3KZYA

Crystal structure of snap-tag
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
176
structure length
162
Chain Sequence
DCEMKRTTLDSPLGKLELSGCEQGLHEIIFLGAAVLGGPEPLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYSHLAALAGNPAATAAVKTALSGNPVPILIPCHRVVQGDLDVGGYEGGLAVKEWLLAHEGHRLGKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SNAP-tag structure
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords SNAP-tag
total genus 47
structure length 162
sequence length 176
chains with identical sequence B
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2009-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3kzyA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 3kzyA01
2GQQA 4CICA 5TRDA 2V79A 4IF4A 4EJUA 2XRNA 2BGCA 1FBQA 3BP8A 3I4PA 1YFHA 5FO5A 2L54A 3PFIA 2VBWA 5BOXA 2QWWA 3GW2A 2R3SA 2Q0OA 2M45A 4RB3C 4UV8A 4KDPA 3EYYA 4FX0A 4WK8F 1FYLA 3E5UA 4BNCA 4HAMA 5ICCA 1W4MA 2BV6A 3BDDA 3GFLA 4WX9A 2W57A 2HKOA 1RUNA 2P7VB 2HYGD 2UXNA 2L02A 3IL2A 1IN5A 5LEJA 3RKYA 5DUIA 5K1YA 1YQAA 3F3XA 1FZPB 3GZ5A 3V8KA 4XLPF 4H0EA 1RZ4A 3JAMZ 3MZHA 5LBQA 1YW7A 4IRHA 5HLHA 3SZTA 2PMHA 1XGMA 1MZBA 3TO7A 4MHGA 1I1SA 1F4KA 3VOEA 4RGRA 1R36A 3FX3A 3W6JB 1W7PB 1DPRA 3U1DA 3IHUA 5L3BA 1BJAA 4HDVA 1IF1A 3GYHX 2ZNYA 2HFHA 4MEXF 3ERED 4ZYHA 2UZKA 3FF5A 1YW8A 4A0XA 4A2UA 3LAPA 3TDZC 3I54A 2LKPA 1SD7A 4A6DA 4XRFA 5LHGA 4IRGA 2IA2A 2O6GE 3O6BB 1PP7U 3ABTA 3M1EA 4MQVA 4WXCA 1H9GA 2W84A 5LHIA 5E8GA 4U7BA 1KQ9A 4GYIA 2QQAA 3MCZA 2VC1A 2HOEA 4LLLA 1VTNC 1Z91A 5L3DA 5HS8A 3HRMA 2CFXA 3IWFA 5JHUA 2K4JA 3PQJA 3RIRA 4XSZF 1DP7P 5LHHA 4A5NA 4I02A 3TGNA 3LSTA 2CG4A 2A07F 5DUKA 3T8TA 1XN7A 2NNNA 4NQWA 3I53A 5L3GA 4BYYA 4ENNA 1O7FA 1Y0UA 5D5UB 1R00A 1HW1A 4M71A 3LA3A 1MJAA 4XBFA 