KZVA 2LH9A 1K79A 1YSAC 1OKRA 5E18F 2JJ7A 2E71A 3GTOJ 3EUHC 4A3FJ 4ZJZA 4OAYA 3FXUA 2NS8A 5HDNA 3ZOQB 1XCVA 3SDBA 3T0YA 1VFCA 1LEAA 1MZBA 3CP2A 1IN4A 3H36A 1SFKA 1ONVA 1SFEA 4X1EA 3V8LA 2HPIA 1D1AA 2EN1A 1YYWA 4HYEA 5FRMA 2X9DA 2Y48A 3KP4A 1WI3A 2HWVA 2NS7A 3TQNA 4G6QA 3D1NI 3L1PA 1JT6A 1MD0A 4BC9A 4YELA 4B09A 3BY6A 4BBRJ 1FBQA 2MBFA 2KRCA 4MFDA 4LU9A 1R7JA 2DLKA 1ZAAC 2A61A 3RKXA 3DPTA 1XGSA 4ZC3A 3WU1B 3AG1H 3L7WA 1VQ5I 1ZHFA 1SFUA 2ELYA 2NUGA 4BL0B 1YX5A 1IRZA 1POGA 2EH3A 1K78B 3DXJF 2P0WA 2VPRA 5IPAA 4UUSA 4LF5E 4NQWB 5DUIA 1U9NA 1WH5A 2K85A 3DKYA 2QENA 5D6FA 3U1DA 3VYTB 5K5OA 3HQ1A 1T95A 3KETA 2LK2A 1X3CA 1O0WA 1VQLI 1RUOA 1P92A 2ZMEA 2ZC2A 2JPBA 3F6VA 3RTRA 2R7TA 5LFAA 1P4XA 3SEZA 3A4CA 5LGTA 4LG0B 3FMRA 1GQEA 4LFUA 5DYMA 1G8XA 1QZYA 1BR2A 2EPLX 1TWHJ 3HG9A 1NHAA 5KAIC 4Q4ZF 4AIJA 3WG9A 2Q8UA 2VPLA 2YTQA 1T4NA 2HDCA 4EVIA 4XLPF 5A2QC 1STZA 4B3ME 3S1MJ 4ZYGA 1ETQA 2IEKA 1J26A 3IWFA 2EOOA 1TT5B 4AUXA 3WTTC 3JTHA 1TT0A 3DTKA 1FIPA 2LKSA 3WODF 3BR3A 5K1YA 3OIQA 1A04A 4AWXB 4P9UA 2YWQA 1SMYF 4XLFA 3O8GA 5LMUE 3ELKA 4UVAA 3UKGA 4OU0A 1TWGJ 2NABA 1U5TB 2HC5A 4JQFA 2WA0A 5FLMJ 4D1QA 3HOUJ 2YPNA 4BY7J 2IS1A 4W1UA 3PL8A 2RQLA 2CW0F 3FM5A 2ETHA 3Q9SA 4FK5C 1N32E 2H1KA 3FK6A 1KU9A 3KYLA 2L92A 1JJ6C 3CD6I 4L18B 4MNUA 2XVCA 1HBXG 3KP2A 1HKSA 3QPLA 2Y9YA 4XOTA 5FROA 2VBZA 4X62E 3E97A 3K7AJ 4LIUA 4YIRX 3ZMVA 1KU2A 2HOSA 4WF2A 5ERIA 2Z1DA 3TW7A 2P7VB 2L6MA 5GAEJ 1TQIA 2KRFA 2K3FA 3KCCA 5TJJA 3VODA 5DV5A 5C3EJ 4RAGA 1X2MA 4HOBA 1LVKA 2L01A 3EUAA 5HODA 1PKPA 4IQ4A 4IHXA 4XONA 2PJRB 5D8KB 3DF8A 1H9TA 2DLQA 4ENKA 5AE1A 2QLZA 5ICFA 3CCEI 2OTJI 3PQKA 4EJWA 3QG5C 1GT0C 3LMLA 2ECCA 2IHR1 1ZBQA 1GV2A 2H94A 5F0HA 3QOPA 3ZGKA 4PGGA 3HM5A 1FOXA 2H8WA 2WAQN 2YS9A 5BPDA 2LY1A 3K4LA 1S7AA 1WJPA 3U1KA 3V7RA 2QBYB 2V86A 5E8GA 1WJFA 1W5TA 1ETYA 4S04A 2JOBA 4B3TE 1RIOH 5F0CA 4NB5A 2UV1A 3FIGA 3OTOE 3HOVJ 3JU0A 4P5OA 2GA2A 2OU2A 2ZJPF 2UXXA 4LF6E 3REOA 2L2MA 4EM0B 2EILH 4PDKA 2MW8A 4R03A 2ZXWH 1IDYA 3QRFF 1BOBA 3W6VA 1P7JA 3CMAI 3A0HC 2K7LA 3NWTA 2NOJB 2KZGA 4QSHA 4BXFA 1MNDA 2NOGA 3IWZA 3KX2A 4IVNA 3OYNA 2O8KA 3HOYJ 3C6KA 4O3MA 4X66E 1TF3A 1ZBTA 1D3YA 3OS1A 3AL0B 3MMYB 2WAFA 1ZK8A 2W25A 3IAM2 4I09A 5CVJA 1U8BA 2IA1A 2P8TA 1WHQA 2R7OA 2NUFA 4WPYA 3JREA 3COAC 2DA1A 2Q8KA 1F36A 3WTVC 2VQCA 3FBIB 1WHNA 2DMQA 2M34A 3HB9A 2MKDA 3T1BA 2X48A 4HG2A 1R5HA 2JSPA 1KQ9A 3TMOA 3MHHC 4HV6A 5CYVA 2ZJRF 2BY0A 4MIMA 4BACA 3FK7A 4PJLA 2RC4A 5E1WA 2PQ8A 4WXHA 4ESBA 2EOHA 3NQOA 5FFZA 4IRGA 2M9HA 1YRNA 2E5ZA 3M7GA 3PM1A 3AG4H 5BQTA 4CA0A 3V42A 5A2QK 3FXJA 2XC7A 2YTFA 2LTSA 1ZYRF 2Z33A 2DAOA 2IS4A 3HUGA 5FFXA 3HOTA 4XLNF 1RQ0A 2OUMA 3JRBA 3FBNB 1A35A 4XLEA 1Z7UA 3OYGA 4O5GA 4JI4E 2R7UA 5FD6A 2MFZA 2A6EF 1RETA 3S2HJ 1WH7A 2V83A 4XBFA 4LB6B 1OCZH 2MSYA 1IAWA 4FTHA 1EKEA 4A6EA 2EPFA 2QM3A 3C2GA 5DM6F 3S2DJ 3H9QA 2G7UA 3I58A 4KIFA 3L2UA 1JKRC 4NXME 2IA2A 1FLIA 4KUMA 2JY9A 2D9HA 2ESHA 3MFKA 1O3SA 3OYDA 2BHZA 2K27A 2HXIA 4RAFA 2ZJ2A 4YFKF 5IY5H 2JA2A 1JK1A 2W82A 3MKZA 2LFBA 1FTZA 1H89C 2EA2A 3ZOBA 4OOGC 2EFQA 2P7CB 2EQ0A 1LLMC 3DBLB 2L9SA 2ISYA 4C9YA 2W7NA 3HZJA 2ZFUA 4WYQB 1Z21A 2JTVA 2LCEA 2KJCA 4F6MA 2G0EA 2P6SA 4XIDA 1MJBA 3M4OJ 5IP6A 1HQCA 2D2WA 1YYVA 2ELKA 2Z5UA 4ASNA 3ADGA 4G6TB 1W7PA 3OR2C 4MTEA 3AG3H 2EOEA 2NRAC 2FNPA 3CUOA 3LNQA 1VQ6I 