4NB5A 4HF2A 3WTVC 2JPBA 1WRJA 5ICFA 1P2FA 3VFZA 2DK5A 5FFXA 4YG2F 3B73A 1E2XA 2MA3A 5KK1A 1RUOA 2UWMA 1XMAA 1D5VA 2NNYA 1SFEA 4EJVA 5DDGA 3JTGA 2RV8A 1XSVA 2M87A 3GO5A 4PGGA 1ZAOA 3E6DA 2IA1A 4EV0A 4YIIA 2OAZA 2RQPA 2K86A 5DCFA 3TO9A 1ZRFA 3GEZA 2XAFA 1DDNA 5LGNA 3WGHA 4JQFA 5FB2A 4R1HA 3WGGA 2RDPA 3I59B 3DQVC 2DI3A 1KU3A 3COAC 4BAYA 1OR7A 4U88A 2GIVA 1USTA 3Q9VA 3E6CC 4AVPA 3F8CA 4G6DA 4KMFA 1ODDA 2P8TA 3QP6A 2KIMA 4U0VA 2D1HA 3C1DA 4Q5SF 1WSUA 2EA4A 3KZZA 1LDDA 1KU9A 2HWVA 1K6OA 3CUOA 4PGHA 3F21A 1FYKA 3KP2A 3H3ZA 5D6FA 4AD9A 5JI6A 1SMYF 4ASNA 1SD5A 2HYFA 4RB0A 4KIFA 1T39A 4HZFA 2DU9A 2FXAA 1H0MA 3GFMA 4Y13A 1BIBA 2ELHA 3QOPA 3TOBA 4OOIA 2H6BA 2FBKA 3R0JA 3GZ6A 1MDMA 1ZG3A 3WGIA 2OQGA 5CYVA 1KYWA 4LD5A 1O7LA 4LLGF 5LRSA 4RGUA 3TDUC 1P92A 2E1NA 2G7HA 3GWZA 1HKQA 5F1RA 1EH6A 3GVAA 3HTSB 1T98A 4HOBA 3GLXA 2F5CA 3AAFA 3WTZA 3DF8A 1HKSA 2H09A 3P9IA 3VEPA 1FBSA 2RNJA 2EWNA 2LSOA 4GO1A 1P4AA 1OPCA 3E6BA 4B8XA 1UHMA 4EMSA 3BJ6A 4LJZF 5LEKA 2M1BA 1J9IA 2DPUA 2VN2A 1ZGJA 3PQKA 1XMKA 4G94A 5E1ZB 2ZO4A 1BC7C 3LQQA 2XROA 5A2QK 4AIJA 2QBYB 1FSHA 4L9JA 5JR3A 3WTTC 3CDHA 2VXZA 4XSXF 4RAYA 1YS7A 2COMA 2EV5A 2P5VA 1EH7A 2EV0A 5FD6A 1S3JA 4ZYEA 4G9YA 2W24A 1F1ZA 2C6YA 2A3SA 3KFWX 2VE8A 4OIOF 4RB1A 3DV8A 3HYIA 2F5EA 3R6SA 2CO5A 1IZ1A 2PG4A 1HKTA 4LK0F 4E70A 1BC8C 4I09A 5CVRA 3RYPA 1BOAA 5ILUA 2IRFG 5HS9A 5E1XA 1G3YA 1MKMA 4I0AA 4CDGA 5FD5A 3WTUC 4LB5A 3I64A 2D2WA 2OZUA 3JAMK 3T0YA 3T1BA 5CVIA 4HQEA 3EETA 2KJBA 1B6AA 1R1TA 3C3WA 2Z99A 1KA8A 2PMUA 1KYZA 1LQ1A 1P4WA 5HDKA 5DV5A 3DP7A 3B02A 2TDXA 3CLOA 1WQ2A 3M8EA 2OZ6A 4A0ZA 3KP7A 5D4SA 4ENMA 1G4DA 3QPHA 3F22A 2DQLA 5E20A 4HV6A 4P96A 4YFKF 2R7FA 4IXAA 5J8FA 4UUVA 4ZZDA 4HF0A 1QGPA 1ZREA 4A0YA 3RKWA 5EEHA 3EQLF 3N4MA 4QLCU 