2A5YB 1UAAA 3ERMA 3KPHA 2HDWA 4G9YA 1SD4A 2XAGA 4XRFA 4M3BA 4ON0A 3RDIA 2CUZA 5LEKA 4A3BJ 3CQZJ 1LQ1A 2GHFA 3L00A 3PQJA 3S32A 4BYYA 2Z16A 3BOQA 5HS8A 4DMIA 1ZAOA 2EV6A 5DDGA 3MZHA 3PIOF 2OBPA 1ERDA 3SFZA 3ZMSA 4M6XA 2CH0A 3QYBA 3E6CC 4JI3E 2IA0A 1AOYA 3LLHA 5L3EA 4ABZA 3ZMZA 3K70C 4PSWA 2NUEA 3AAFA 2EWLA 5KL5A 3WGHA 1QVUA 5D5UB 5LRSA 1TNTA 1R36A 1R71A 4BQNA 2FV4B 3SEQA 2K4VA 2RV8A 3RYRA 5FLXK 2RAEA 1X58A 3E5UA 4B43A 2L5QA 3P7NA 1DDNA 2O8XA 4H4KC 4XSXF 4B4CA 2BVLA 1KYWA 3T8TA 2QGUA 2ZXHA 2ENCA 1XMKA 2IXSA 1MBEA 1B59A 1XNRE 1WZ2A 2ODRC 1HW2A 1PUEE 2GM4A 2E5LE 1ETKA 5DEQA 1KU7A 2GAUA 3TP0A 1W5CC 4HEA2 1X6FA 4RB2C 1IBME 3RZDJ 1I1GA 2FA5A 1YYOA 3BF2A 2HEOA 4I0AA 2CMPA 4RGSA 4AYBA 1H9GA 1RRJA 3QPHA 1QPIA 4B3SE 3JR9A 4IJAA 5EGOA 3KYCB 2YRHA 2XGDA 3J7ZI 4LGWA 2LMZA 1DU0A 2E35A 2AS5F 1W0UA 2FRHA 5F08A 4OMYA 3DEEA 1SFOJ 1RZ4A 2AQEA 1KZHA 2WZOA 4HBLA 3ABKH 4RLQA 4ESJA 1S6LA 2QKLB 1VQPI 3L9FA 5GP9A 3K69A 3ASNH 2MDRA 3W2WA 5KVRA 4F7ZA 5IT3A 3CCMI 5AASA 4M2ZA 3T5XA 3I54A 1ZGWA 5IT9C 3W2VA 1KYZA 5TGTA 2IJLA 2F5VA 2P81A 4CZCA 2JPCA 3ZQHA 1HOMA 1P47A 2KL4A 4Q28A 2V9PA 3RIRA 3JSOA 3OL3A 4CCJA 2EBIA 2M4GA 1IUFA 4BCAA 1L0OC 4KJZA 4AVPA 1V5FA 5CVRA 1R23A 2LR8A 4FT8A 2LRDA 5GTHC 3H5NA 4AU7A 4B8XA 2N3GA 4LFBE 2MD5A 4TUIA 4HX8A 5ICCA 3VEPA 1ULYA 3KEQA 3C2BA 2VN2A 4NC7A 5B66C 3LAPA 1B8IA 4NNJA 3MQ0A 2R7ZJ 3BR2A 3ABUA 1BA5A 5EZHA 1XD7A 3JRDA 3CUQA 4UHTA 5ICGA 3KZZA 3V7CA 5E8IA 4LF7E 2F4OB 4AVZA 1EA3A 4IXAA 1X3WB 2DT7B 3CO6C 3VSKA 3BWGA 1IN5A 3ESWB 2VQLA 5ICEA 2E1NA 2DMYA 1IRGA 2CW8A 2DQRA 4XKCA 1FEXA 2MA3A 3LA3A 3WU0A 2HJJA 1ZH5A 4RB0A 2E5NA 3J80C 3ECOA 2WB1A 2LMDA 2IAIA 4DYQA 2V8QB 4YIIA 1D5YA 2ELZA 2ENHA 2K40A 1T4OA 4DZPA 4HNVA 1ZLKA 1NH3A 1S3JA 2COBA 1JKOC 2QEXI 1J5YA 2VF1A 5LEJA 4XLAA 3S1QJ 2VC1A 4E7LA 5FLVA 3CC2I 3G6EI 3AG2H 1BI1A 4GYGA 3JSPA 3M3YJ 1R4NB 2R5YB 4FX4A 2F8BA 2JPAA 4N0BA 1FOYA 3K1MA 2N8XA 4LITA 4YFXF 1R1VA 2VBYA 1D5VA 5CFFE 2VBXA 2YTPA 1TWAJ 2QVOA 3LWFA 3GTJJ 4BE0A 1U6GA 1S29A 1XTAA 2WV1A 3D5SC 3QU6A 1ACIA 3X2QH 2BE5F 4FCYA 1T2KA 1Y0UA 3BP8A 4E7IA 3N4MA 1E2XA 5ED4A 1PUFA 5DCMB 4IOCF 4BKXA 2Q2EB 4XM3A 3C6MA 5BOXA 1YYKA 3OYBA 1SVOA 2ZKZA 1ETWA 3B73A 3MD2A 5KHDA 3LSIA 3PNTA 4YEJA 1R6RA 5GPAA 2VL8A 4IHSA 1ZR9A 1AAYA 3EPHA 2JRTA 4U0YA 1TLHB 2M2EA 1D1CA 2F4VE 3W3CA 3CMEI 1IV6A 1HLVA 5TISC 4BAYA 4RGUA 2L3CA 4G94A 3CCUI 4JK1X 1RR7A 4XK4A 2HFHA 4AM3A 2DW4A 1Z6RA 3TBIA 3SFIA 4NBQA 5DNYA 2JR1A 1YG2A 1OLTA 4CO8A 1XDUA 3DKXA 4B47A 2LJHA 3CC4I 1FKAE 3ECHA 2EOXA 2DCEA 2WBUA 2UUAE 4A3LJ 3U21A 1FMVA 3Q3SA 3FMSA 4KT6A 4CZZA 1MBGA 1IMUA 1USTA 4Y17A 2OTLI 1AA7A 4BS9A 1XC5A 1TQPA 1STUA 2V4JC 1B4AA 2KHMA 1RPWA 2A68F 2DFIA 5TSEA 2KIQA 1SD7A 5HNFA 5HOOA 2VLAA 3HDDA 2B3TB 3IH4A 1W1WE 1XMAA 4GEQB 1VQNI 3S8PA 4HSRA 1BJAA 3C3WA 1VQOI 1K78A 2KKOA 3G1MA 1NK3P 2JVHA 1WRJA 1UMQA 1GDTA 2NVXJ 2DPDA 2LNBA 4NQWA 4AD9A 2N3HA 1UN6B 5IT9K 2VKHA 5E20A 3T1YE 2LKPA 2BXZA 4JI7E 1DPRA 2H6BA 4IRHA 2NXNB 4CCOA 3K4KA 3K4JA 3K1NA 4M0VA 1I6XA 2KDOA 2RS6A 4XRSA 2EV0A 3S1RJ 2CQNA 3A03A 1PVEA 3BBGA 4RB1A 4FHTA 4F92B 4DBQA 3KE2A 2EIMH 2RS7A 2M0CA 3FXMA 4QPOA 2LOOA 3MSWA 4EV0A 4AIHA 2RSIA 2ELJA 3R61A 2DFEA 2YTOA 2CTDA 2M4IA 2R7FA 2I13A 3K4CA 1UCRA 4UY8I 2IBDA 4IRIA 2LREA 1GLNA 4QWQA 3EQ1A 1RI7A 4BJ5C 4E6KG 4D7MA 1PJSA 2DO7A 1V54H 5DM7F 1HR0E 3FDYA 1T0FA 