3KLNA 2Z9OA 1JHHA 3QU6A 2PI0A 4Q48A 3G73A 3M9AA 5IT9K 2QLZA 4HX7A 3EDPA 5DEQA 3ECOA 1S7AA 1R7JA 1K78A 1FBUA 2EFWA 4IHTA 2FOKA 1TNTA 3WTSC 2EFNA 2F5DA 1J0RA 4RGXA 4MTDA 4MTEA 2H94A 2NYXA 4LMYA 2JZYA 3FWEA 3NEUA 2PN6A 1W5TA 2L4MA 5J6XA 2AXLA 3M7GA 2ACJA 2P6TA 1YO5C 2LNBA 2M8EA 3HTUA 5DCMB 4MNUA 3BROA 3ISPA 4LB6B 4HLXA 2EB7A 2EJRA 2GZWA 2PLYA 2DO7A 2QYOA 3R0AA 4KT5C 5HOOA 3GX4X 1ZHFA 2ISYA 1UB9A 1IRGA 1J5YA 2BYVE 5E18F 2VONA 2ZXJA 2Z33A 3P9KA 3C18A 3J81Z 4KN7X 1S29A 2DFIA 2YR2A 2A68F 5K5QA 3F8NA 3IRQA 1ZG5A 1EV7A 3WTXC 1K78B 2M5WA 3BPVA 1UHWA 5ILSA 3FXUA 3D0SA 3U9GA 4U7DA 2GA2A 4EJWA 2WTEA 3WG9A 4WWCA 3K0LA 2KJCA 2LDUA 3WTYC 3F6OA 4KN4X 5TJJA 3K1NA 4HF1A 3OV8A 1ZN2A 5LRRA 2Y0MA 2XIGA 3H3UA 5HVQC 1TBXA 3JW4A 1LJ9A 2MD5A 3J80Z 4AIHA 4MEYF 3FXQA 3I71A 2DLLA 3LAJA 2HS5A 3J7AO 2IA0A 2HKXA 1W7PD 4B09A 1FNNA 3HUGA 5ED4A 3E97A 1Z6RA 3P7NA 5BS6A 1RIOH 1PP8F 3P9CA 4M73A 2VE9A 1XD7A 3RDIA 3ZPLA 4UVCA 3F23A 4RAZA 4YIFA 2XUBA 3BJOA 2RKHA 3FMSA 2YSRA 3F72A 5IT3A 4HBLA 3RKXA 3MEXA 2QQ9A 5HLIA 3NRVA 1U5TA 1FX7A 3F8BA 2XAGA 4Y15A 5D4RA 1ZH5A 3KE2A 3ROUA 4EM0B 4PDKA 3FMQA 1WKMA 4KFCA 4CO8A 1LVAA 3HRUA 1G3TA 3IWZA 2VT2A 3C7JA 4DNCA 2CW0F 1FC3A 5JVTA 2F5FA 3R60A 4WXHA 1LEBA 1ON2A 3KLOA 3K1PA 2O3FA 1BN5A 2CQKA 3T8RA 1JE8A 3TKYA 3LA7A 2DK8A 1FPQA 3HOSA 1SD4A 1TQPA 4ENJA 4GCVA 1X3UA 1YTYA 1ULYA 2MBFA 2K27A 4G7OF 3CTAA 3IKVA 2K7LA 2EFPA 2Z3YA 4HX4A 1CF7B 1Z1DA 1XGNA 2PFBA 1LB2A 1R1VA 4AWXB 1MD0A 1XDUA 2IVMA 2X0LA 2Q8KA 1JGSA 4R79A 3IRRA 3KP3A 4PZJA 3E5QA 5CVUA 2A61A 3V8LA 3W6KB 3EYIA 2HQRA 2OBPA 2PQ8A 1Z7UA 1Q1HA 1XSDA 3IKTA 4UXNA 4P5OA 2HZTA 1BIAA 1PUEE 5L3CA 2QQBA 2ZBKA 1MDMB 4ENKA 3WTWC 4OIRF 4UVBA 1HQCA 5H6QA 2VBXA 3MFKA 2RC4A 3ELKA 2Y48A 3FXRA 1ZARA 2WV0A 4OIQF 3GXOA 2B0LA 1O3RA 