3VFZA 1UBDC 3RYPA 1JTYA 1IDZA 4Q35B 2HQ5A 1GVJA 1I39A 3BDDA 1LFUP 2F4IA 1U5TA 5CQEA 5KAFC 1AHDP 2H8RA 1Z1BA 5KNLA 4LOCA 2CU7A 3VWBA 4NC6A 1BJZA 2YTGA 3TDUC 1IJWC 4QPQA 3CDHA 3HPGA 4DNCA 3KLOA 3HEFA 3OYFA 5A6JA 1X2NA 4I2OA 4Y33A 3K0LA 4M3FA 2FGGA 2KMUA 1GZ6A 5BNGA 4ZH4F 1Z9CA 4IJDA 2V88A 3TW6A 3ZXSA 2ESNA 4I98B 5F3WA 3PFYA 4L0ZB 5IV8B 3PO3J 3L2RA 2H09A 2HQRA 4HA8A 2PMZN 3OOUA 3PNVA 5D5XB 2PJRA 2XGCA 4AIKA 3LQQA 3NAUA 4TV7A 3U9GA 1FPQA 2ISZA 5E1ZB 4ZZLA 1QZZA 4KICA 4P96A 4AIDA 3BZ6A 4S0HB 3S16J 4CH7A 1YZ9A 1AWCA 4EJUA 2OV7A 3WE3A 1IQSA 4I99C 2BB8A 2J5PA 2OAZA 4U88A 4DR2E 2C6YA 3FF5A 1OYYA 4XSZF 2CUFA 4XNFA 4JV5E 3SHFA 1YW8A 2QBYA 2GZWA 2CV0A 2JRMA 2EMIA 2L9NA 5HS7A 5C4JJ 2ZNZA 2RVCA 5E3LA 3KP6A 1A1LA 3CCRI 4ESFA 3L2QA 1P7IA 2XPUA 3HOWJ 3CF2A 2CG4A 1LNWA 4M9SA 1Z6TA 5AE2A 2E7XA 4BHBA 5F27A 4KISA 2EN3A 1RC7A 1A1GA 2IVMA 2LG4A 2EPOA 2E2JJ 2W57A 2CGPA 1IC8A 2XF7A 4R1HA 5ADZA 3BR0A 3WGIA 3HOZJ 3E6BA 1ZG1A 4JBAA 4Z2YA 3F6GA 3F3XA 2R92J 3S17J 2LTPA 1RUNA 2HS5A 2EMWA 4DV0E 1JHHA 4L5JA 1J59A 1X6EA 2YSPA 4MGRA 2PMHA 3TL4X 3GWZA 4R2EA 2F5DA 2E2HJ 2E2IJ 2OPTA 2FEZA 4R2SA 2E1OA 2VI6A 4PCQA 3S15J 2TDXA 2STWA 1PYVA 1FJGE 1G2HA 4RGRA 1K6OA 1S5LC 2PBIA 1BL0A 3KWRA 1JI8A 3CMYA 4HTGA 4KYWA 4G7OF 2YTDA 2DA4A 2M0MA 5KL2A 1IZ1A 1S8NA 2ME0A 2OQRA 2ZXJA 4E7KA 3FXRA 5HLHA 4LTYA 3QOEA 3FXQA 1PP7U 3DBHB 3DU5A 1WSUA 2RQPA 1IN6A 2DODA 4CXFA 5EF6A 2B9SA 2EPXA 4A69C 2A5WA 2HZDA 1LEBA 4BXXJ 5EJCA 4NZVA 5KL7A 2DLLA 3IRRA 5B1AH 2LD5A 2EL6A 2B63J 4ETSA 4L0YB 2JP9A 1P6RA 4LK0F 2KIFA 5E1XA 2EA4A 3BCAA 3BQZA 4IHWA 3J80Z 3S14J 4HNUA 4R79A 1HW1A 2NNNA 3FZVA 2P5KA 3BCBA 3QODA 4Y3OA 1JT0A 2DBBA 1TN9A 1SANA 4A0XA 1FYMA 2VODA 5ILVA 2XPWA 4XMYA 2JA5J 2EE8A 2FOWA 3QPTA 3JAMC 3F9KA 3IKTA 5DTDA 4HEIA 2EFNA 4CCMA 4I0BA 4XLHA 3WTUC 3ADIA 1G3WA 2HKOA 2PI0A 3JCUC 1BR1A 3IWBA 4XL9A 5EDNA 2YX4A 4P7DA 1G6NA 1R22A 3H5AA 4F9AB 5HDGA 1OQYA 1QNTA 2HKXA 3CJNA 3P9KA 2QCOA 4RAZA 1O7LA 2E1CA 3W2AA 1HNXE 1LDJA 2XGEA 5IYBJ 1K6YA 2EIJH 3RSNA 2V6CA 3BR6A 1Z3YA 5JLXA 5BS6A 2V7FA 4E7JA 4DYRA 3DTIA 2LTRA 2PJPA 2W4SA 2F5CA 1MH3A 3FIWA 1VZ0A 2JUGA 2VXZA 2FUG2 2FU4A 1X1DA 1D8KA 2A6HF 4F6NA 2IRFG 1K7AA 4IL6C 2W48A 3E6DA 3HXLA 3DQVC 3A1YA 2LBSB 4OIQF 4IPAA 1KYQA 2LY9A 5M5YJ 2YTIA 3VSLA 2IGMA 2MYSA 2O3FA 2LY2A 5FKOA 3DPLC 2HI3A 4F54A 1MDMB 4CSWA 2DDAA 1XGMA 2FD5A 4E70A 2HHHE 2EWNA 1Y0NA 3HL2A 2WAEA 3ASOH 2BBGA 4X64E 2VE7C 2YTEA 2R5ZB 2HTSA 2ACJA 1D1BA 2EZ6A 2KIUA 2LVSA 3MCZA 2WY7Q 3EQLF 2EL4A 4GFBA 2V85A 2DRPA 2X6YA 3P5JA 3PJRA 3BTJA 2HR3A 2EOSA 3O6BB 4I8OA 3DFGA 1TNSA 1MMAA 2ZNYA 2MC4A 1CGPA 3IH3A 2DXIA 1MBFA 5BR8E 1ZARA 2CUEA 3OS0A 4HLXA 4HV5A 5FGMA 2GXAA 2LUQA 4N9IA 2XSDC 2RSMA 1QPMA 3THOB 3VYSB 2OQGA 1FYLA 1WHUA 4M6YA 4KMFA 1UILA 2QSFX 1YOVB 2RDPA 1MEYC 5AIPA 3H9GA 3LSRA 3KYDB 1B6AA 4XRMA 4F9BB 4O4KA 1OPCA 2EN7A 2QQAA 2CV1A 2QSGX 3E7LA 4B3XA 4QTRA 3H09A 2E1MC 2X85A 2NVTJ 2K02A 2UXBE 1HC8A 3K4BA 4KITB 1YITI 2GLIA 2L8TA 1IV8A 2M3AA 2NVYJ 4XN3A 4JX6A 4U7DA 5FLXC 2I9IA 1S9HA 1X1PA 5DD4A 1H8AC 1G2DC 3AV0A 4XQFA 3B02A 3PUFA 1W4MA 2EN6A 2EM6A 3BG7A 1FJLA 3H9JA 2IS2A 2DMNA 1NG7A 2FXAA 3IWCA 5FD5A 4ZYHA 3K6QA 2FBHA 3MKWB 4OIPF 5F1RA 5IOZA 2PEXA 3O3KA 1Q1VA 5M3FJ 2MKNA 2VBWA 4BMJA 4E7ZA 1BOAA 9ANTA 4GKJE 1TC3C 4DKKA 3K10A 1QHGA 1JK2A 3K2ZA 1YO5C 5J3LA 3RMPA 1X6HA 2XSJC 5F0FA 1MJAA 2ZM6E 3E3VA 1V4RA 2DFHA 3D0SA 3WGGA 4I01A 1JE8A 2IS6A 2CV2A 1Z7LA 2XAQA 1XS9A 2EPZA 1WQ2A 1IXRC 2BY1A 1B72B 2N8GA 3LFKA 1EV7A 3K6GA 3JAMK 3GTMJ 2XB0X 2E60A 3W6KB 3LQRA 1KONA 3LSGA 4NUBA 3HRTA 4IX7A 1T98A 2DA5A 5ILSA 4E7SA 2RN7A 1GUUA 4N9HA 4KNYA 1SD5A 1T6SA 2K4BA 4C3JJ 3J7AO 1YHQI 1IN7A 4UVBA 1XMXA 2L3DA 2XF6A 3HRMA 1IUYA 2IT0A 4P78A 2PLYA 1UELB 3LSTA 5J47A 3GVAA 2YU5A 3HRUA 2RREA 1A1FA 4MEYF 2JA6J 1UHSA 1FYKA 1B69A 2EN2A 3C2HA 4LB5A 3PSIA 4U7BA 2HYFA 3OYKA 1RNLA 3IRQA 1BI0A 3I4MJ 2EQRA 3DV8A 5J1YA 3OS2A 1Y1VJ 4D9JA 3WTSC 4UV9A 5JHFA 3CCJI 4IZZA 1DQ3A 5EG0B 4BEHB 2DT6A 2DI3A 2Y0MA 3H92A 2EPRA 2VONA 1FP1D 1A5JA 2JVGA 3ROUA 3NEUA 2D1HA 2DTRA 2W1OA 4JX4A 2R5YA 4HDUA 2CW7A 5J4YA 1YS7A 2VE9A 2ZJQF 3MKYB 2HNHA 5JVGF 4Q48A 3GTPJ 5FKMA 1HKTA 3M8FA 4HPQA 1U9OA 3PSFA 3GFIA 4C2MJ 2M1SA 2X6OA 1QZEA 3CCSI 3KFWX 2D45A 2K9NA 3ZMTA 2BBYA 2LO3A 4R2CA 3P9IA 1OCTC 1YJNI 1NCSA 5DCMA 1ZG3A 1IBLE 1Y6IA 2Q2EA 3QP5A 2EMKA 2V89A 4PGHA 4ANJA 3T1HE 4PJ0C 3CP8A 3CZ6A 2EMGA 3OL4A 4GO1A 2YX7A 2EM3A 5A6AA 5IP9J 2EPMX 1JTXA 1OCPA 2GLOA 3WTYC 4A2UA 1Y1WJ 3DLLF 4RM3A 1X1AA 1SC7A 2BOLA 3AFHA 2JWOA 4I02A 4IHTA 2YRMA 4MTDA 3HKZN 5TRDA 3H5RA 1QBJA 3R60A 2MH2A 1CF7B 1W7PD 3F22A 2NYXA 2CT1A 4YY3E 4F3QA 3BPXA 1Y8RB 1F5TA 1ZG5A 2DK5A 4BBYA 5CJ9A 4F2JC 3JTGA 3PIPF 3ZR8X 2UXDE 3GXOA 3S2WA 5KK1A 2R7QA 1KJKA 1FMWA 1R4MB 3VYXA 1K4TA 3J81C 3DCFA 4N4OB 1YI2I 1RR8C 5IWAE 3CMMA 4RMNA 1Z67A 2EPCA 5C4XJ 4IHVA 3J7Yp 2X6XA 1DGWY 4C2UA 5A2QZ 1GXPA 2KPMA 1SR9A 1J7KA 2LDUA 1QGPA 2ME6A 1REPC 4KWYA 1QRYA 1T0FC 3GZ5A 4IOAF 5FJ8J 2LLKA 4L5IA 2EMHA 2L7MP 1A1IA 2A6TA 1U5TC 5J1RA 1XNQE 4OWRB 4KMUX 1A6QA 2X1DA 3H3VK 4V2FA 2FMYA 3HBLA 1VF9A 2XRNA 5D5VB 4JYAE 3V7SA 2LSOA 1M1EB 2M7BA 3IP4B 4J00A 1EH6A 2DK8A 2BXYA 2F4MB 4B48A 2R0QC 3C4TA 3M99B 1ORKA 2V1NA 2ZXIA 4A3JJ 5LL6R 2GWRA 2P4WA 5EYRA 4U0VA 4R2AA 4WSPA 1O3TA 2OZ6A 4BGDA 2XB5A 2EMFA 1WJEA 1JUPA 5GAHJ 1UHWA 1QU6A 2EN4A 2CYYA 4PUSA 2K9LA 3K1PA 4EJVA 3ZP5A 1RMDA 3S3OA 3ZQQA 5J6XA 2VJIA 3RPUA 2I5UA 4FE7A 3ZMUA 5LHGA 2CQXA 2V26A 2QA4I 2CSHA 2M7QA 1N78A 1EH7A 3MEXA 3OSGA 1O57A 2L7FP 4DUZE 2DYRH 2BVMA 3E1SA 3OWTA 2XROA 5F6FA 1O4XA 3M8EA 3OV8A 5EEGA 1W36D 3LFUA 2EZIA 2R3SA 3VYRB 3SJMA 1DP7P 3GUDA 3CC7I 4YHHE 2EQ3A 5LGNA 1YPNA 4LF9E 4JP0A 2JQ7A 3KP3A 3FXKA 3IH2A 5L3FA 3K9TA 1AH5A 3P9CA 1B9MA 2EFPA 3ZQFA 4BHCA 1LE8B 1XGOA 2XPVA 4DV6E 2HU9A 4RS8A 4JI8E 4CCKA 3MHSC 1BW6A 1WKMA 5CVVA 1FP2A 4W97A 2GXGA 4EMSA 3RPUD 2LRSA 1VQ7I 1K83J 2B7EA 2DMUA 5FB2A 3TO7A 5A6BA 3VYYA 1HNWE 1SVMA 1DGRM 4XOPA 5IP7J 3F8NA 3GFMA 2K9SA 3L09A 4WSGA 1QQIA 4DR1E 5K7HA 1S72I 2G7HA 3SZTA 1JUSA 2NA2A 3LOCA 1ZR2A 1G4DA 2HGHA 1ZRFA 1X3UA 2WBTA 4D5FA 3P1XA 1MJ9A 2NNYA 4MQ9F 3AL0C 2FQ4A 4I6ZA 3I59A 2LVHA 1GXQA 1WJDA 2JUCA 3JRIA 2EOJA 3MAJA 3M1CA 5LHIA 4IQJA 3SXYA 1L3LA 4GKKE 2XHKA 2HVQA 2KHXA 4JI1E 4F55A 1FIAA 3HSRA 1R5GA 3HYIA 1G59A 2EOZA 5HLTA 3PO2J 4DR7E 3N05A 4DBRA 1HDPA 4EJTA 5A6BD 1SEUA 2YR2A 3QPSA 3WG7H 2QQ9A 3BTLA 1X3ZB 2LF8A 2DSYA 1PDAA 2EM7A 4BHPA 3F0CA 3OOPA 1D0ZA 2CRGA 5J4VA 1UB9A 3CJRB 2W85A 1ODDA 4R8OA 1WJ5A 1WVRA 1YX3A 5HS9A 4BY1J 4HQMA 3W6JB 5FKNA 3FKIJ 1KA8A 2PMZA 1SD6A 1LDKB 1KU3A 1AKHB 1OJLA 5KL6A 3I5UA 3J81K 2AHQA 5F04A 3WTZA 4IS1C 3KZIC 2K9MA 4HW0A 1XSXA 4WXDA 3CCVI 4JI6E 3RPQA 3ADJA 3RZOJ 2VC0A 1P4WA 3AUZA 2ZMEC 