4OMYA 1FLIA 3QRFF 1R22A 2J5OA 1ZGAA 1C0WA 5H6RA 3GFIA 2IP2A 1U3EM 1AOYA 2DBBA 2OQRA 4N0BA 4FHTA 3RPQA 1YW9A 6PAXA 1IRFA 4EM1A 4HV5A 4G6QA 5ERIA 2J5PA 2A5YB 4S05A 2P4WA 1HXDA 1TTYA 1O57A 4O5VA 1MGTA 4KUMA 1Z9CA 1LDKB 2PBIA 3L7WA 2FBHA 4DQ2A 2FEZA 2MC3A 4U0YA 1RNLA 5BMZA 1W5SA 1FOKA 1ONVA 2D1VA 4ESJA 1B4AA 3QU3A 1IW7F 3DKWA 3LWFA 4OIPF 1BI1A 4GYGA 2V1XA 2O03A 3F8MA 1A04A 3HHGA 1SMTA 4CHUA 1SAXA 1T38A 2NS0A 3MZYA 1NHAA 1ZLJA 3KCCA 1HBXG 2QBYA 1G3SA 1QBJA 2V1UA 2CWEA 2MH2A 3MQ0A 1J7KA 3ZMDA 4RS8A 2BBYA 5ICEA 2EFQA 3J80K 2XAJA 1MJBA 3V4GA 3Q5FA 1FYMA 1U6GA 3ZMUA 1B1BA 3REOA 4M74A 1I6XA 2PJPA 1FSEA 1U5TC 2UXXA 5CVJA 3BPXA 3KP5A 3TOAA 3WE3A 4N9IA 4YFNF 3KEOA 4EVIA 4Z2YA 4FX4A 3MAJA 1B9NA 5DD4A 3DEUA 3V7RA 1GVJA 3CJNA 1WWXA 4L0ZB 4A12A 2A6HF 2X4HA 3JTHA 1D8JA 4O6JA 1FP1D 4ON0A 2RVCA 4IVNA 2FRHA 4EQQA 1GXQA 4EM2A 2L3DA 2L4AA 1J75A 2RGVA 4I0BA 2ZFWA 1XB4A 4WXDA 2JPCA 2HEOA 2IJLA 1MJ9A 1BI3A 4MGRA 2XAQA 5F64A 1B9MA 2NRAC 5AIQA 5ICGA 4OMZA 1XCVA 3SXYA 4ZYDA 1TNSA 1B59A 3F6VA 2ZMEA 2DW4A 4JK1X 1IAWA 1P6RA 3I5UA 2P6SA 1OMIA 4L0YB 4LG0B 5HLGA 2QM3A 4KA4A 2GAUA 2Q2EA 5FLXZ 2XKOA 1ZRDA 1O3QA 3KZYA 4I01A 2G9WA 1QO0D 1YYVA 3CUQA 1ZYRF 2VODA 2ESHA 5L3FA 3WODF 2W25A 3M8FA 1KGSA 3RPUA 4L9NA 1R23A 3SQNA 5IT9Z 4L5IA 2ETHA 2YX7A 3JSPA 4IPAA 4LFUA 1OYIA 1USSA 5JFRA 4M9SA 1HW2A 4HYEA 5BQTA 1XGSA 3BWGA 2BE5F 2XGXA 5J8CA 3FZVA 4LLNA 2V6CA 1YIOA 1UFMA 4IJAA 3V7CA 1D8KA 3SFZA 3EUHA 4A6EA 1AWCA 1HSTA 2EFOA 1I27A 1BI2A 2ZNZA 2R7DA 1ZG1A 4EJOA 3ZN0A 1F5TA 4KIGA 2P7CB 3K9TA 3KP6A 2STWA 3K2ZA 2KIFA 4ZZLA 2BEOA 2A6EF 2FMYA 2HR3A 3RJPA 2ISZA 3T5XA 5D5VB 5CJ9A 5KVRA 2FQ3A 1QPMA 2P5LC 3KETA 3BZ6A 3ZMVA 4XLNF 2GWRA 4ZH4F 2K4BA 4LK1F 4FT8A 3WU0A 4AIKA 2MLGA 2MH9A 5H20A 2OA4A 5AONA 1CF7A 5DD8A 