2LE2A 4K2EA 2KDZA 2VT3A 3LSMA 3J7YJ 2EMCA 5H20A 3VYUB 4O43A 3ZMDA 3NARA 2L02A 1MMDA 3Q5FA 2BW3B 5CPRB 2FNAA 3HPSA 4C3IJ 2EORA 2A07F 5H2FC 3KZYA 1GHCA 4GYIA 2DA7A 2P6TA 3C7JA 1XDSA 3Q0VA 5DS9A 5B1BH 4CYDA 3DBRB 2JYAA 5CKTA 4N4NB 5KCMA 2GXBA 1F4KA 1HXDA 2FBKA 2GIVA 2M1BA 4M6VA 1VQKI 4QLCU 2FSWA 3RCOA 1QU3A 4WCGA 2IP2A 1ZTRA 2VJ4A 4LIVA 5LGUA 3OYIA 1BR4A 5CLSA 5AC5A 3IC7A 3MWMA 3FISA 3UR3C 2JA7J 2EOFA 2G9WA 4DV4E 1MBHA 3GF2A 1F9NA 4DR6E 1WXRA 4LG0A 2DIXA 1FX7A 1SFXA 2XUBA 3G4SI 3J7AY 2EMBA 4KT5C 3IHUA 3HGGA 1T38A 4MLVA 2EV5A 4MQVA 4UUVA 2GOXB 1X5WA 2XASA 2V6EA 2FBIA 4IEJA 4IHYA 2KQRA 4LLNA 2J7JA 3BR1A 3GLLA 2CPNA 2MLKA 3E5QA 1HSJA 2BY2A 2DOEA 3B6CA 3EPZA 1VQMI 2EZKA 2YRKA 1YJ9I 1UHZA 4DQ2A 1XB4A 5K5QA 1X49A 2CQ7A 3A01B 1YS6A 2V1XA 2XKPA 4CYCB 2DPUA 1R1UA 2D1VA 2R7DA 4XLCA 2O0YA 2JT1A 2YUSA 4XRSG 4CHUA 2MABA 5H6RA 2V1UA 4CUGA 3DTEA 1R00A 3ZQGA 4IKFA 3F8MA 1LJ9A 2Y75A 1Y56A 4OIOF 1MBKA 2P5VA 4GRIA 5L3GA 2WBMA 4A3EJ 1IO2A 2E1MB 1DGCA 1ITYA 5M3MJ 4RDUA 2E19A 1XMQE 1MNEA 3G1LA 2WBSA 4LF4E 2DA2A 4B44A 1F2IG 2JXPA 4N4RB 1VQ4I 4HQEA 2L2OA 3HIFA 3I0TA 3A02A 4LMYA 2STTA 2QQ8A 2DMPA 3M9AA 2LC2A 2DMIA 1A6IA 1JKPC 3DP7A 2ADUA 4UVCA 2HYGD 3ECRA 3Q0UA 3JRFA 4L5NC 2DGCA 3OYAA 4O5VA 1MGTA 5B3SH 2DN0A 2X0LA 5GAGJ 1ZN2A 3E0JB 3QQAA 2YU3A 1WFXA 2IGNA 3TEDA 2L4AA 2HPMA 3OYEA 1MW7A 2VKVA 3EETA 5K5RA 1IBKE 1BC8C 1BBYA 2IW5A 1H0MA 6PAXA 3DU6A 2EMLA 2R5ZA 3JTZA 1I5ZA 4C3HJ 1TZLA 2HVSA 5E17F 2YPRA 1OR7A 2Y0SN 3R0AA 3V4GA 5JLWA 4BDYA 2V9VA 4M9XA 1N77A 2OZUA 1XCBA 4EM2A 5FRNA 4DV7E 1R1TA 2CSOA 4MFEA 4QIWN 2UU9E 4A6DA 1D0XA 1EJ9A 1E17A 4ITVA 2O6GE 2DT5A 2EQ1A 4F9CB 1FWZA 1NG6A 3IUOA 1V5EA 1J0RA 1KQ0A 2A05A 2ID3A 3A2KA 3BIDA 2JZYA 4ENNA 2KJBA 2X51A 3BROA 3CLOA 2EIKH 4J01A 5HVQC 1ON1A 1N75A 2COMA 1U2WA 3WU2C 1RESA 3HTUA 3J7AG 2EZLA 1BIAA 2FQ3A 1LPQA 2MH9A 1JGSA 3R6SA 4WX9A 1G3YA 2DJNA 2ZCWA 4BJ6C 1IG7A 2HQNA 5E3OA 2BEOA 1G2FC 5DCFA 2L9RA 3NWSA 4BH9A 5LHHA 5IT9Z 1LKXA 1BM9A 2GQQA 2L9VA 3N97A 1RKTA 2K4JA 2VJJA 1N34E 1D0YA 2YTJA 4OOIA 1UZCA 4S05A 2F48A 3MKLA 3GFLA 1O3RA 4JI0E 4D0PA 2EK5A 3IWDA 4BU2A 3HPZA 5AONA 1EKZA 3CTAA 2XF5A 2I8DA 4X9JA 3GX4X 4R2QA 3ERED 2FMLA 5LD2C 2WAQA 3I56I 1T39A 2JOXA 3I53A 1Z91A 3WTXC 4LK1F 1YIOA 3V8KA 2KONA 2V79A 4BC7A 4Q5SF 4HAMA 3BG9A 3S3NA 1V55H 1ETXA 1L4SA 2XV4S 4GDFA 3EPLA 3EPKA 1J5EE 2FTXB 4PJMA 1B72A 4RHBB 2YSRA 1C0WA 5KL3A 2QSHX 3S1NJ 4JYKA 4JOMA 5JI6A 4L9JA 3BZKA 2O7OA 5F64A 4L5EA 3JRAA 2JA8J 1FT9A 4OIRF 4Y4RA 3K2AA 3HTXA 3LL7A 2L54A 1EH8A 4PJJA 4F93B 3EYIA 4YG2F 2R4GA 3I64A 2LBFB 1A1HA 2M8GX 2WTEA 1JHFA 1X4PA 3BGHA 3K4MA 2O03A 4G8XA 3QYEA 2ZSHB 3LSHA 4RGXA 5AE3A 3LAJA 3C18A 5D4RA 2EM8A 1XG1A 2EM5A 4NHRA 3BG5A 1OISA 4X6AJ 2Q1ZB 4R8HA 4DR4E 2MC3A 3KP5A 4D5CA 2B7TA 2K7IA 1HNZE 1I50J 2A69F 3A0BC 1OMIA 3MZYA 4BEHA 4YFNF 1ZGAA 2EJRA 5EG0A 1UG0A 4DUYE 2PG4A 5AIQA 1NK2P 2OA4A 4FE4A 3BC8A 4U87A 5E3MA 2MG4A 3LA2A 1MH4A 2EFWA 3HSEA 2Z3YA 2HQAA 3PUBA 2ZO4A 5M5XJ 4RB3C 3UNGC 4Y52J 4UV8A 2YSOA 4F52A 4D7NA 4CDGA 2VB6A 4A3GJ 4A0YA 5DUKA 2HYJA 2DOAA 5JR3A 4CCLA 2JWTA 3GBGA 4PZJA 1KQ8A 1LFBA 5AC4A 1T56A 1JJ8C 1HF0A 3HTSB 4DR5E 4UNOA 4AC0A 3AKZA 2EOMA 4V19K 1MMGA 4P55A 2QF7A 1AU7A 2UWMA 4DYCA 2OJED 4GZNC 1R58A 2RPCA 1XGNA 1U78A 3QYFA 3FKJA 3GCMA 1IGNA 2O9LA 4DOZA 2L7ZA 1FY7A 2OCEA 5L3CA 5DD8A 1BN5A 2ID6A 1OFCX 4I76A 1EF4A 1DUXC 3LSKA 4M9VC 2QZ8A 4EATA 1QO0D 3CCLI 3RQIA 1H88C 4LLGF 2PX9A 3F8CA 2KOUA 2BZTA 2FJ1A 1V3FA 1BC7C 2M30A 2GIZA 1CF7A 1LUJB 2EL5A 1DU6A 5LMNE 3HC7A 1FOWA 2BHYA 3IV5A 2HDDA 2HZTA 1FNNA 4LD5A 1S7EA 3HHGA 3GYHX 2W84A 2L7KA 1W36C 2L4MA 2M8EA 2VQGA 1QA6A 2DQLA 2EPAA 4KZSA 1Y8QB 1E3OC 4E7HA 2WWYA 3GZ6A 2R7WA 1SVLA 4M3EA 4HF0A 3TOAA 1PJTA 5KL4A 4JI5E 1ZGJA 1UFMA 2KP6A 2DA3A 3BZCA 4J8ZA 4OMZA 2DJIA 2OC6A 4DGWB 3RKYA 1K4SA 3GZNB 3F6HA 4UUTA 4EGZA 2B9DA 1ENHA 3ISPA 2R76A 3RKQA 4YRVA 1JKQC 2MC5A 3EPJA 3BTCA 1RKWA 1ZELA 3GW2A 4M3DA 2EINH 2NVUB 3K4NA 3I71A 3BLYA 2X6WA 5K7ZA 1SMTA 4M9ZA 2LT7A 3ABMH 4RH8A 4BXUA 1FC3A 3HKZA 2H6CA 4DR3E 3F8BA 5BPIA 1HKQA 5EZGA 1GTKA 4KIBA 2P5LC 2JSCA 1Z05A 2WADA 3CUQC 4MEXF 3IKVA 3DPUA 3EUKL 1LB2A 2HVRA 3CCYA 4R2PA 1ZKGA 1GVDA 1P2FA 4ENJA 2XAUA 2M9AA 2CFXA 3H35A 1X48A 5J40A 3CCQI 4HF2A 2CJJA 5E79C 2GA1A 1XSVA 5FKKA 3CLQA 4EJOA 5ILUA 3DEUA 3JRCA 4HZFA 2M87A 2UUCE 3G3ZA 5LBQA 1FOKA 3H3ZA 2EMAA 1J09A 4BDZA 4X8WA 1I94E 2EFOA 4PSXA 3TOBA 1IXSB 4FQGA 2H27A 2JVAA 4A3CJ 5GTIC 2XGXA 1ZRCA 4A93J 1BIBA 2UUZA 3BJ6A 3LA7A 1TP4A 2EZHA 3BG3A 3OYHA 3EUHA 2ZBKA 4P9FA 1YTYA 1W0TA 1YFHA 1MKMA 4BUPA 4C2TA 1LE8A 2RNJA 2AO9A 3ULQB 4CICA 4R2DA 4XN0A 3VHTB 5JFRA 2X1EA 1OCOH
chains in the Genus database with same CATH topology
4YIFA 3HOSA 1I1SA 1W5SA 2IPQX 4BNCA 1LVAA 3I4PA 2ZMEB 1TW2A 3M1EA 1IRFA 4KIGA 3DKWA 4L9NA 5D4SA 2PFBA 5J8CA 1ZLJA 2HTJA 2UXNA 4FX0A 1J75A 2XKOA 1Z1DA 3HHHA 1OYWA 2XAJA 2O61A 5LRRA 4G7ZF 1Q1HA 4L9TA 2V1DA 2VOPA 3BJAA 3SZPA 1PP8F 3FHZA 3FMQA 3GFJA 2F5EA 4GXOA 1KGSA 2F2EA 3CO7C 3RI4A 3TO6A 3R4KA 4HLYA 4M73A 4ENMA 4EQQA 2M45A 1F1ZA 3F6OA 4A0ZA 1ON2A 1XSDA 1B9NA 2ELHA 2KIMA 4KFCA 3JAMZ 1BI3A 2XIGA 3FWEA 5D5WB 1IN8A 1YQAA 4LJZF 3ZQ7A 3VB2A 2CQKA 2F5FA 2PMUA 4BQAA 3C1DA 3E6MA 2A3SA 1PDNC 2X4HA 4CGZA 3HSFA 2PN6A 1TW3A 3JW4A 1U3EM 1I27A 2RGVA 1FSHA 3GEZA 2AXLA 3H3UA 1IW7F 3GO5A 2E7WA 5JVTA 4UXNA 2UZKA 4HX7A 3ZPLA 3KP7A 4H0EA 1IXCA 4HX4A 2VE8A 4MHGA 1TTYA 5JHUA 4M74A 2Z99A 5EEHA 3SQNA 3G73A 1JXSA 4G7HF 2BV6A 4GGGA 3L2CA 4M71A 5HLGA 5J8FA 1J9IA 5H6QA 3F21A 1FSEA 1UHMA 4Q47A 4KN7X 3EDPA 2NAZA 5CVIA 1XN7A 3VOEA 1HW5A 3RKWA 3F72A 4KDPA 5BMZA 5FLXZ 2BGCA 4G6DA 1DPUA 3BJOA 2EB7A 1BI2A 3U2RA 2CWEA 2CO5A 1TBXA 4ZYDA 4KA4A 3TDZC 1O3QA 1U8RA 2Q0OA 2B0LA 5HDKA 4HF1A 2Z9OA 1LDDA 1W7PB 3R0JA 3Q9VA 3BPVA 1P4AA 1WI9A 1YW9A 4L9VA 2ZFWA 2WC2A 1B1BA 3F8FA 2VOOA 2M5WA 2NS0A 3GLXA 4A12A 2XAFA 3O2PE 4O6JA 3T8RA 2VT2A 3QP6A 1D8JA 2HOEA 2QQBA 2HGCA 4EGYA 3D5LA 4GCVA 2J5OA 3TO9A 1VTNC 2K86A 2XAHA 4A5MA 3FX3A 1S7OA 1FBUA 3ML6A 2W24A 4Y13A 5HLIA 1FBSA 5D6EA 3NRVA 5CVUA 5L3BA 2FE3A 4M72A 4HDVA 2DU9A 2WV0A 3E5XA 4ZYEA 3ZN1A 3V8JA 5L3DA 3RJPA 1G3SA 4KN4X 4WWCA 3WTWC 2QWWA 4WK8F 1O7FA 3QAHA 3TKYA 3PFIA 1MDMA 1WWXA 4LLLA 2FOKA 3J80K 3KEOA 3F23A 1YW7A 1TQMA 1ZRDA 1FZPB 3TGNA 2BYVE 3CUQB 4IF4A 4Y15A 3J81Z 4WXCA 2RKHA 3HRSA 4A5NA 4U0WA 3ABTA 3WE2A 1G3TA 5FO5A 2QUFA 2QYOA 3ZN0A 1USSA 1ZREA 4NHJA 2OD5A 1J2XA 1SAXA 2LF7A 3I59B 4I7HA 3QU3A 4RAYA 3IL2A 4EM1A 3FM3A 5LLQA 3KLNA 5D8LB 1YLFA 4ZZDA 1IF1A 4OINF 1HSTA 2MLGA 2FF4A 3EYYA 1OYIA 1K79A 1OKRA 5E18F 3FXUA 5HDNA 1XCVA 3T0YA 1LEAA 1MZBA 1IN4A 1ONVA 1SFEA 3V8LA 4HYEA 2Y48A 3KP4A 2HWVA 3TQNA 4G6QA 1MD0A 4B09A 3BY6A 1FBQA 2MBFA 1R7JA 2A61A 3RKXA 3DPTA 