2EA2A 1XDSA 1I1GA 2L01A 4UHTA 4GGGA 4EGYA 4UVAA 1IUYA 3DFGA 1HSJA 2OU2A 4G7HF 4YFXF 5D5WB 4KMUX 2ZJ2A 3DPTA 1GXPA 4TV7A 4EJTA 3L2CA 2FMLA 3L9FA 3ULQB 1RI7A 3ZMSA 3QAHA 4KICA 4RGSA 2G7UA 3CUQB 1HW5A 1XSXA 1KQ0A 1PDNC 3WE2A 2VC0A 1DPUA 1XCBA 1FWZA 4LG0A 4ESBA 1U2WA 3O2PE 1QNTA 2FU4A 3J81K 3ZMZA 2ADUA 2HGCA 3F8FA 2ZMEB 2P5KA 3WU1B 3HIFA 1R58A 3G3ZA 1YLFA 1Z05A 2XAHA 4OU0A 1TQIA 4HQMA 3CO6C 1SD6A 3OOPA 2V1DA 1EH8A 4RB2C 3DXJF 2DQRA 4Q47A 2KIUA 2OD5A 1ON1A 2RN7A 2JTVA 4WF2A 1K7AA 2HQNA 1YS6A 2WC2A 5DCMA 2ZKZA 3HSRA 1IN8A 4N9HA 4IHSA 4KNYA 2PEXA 2VBZA 1G6NA 4O3MA 1LNWA 2IPQX 4BH9A 3FMRA 2LF8A 3HSFA 2XKPA 1U78A 4OINF 4F7ZA 4BXUA 4HW0A 3RTRA 4K2EA 3L09A 4ETSA 1XGOA 5BPDA 4G7ZF 5EEGA 5L3EA 4EGZA 1JXSA 2CGPA 5E1WA 3GFJA 5E17F 1OYWA 3RYRA 1T0FA 5K5RA 1STZA 4I98B 5FFZA 1CGPA 1T2KA 3K69A 1R5HA 3QP5A 1O3TA 1O3SA 1J59A 3S2WA 1L3LA 4I2OA 5HDNA 3HRSA 3LQRA 4HX8A 4M72A 2MLKA 2W85A 2CSOA 4M6XA 5HS7A 4R8HA 4BHPA 2LF7A 2E7XA 3ZN1A 4HA8A 3DPLC 5F6FA 5BPIA 3CO7C 1ZLKA 3ZMTA 1KQ8A 5CLSA 3BJAA 3HSEA 5ILVA 4L18B 2YPRA 4CXFA 1FP2A 2E7WA 1R5GA 1IXRC 1BBYA 2H27A 3SHFA 5CVVA 3ZQ7A 4CGZA 1S6LA 1W7PA 3VB2A 3FHZA 2FNAA 4QWQA 4M9ZA 4M9XA 2DTRA 3MWMA 5DYMA 3V8JA 1WI9A 1Z6TA 2XVCA 2WWYA 1QQIA 2IT0A 4LGWA 1KU2A 5A2QZ 3FM5A 4P9UA 3I0TA 2GXBA 1JHFA 3E3VA 3HRTA 2HTJA 5K5OA 1TW2A 5D8KB 1IN6A 2DPDA 4ESFA 1BI0A 4P55A 2KKOA 2FNPA 3E5XA 5AIPA 2ESNA 4S04A 4L5JA 1U5TB 4KIBA 4GXOA 2DAOA 3QPTA 2XHKA 2HDCA 2YU3A 3KEQA 2QZ8A 2K02A 3LFKA 5LLQA 4NHJA 4I7HA 1FT9A 4Y17A 2ZCWA 1FY7A 2FSWA 1TW3A 2YX4A 2XV4S 2QUFA 4Q4ZF 1LEAA 1YG2A 2V9VA 4KYWA 4M6YA 1D3YA 3RI4A 1G3WA 4L9VA 2FF4A 4CZZA 2STTA 4D0PA 1OYYA 4WCGA 3ABUA 2FE3A 3BY6A 3O3KA 2JSCA 2GA1A 3Q9SA 1H9TA 4PCQA 3TO6A 1QZZA 4CYDA 5D5XB 1OKRA 2Z5UA 2VOPA 1TLHB 1J2XA 2CYYA 3CUQC 2GXGA 4HDUA 4U0WA 1L0OC 3K1MA 4HLYA 3R61A 3LA2A 2IW5A 5HDGA 5LGTA 2H6CA 5FLXK 3BOQA 4P9FA 2AS5F 1REPC 1F9NA 1R1UA 1KU7A 3TQNA 1ZRCA 4MQ9F 3V7SA 3FM3A 3GUDA 2E1CA 1IXCA 1IXSB 2QENA 1P4XA 3GF2A 2O8XA 4A5MA 1S7OA 1K79A 3HHHA 1E17A 4BHCA 3E6MA 1U8RA 1QZYA 2M30A 1GHCA 4L9TA 3ECHA 1TQMA 2VOOA 3ML6A 1IN7A 2EK5A 1I5ZA 1T6SA 2F2EA 4IRIA 2O0YA 4BQAA 3N97A 1IN4A 2A69F 2XASA 3L00A 2VBYA 3D5LA 2NAZA 2KRFA 3HOTA 1BM9A 4G8XA 5D8LB 2HTSA 2FBIA 5FGMA 5E8IA 1V3FA 2JT1A 2Y75A 4UNOA 4JBAA 2JRTA 3I58A 3JSOA 2O61A 2QVOA 5LGUA 3I59A 1LDJA 3H92A 2FA5A 4UV9A 1SFXA 3ZP5A 4ZYGA 1UCRA 3VODA 1DUXC 3IC7A 3KP4A 2DT5A 1V4RA 2D45A 4BHBA 1S8NA 3U2RA 2VT3A 3NQOA 3SZPA 1SFUA 3R4KA 5D6EA 2EV6A
chains in the Genus database with same CATH superfamily
2GQQA 4C2MJ 4CICA 2LOOA 5A6BD 5GADJ 4R8OA 5TRDA 2V79A 4II3A 4IF4A 1ZR4A 4I76A 4EJUA 5FLVA 2XRNA 4QTRA 2YTDA 2BGCA 1FBQA 4BJ5C 3BP8A 2QF7A 4WSPA 3UR3C 3I4PA 1YFHA 2EOJA 5FO5A 3AL0B 2L54A 3PFIA 2VBWA 2DB2A 4HNTA 5BOXA 2QWWA 1YZ9A 3GW2A 2R3SA 2LBSB 2Q0OA 3GZNB 2M45A 3IH4A 4M3GA 4UV8A 4RB3C 4KDPA 4X66E 2DA2A 4NC8A 3HOXJ 3OYHA 3J7ZI 3EYYA 4FX0A 4WK8F 1FYLA 3E5UA 4XRMA 2VJJA 2UXDE 4LTYA 2EN7A 4BNCA 2FJ1A 3HGYA 4HAMA 5K7HA 5ICCA 2V88A 2WBTA 1W4MA 2O7OA 4FQGA 2BV6A 3K4KA 3BDDA 3GFLA 1GV2A 4WX9A 2W57A 2HKOA 4R2SA 1RUNA 2P7VB 4Y52J 2HYGD 3HOWJ 4P1WA 2UXNA 2L02A 3IL2A 4O43A 2UUZA 2W7NA 3LSRA 1IN5A 1MMDA 5LEJA 3RKYA 5DUIA 9ANTA 5K1YA 3ADLA 1JTXA 1BR2A 3IAS2 1A1FA 1YQAA 3F3XA 1FZPB 4FK5C 3OS0A 3GZ5A 1LUJB 3V8KA 4XLPF 3CESA 5J1YA 4H0EA 2VF1A 1RZ4A 4HEIA 1N32E 5CKTA 3JAMZ 2CPNA 2YTFA 3MZHA 5LBQA 2HQAA 1YW7A 3HC7A 5JHFA 3FXLA 2DMIA 3BZKA 4IRHA 2HOSA 2RTXA 5HLHA 4BJ6C 3OYBA 3SZTA 1Y1VJ 2B63J 5A6BA 5IP7J 1IRZA 2PMHA 4JI0E 3OYEA 1XGMA 5TGTA 2BVMA 