1XGSA 3WU1B 3L7WA 1ZHFA 1SFUA 1K78B 3DXJF 5DUIA 5D6FA 2QENA 3U1DA 5K5OA 3KETA 1RUOA 1P92A 2ZMEA 3F6VA 2JPBA 3RTRA 1P4XA 5LGTA 4LG0B 3FMRA 4LFUA 5DYMA 1QZYA 4Q4ZF 1NHAA 4AIJA 3WG9A 2HDCA 4EVIA 4XLPF 1STZA 4ZYGA 3IWFA 3WTTC 3JTHA 3WODF 5K1YA 1A04A 4AWXB 4P9UA 1SMYF 3ELKA 4UVAA 4OU0A 1U5TB 4JQFA 2CW0F 3FM5A 2ETHA 3Q9SA 1KU9A 4L18B 4MNUA 2XVCA 1HBXG 3KP2A 1HKSA 2VBZA 3E97A 3ZMVA 1KU2A 4WF2A 5ERIA 2P7VB 1TQIA 2KRFA 3KCCA 5TJJA 3VODA 5DV5A 4HOBA 2L01A 5D8KB 3DF8A 1H9TA 4ENKA 2QLZA 5ICFA 3PQKA 4EJWA 2H94A 3QOPA 4PGGA 5BPDA 1S7AA 3V7RA 2QBYB 5E8GA 4S04A 1W5TA 1RIOH 4NB5A 4P5OA 2GA2A 2OU2A 2UXXA 3REOA 4EM0B 4PDKA 3QRFF 2K7LA 3IWZA 4IVNA 4O3MA 1D3YA 2W25A 4I09A 5CVJA 2IA1A 2P8TA 3COAC 3WTVC 2Q8KA 3T1BA 1R5HA 1KQ9A 4HV6A 5CYVA 2RC4A 5E1WA 2PQ8A 4WXHA 4ESBA 3NQOA 5FFZA 4IRGA 3M7GA 5BQTA 5A2QK 1ZYRF 2Z33A 2DAOA 3HUGA 5FFXA 3HOTA 4XLNF 1Z7UA 5FD6A 2A6EF 4XBFA 4LB6B 1IAWA 4A6EA 2QM3A 2G7UA 3I58A 4KIFA 2IA2A 1FLIA 4KUMA 2ESHA 3MFKA 1O3SA 2K27A 2ZJ2A 4YFKF 2EA2A 2EFQA 2P7CB 2ISYA 2JTVA 2KJCA 2P6SA 1MJBA 1HQCA 2D2WA 1YYVA 2Z5UA 4ASNA 1W7PA 4MTEA 2NRAC 2FNPA 3CUOA 2A5YB 5LEKA 4G9YA 1SD4A 2XAGA 4XRFA 4ON0A 3RDIA 1LQ1A 3L00A 3PQJA 4BYYA 3BOQA 5HS8A 1ZAOA 2EV6A 5DDGA 3MZHA 2OBPA 3SFZA 3ZMSA 4M6XA 3E6CC 2IA0A 1AOYA 5L3EA 3ZMZA 3AAFA 3WGHA 5D5UB 5LRSA 1TNTA 1R36A 2RV8A 3RYRA 5FLXK 3E5UA 3P7NA 1DDNA 2O8XA 4XSXF 1KYWA 3T8TA 1XMKA 1B59A 1HW2A 1PUEE 5DEQA 1KU7A 2GAUA 4RB2C 1I1GA 2FA5A 2HEOA 4I0AA 4RGSA 1H9GA 3QPHA 4IJAA 4LGWA 2AS5F 2FRHA 4OMYA 1RZ4A 4HBLA 4ESJA 1S6LA 3L9FA 3K69A 5KVRA 4F7ZA 5IT3A 3T5XA 3I54A 1KYZA 2IJLA 2JPCA 3RIRA 3JSOA 1L0OC 4AVPA 5CVRA 1R23A 4FT8A 4B8XA 2MD5A 4HX8A 5ICCA 3VEPA 1ULYA 3KEQA 2VN2A 3LAPA 3MQ0A 3ABUA 1XD7A 3CUQA 4UHTA 5ICGA 3KZZA 3V7CA 5E8IA 4IXAA 3CO6C 3BWGA 1IN5A 5ICEA 2E1NA 1IRGA 2DQRA 2MA3A 3LA3A 3WU0A 1ZH5A 4RB0A 3ECOA 4YIIA 1ZLKA 1S3JA 1J5YA 5LEJA 2VC1A 1BI1A 4GYGA 3JSPA 4FX4A 4N0BA 3K1MA 4YFXF 1R1VA 2VBYA 1D5VA 2VBXA 2QVOA 3LWFA 1U6GA 1S29A 3QU6A 1T2KA 2BE5F 1Y0UA 3BP8A 3N4MA 1E2XA 5ED4A 5DCMB 5BOXA 2ZKZA 3B73A 4IHSA 2JRTA 4U0YA 1TLHB 4BAYA 4RGUA 4G94A 4JK1X 2HFHA 2DW4A 1Z6RA 1YG2A 4CO8A 1XDUA 3ECHA 3FMSA 4CZZA 1USTA 4Y17A 1TQPA 1B4AA 2A68F 2DFIA 1SD7A 5HOOA 1XMAA 1BJAA 3C3WA 1K78A 2KKOA 1WRJA 2DPDA 2LNBA 4NQWA 4AD9A 5IT9K 5E20A 2LKPA 1DPRA 2H6BA 4IRHA 3K1NA 1I6XA 2EV0A 4RB1A 4FHTA 3KE2A 4EV0A 4AIHA 3R61A 2R7FA 1UCRA 4IRIA 4QWQA 1RI7A 2DO7A 1T0FA 3VFZA 3RYPA 1GVJA 3BDDA 1U5TA 3TDUC 3CDHA 4DNCA 3KLOA 4I2OA 3K0LA 1Z9CA 4ZH4F 2ESNA 4I98B 4L0ZB 2H09A 2HQRA 4HA8A 5D5XB 4AIKA 3LQQA 4TV7A 3U9GA 2ISZA 1FPQA 5E1ZB 4ZZLA 1QZZA 4KICA 4P96A 3BZ6A 1AWCA 4EJUA 3WE3A 2J5PA 2OAZA 4U88A 2C6YA 3FF5A 1OYYA 4XSZF 3SHFA 1YW8A 2QBYA 2GZWA 5HS7A 2ZNZA 2RVCA 3KP6A 4ESFA 2CG4A 1LNWA 4M9SA 1Z6TA 2E7XA 4BHBA 2IVMA 2W57A 2CGPA 4R1HA 3WGIA 3E6BA 1ZG1A 4JBAA 4Z2YA 3F3XA 1RUNA 2HS5A 1JHHA 4L5JA 1J59A 4MGRA 2PMHA 3GWZA 2F5DA 2FEZA 4PCQA 2TDXA 2STWA 4RGRA 1K6OA 2PBIA 4KYWA 4G7OF 1IZ1A 1S8NA 2OQRA 2ZXJA 3FXRA 5HLHA 3FXQA 1PP7U 1WSUA 2RQPA 1IN6A 4CXFA 1LEBA 2DLLA 3IRRA 4ETSA 4L0YB 1P6RA 4LK0F 2KIFA 5E1XA 2EA4A 3J80Z 4R79A 1HW1A 2NNNA 3FZVA 2P5KA 2DBBA 4A0XA 1FYMA 2VODA 5ILVA 3QPTA 3IKTA 2EFNA 4I0BA 3WTUC 1G3WA 2HKOA 2PI0A 2YX4A 1G6NA 1R22A 5HDGA 2HKXA 1QNTA 3CJNA 3P9KA 4RAZA 1O7LA 2E1CA 1LDJA 2V6CA 5BS6A 2PJPA 2F5CA 