1LKXA 5GAGJ 2FTXB 2QQ8A 5B1BH 1MZBA 3LLHA 5EF6A 3EPHA 2N8GA 1ORKA 4XKVA 3TO7A 2EZLA 4E6KG 4MHGA 2QKMB 5KAFC 1I1SA 5H2FC 1F4KA 2XAUA 3T1HE 4F52A 3GTMJ 3LL7A 3VOEA 4RGRA 1R36A 3FX3A 4JI4E 1IMUA 2E35A 1KONA 3W6JB 4XM3A 1W7PB 2DFEA 2DMQA 1DPRA 2EMBA 4HEA2 1TZLA 5TSEA 3U1DA 2ODRC 3IHUA 1YX5A 1UAAA 5L3BA 1BJAA 2BVLA 4LIUA 1TWCJ 4XOTA 1YRNA 4A3GJ 2LLKA 5M5WJ 4HDVA 1IF1A 2LV2A 3GYHX 2LH9A 2ZNYA 2HFHA 4U87A 3VYXA 4MEXF 3ERED 2UV1A 3H9QA 4ZYHA 2V85A 2EIJH 4DR4E 2UZKA 3FF5A 2L9SA 1YW8A 2IGNA 4X65E 4A0XA 4A2UA 3LAPA 3TDZC 3I54A 2VQFE 2LKPA 3FKIJ 4RAGA 1SD7A 4A6DA 4XRFA 3GTOJ 1W0TA 4CCLA 2HVRA 2XGCA 5LHGA 1PJRA 4ZTJA 1BW5A 4IRGA 2IA2A 4HG2A 3AL0C 3ERMA 2UXCE 2O6GE 5EGOA 5J3LA 1OCZH 3O6BB 1PP7U 2CT1A 3ABTA 1JUMA 3M1EA 2MD0A 4XRSA 1GVDA 4MQVA 4WXCA 1J09A 1H9GA 2W84A 5LHIA 3AG3H 3GTQJ 3QYFA 4XICA 5E8GA 2NVTJ 1JT6A 4XLCA 2LFBA 3C4BA 4U7BA 1KQ9A 3MKYB 4GYIA 4XIDA 4YY3E 2KIQA 5IT9C 1A35A 3PO3J 2QQAA 3MCZA 2VC1A 2GLIA 2HOEA 4LLLA 4BE2A 1D0XA 5AE1A 1B69A 1VTNC 4DYRA 1SAUA 1Z91A 5L3DA 2VQGA 5A6KA 2IS1A 1SANA 2Y31A 5HS8A 2QA4I 3CCJI 4CCMA 3HRMA 2CFXA 3IWFA 3MMYB 3HUGB 5JHUA 2BY2A 3ZRGA 2YTIA 4MLQA 1ETVA 2K4JA 4F93B 3PQJA 3I9V2 3RIRA 4I99C 2KHMA 1DQ3A 4LITA 2EJ4A 3LSJA 2W48A 3OY9A 2JWOA 3KYLA 4XSZF 1DP7P 5LHHA 4A3IJ 4A5NA 4UY8I 5KL5A 4I02A 1MNEA 4CCOA 3HM5A 2KRCA 3TGNA 3LSTA 1MH4A 3OR1C 2CG4A 2H8WA 5DUKA 3T8TA 2A07F 1XN7A 2NNNA 2VKVA 3IUOA 1T33A 2EOFA 1ERDA 1VQ9I 3K4LA 4NQWA 4UUSB 4PJLA 3I53A 1R9TJ 5ADZA 5L3GA 3VSLA 1UHSA 2KONA 2LVSA 4BYYA 4ENNA 1O7FA 4XKCA 1Y0UA 5D5UB 1R00A 1HW1A 4M71A 2DOAA 3LA3A 1MJAA 4XBFA 5GTHC 3S15J 3BIDA 4NB5A 3PIOF 4HF2A 3WTVC 4BQOA 2JPBA 1G2DC 4L5NC 1WRJA 5ICFA 2QSGX 1P2FA 3VFZA 2EOYA 3ZGKA 2V86A 2MC5A 1K61A 2CH0A 2DK5A 2E2HJ 5FFXA 4YG2F 3C2HA 3B73A 