2VXZA 2FU4A 1D8KA 2A6HF 2IRFG 1K7AA 3E6DA 3DQVC 4OIQF 4IPAA 2O3FA 3DPLC 1MDMB 1XGMA 4E70A 2EWNA 2HTSA 2ACJA 2KIUA 3MCZA 3EQLF 2HR3A 3O6BB 3DFGA 1TNSA 2ZNYA 1CGPA 1ZARA 4HLXA 4HV5A 5FGMA 4N9IA 1QPMA 2OQGA 1FYLA 4M6YA 4KMFA 2RDPA 5AIPA 1B6AA 1OPCA 2QQAA 2K02A 4U7DA 5DD4A 3B02A 1W4MA 2FXAA 5FD5A 4ZYHA 2FBHA 4OIPF 5F1RA 2PEXA 3O3KA 2VBWA 1BOAA 3K2ZA 1YO5C 1MJAA 3E3VA 1V4RA 3D0SA 3WGGA 1JE8A 4I01A 2XAQA 1WQ2A 1IXRC 3LFKA 1EV7A 3JAMK 3W6KB 3LQRA 3HRTA 1T98A 5ILSA 2RN7A 4N9HA 4KNYA 1SD5A 1T6SA 2K4BA 3J7AO 1IN7A 4UVBA 2L3DA 3HRMA 1IUYA 2IT0A 2PLYA 3LSTA 3GVAA 3HRUA 4MEYF 1FYKA 4LB5A 4U7BA 2HYFA 1RNLA 3IRQA 1BI0A 3DV8A 3WTSC 4UV9A 2Y0MA 2DI3A 3H92A 2VONA 1FP1D 3ROUA 3NEUA 2D1HA 2DTRA 4HDUA 1YS7A 2VE9A 4Q48A 1HKTA 3M8FA 3GFIA 3KFWX 2D45A 3ZMTA 2BBYA 3P9IA 5DCMA 1ZG3A 2Q2EA 3QP5A 4PGHA 4GO1A 2YX7A 3WTYC 4A2UA 4I02A 4IHTA 4MTDA 5TRDA 1QBJA 3R60A 2MH2A 1CF7B 1W7PD 3F22A 2NYXA 3BPXA 1F5TA 1ZG5A 2DK5A 5CJ9A 3JTGA 3GXOA 3S2WA 5KK1A 5A2QZ 1GXPA 1J7KA 2LDUA 1QGPA 1REPC 3GZ5A 4L5IA 1U5TC 4KMUX 2FMYA 2XRNA 5D5VB 3V7SA 2LSOA 1EH6A 2DK8A 2GWRA 2P4WA 4U0VA 1O3TA 2OZ6A 1UHWA 2CYYA 3ZP5A 4EJVA 3K1PA 5J6XA 3RPUA 5LHGA 3ZMUA 1EH7A 3MEXA 1O57A 2XROA 5F6FA 3M8EA 3OV8A 5EEGA 2R3SA 1DP7P 3GUDA 5LGNA 3KP3A 5L3FA 3K9TA 3P9CA 1B9MA 2EFPA 4BHCA 1XGOA 4RS8A 1WKMA 5CVVA 1FP2A 2GXGA 4EMSA 5FB2A 3TO7A 3F8NA 3GFMA 3L09A 1QQIA 2G7HA 3SZTA 1G4DA 1ZRFA 1X3UA 1MJ9A 2NNYA 4MQ9F 3I59A 1GXQA 3MAJA 5LHIA 3SXYA 1L3LA 2XHKA 3HSRA 1R5GA 3HYIA 4EJTA 2YR2A 2QQ9A 2LF8A 4BHPA 3OOPA 1UB9A 2W85A 1ODDA 5HS9A 4HQMA 3W6JB 1KA8A 1SD6A 1LDKB 1KU3A 3I5UA 3J81K 3WTZA 4HW0A 1XSXA 4WXDA 3RPQA 2VC0A 1P4WA 4K2EA 2VT3A 5H20A 3ZMDA 2L02A 3Q5FA 2FNAA 2A07F 3KZYA 1GHCA 4GYIA 2P6TA 3C7JA 1XDSA 4CYDA 2GXBA 1F4KA 1HXDA 2FBKA 2GIVA 2M1BA 4QLCU 2FSWA 4WCGA 2IP2A 5LGUA 5CLSA 3IC7A 3MWMA 2G9WA 3GF2A 1F9NA 4LG0A 1FX7A 1SFXA 2XUBA 4KT5C 3IHUA 1T38A 2EV5A 4MQVA 4UUVA 2XASA 2FBIA 4LLNA 2MLKA 3E5QA 1HSJA 4DQ2A 1XB4A 5K5QA 1YS6A 2V1XA 2XKPA 2DPUA 1R1UA 2D1VA 2R7DA 2O0YA 2JT1A 4CHUA 5H6RA 2V1UA 1R00A 3F8MA 1LJ9A 2Y75A 4OIOF 2P5VA 5L3GA 4HQEA 3HIFA 3I0TA 4LMYA 2STTA 3M9AA 3DP7A 2ADUA 4UVCA 2HYGD 4O5VA 1MGTA 2X0LA 1ZN2A 2YU3A 2L4AA 3EETA 5K5RA 1BC8C 1BBYA 2IW5A 1H0MA 6PAXA 1I5ZA 5E17F 2YPRA 1OR7A 3R0AA 3V4GA 2V9VA 4M9XA 2OZUA 1XCBA 4EM2A 1R1TA 2CSOA 4A6DA 1E17A 2O6GE 2DT5A 1FWZA 1J0RA 1KQ0A 2JZYA 4ENNA 2KJBA 3CLOA 3BROA 5HVQC 1ON1A 2COMA 1U2WA 3HTUA 1BIAA 2FQ3A 2MH9A 1JGSA 3R6SA 4WX9A 1G3YA 2ZCWA 2HQNA 2BEOA 5DCFA 4BH9A 5LHHA 5IT9Z 2GQQA 1BM9A 3N97A 2K4JA 4OOIA 4S05A 3GFLA 1O3RA 4D0PA 2EK5A 5AONA 3CTAA 3GX4X 3ERED 2FMLA 1T39A 3I53A 1Z91A 3WTXC 4LK1F 1YIOA 3V8KA 2V79A 4Q5SF 4HAMA 2XV4S 2YSRA 1C0WA 5JI6A 4L9JA 5F64A 1FT9A 4OIRF 2L54A 1EH8A 3EYIA 4YG2F 3I64A 2WTEA 1JHFA 2O03A 4G8XA 4RGXA 3LAJA 3C18A 5D4RA 4R8HA 2MC3A 3KP5A 2A69F 3MZYA 1OMIA 4YFNF 1ZGAA 2EJRA 2PG4A 5AIQA 2OA4A 3LA2A 2EFWA 3HSEA 2Z3YA 4RB3C 2ZO4A 4UV8A 4CDGA 4A0YA 5DUKA 5JR3A 1KQ8A 4PZJA 3HTSB 4UNOA 4P55A 2UWMA 1R58A 1XGNA 1U78A 1FY7A 5L3CA 5DD8A 1BN5A 1DUXC 2QZ8A 1QO0D 4LLGF 3F8CA 1BC7C 1V3FA 2M30A 1CF7A 2HZTA 1FNNA 4LD5A 3HHGA 3GYHX 2W84A 2L4MA 2M8EA 2DQLA 2WWYA 3GZ6A 4HF0A 3TOAA 1ZGJA 1UFMA 4OMZA 3RKYA 4EGZA 3ISPA 3GW2A 3I71A 1SMTA 4M9ZA 4BXUA 1FC3A 2H6CA 3F8BA 5BPIA 1HKQA 4KIBA 2P5LC 2JSCA 1Z05A 3CUQC 4MEXF