1E2XA 2MA3A 5KK1A 1N33E 2VJ4A 3HZJA 1RUOA 1XMAA 2UWMA 4ZDOA 1QHGA 1D5VA 3OYGA 2NNYA 1O4XA 1SFEA 4EJVA 4YIRX 5DDGA 3HL2A 3I55I 3KYDB 4ZDPA 3JTGA 2KDZA 2V83A 2RV8A 1XSVA 2M87A 3GO5A 5GAHJ 4PGGA 1G2HA 1ZAOA 3A0BC 1P7IA 3E6DA 3WU2C 1IQOA 2IA1A 5DM7F 4R03A 4X1EA 3MKLA 4EV0A 1B72A 1R5ID 3HG9A 1IDYA 5E3OA 2X1DA 2V9KA 4E7ZA 2EM9A 4YIIA 2JVGA 2F48A 2OAZA 2RQPA 2K86A 3TQMA 5DCFA 2JVHA 3TO9A 2K9LA 5FJ8J 4OAYA 3M1CA 1WHQA 1ZRFA 1YHQI 3QWLA 3GEZA 3PIPF 2XAFA 1DDNA 3TW6A 5LGNA 2XPVA 3WGHA 1GDTA 4JQFA 4PUSA 5FB2A 4R1HA 3WGGA 2RDPA 3I59B 4DV5E 2EPZA 3DQVC 2DI3A 1KU3A 4CA0A 5KHDA 2O9LA 3COAC 2FV4B 4GKJE 4BAYA 3ADGA 1MBGA 3MD2A 2EOMA 1OR7A 4U88A 2GIVA 1USTA 3BR5A 4K0KE 1Y8QB 3Q9VA 3FXKA 5EG0A 1TN9A 3E6CC 4OX9E 4AVPA 3F8CA 4IL6C 4G6DA 2X85A 4KMFA 1ODDA 4M6VA 2JJ7A 2P8TA 3QP6A 2JPAA 3ABLH 2KIMA 4U0VA 2XB0X 3FK7A 2D1HA 2EMHA 1F2IG 3C1DA 1FJLA 4Q5SF 1WSUA 2YRMA 4BE0A 3A0HC 2XPUA 2EA4A 1TWHJ 1LDDA 3KZZA 2DXIA 1X49A 5LMNE 1KU9A 2HWVA 3G1MA 1K6OA 3CUOA 1QVTA 4PGHA 3F21A 1FYKA 2PRTA 4IOCF 2X6YA 3KP2A 1W0UA 3H3ZA 3ZQFA 1H89C 5D6FA 3PSIA 4AD9A 3TL4X 4XLEA 5JI6A 1SMYF 3FISA 4NC7A 4ASNA 2YTPA 1SD5A 5A6JA 2HYFA 1XG1A 1V5GA 2Z16A 2FX0A 4NDLA 2R5YB 5IYDJ 4RB0A 4X8WA 4KIFA 1T39A 4HZFA 3U21A 2DU9A 2FXAA 5FROA 1P9QC 4LIVA 4QIWN 1H0MA 1HOMA 2DIXA 3GFMA 4Y13A 4CZCA 2O8KA 1BIBA 1R4MB 1Y56A 2ELHA 4XKBA 5B1AH 3QOPA 3TOBA 2XDVA 4ZJZA 4JI5E 3JCUC 3RCOA 2HVQA 2IGMA 4OOIA 2CV0A 2IXSA 2K3FA 2KPMA 2H6BA 2FBKA 4FE4A 3BG6A 3R0JA 3GZ6A 1MDMA 1ZG3A 1E3OC 2OQGA 3WGIA 5LMUE 3VSKA 1ZAAC 1G59A 2JY9A 1QU3A 4MLOA 2HU9A 2NVYJ 1VNDA 1IJWC 5CYVA 2R5ZA 1FMVA 1KYWA 3ABMH 4LD5A 4A3FJ 2O5RA 4CYCB 1O7LA 1KYQA 4LLGF 5K7FA 3J7AG 2M0CA 1HA8A 5LRSA 4RGUA 3F9KA 2EOQA 3TDUC 1KJKA 4BKXA 1P92A 2E1NA 2G7HA 3GWZA 3OMYA 3S8PA 3JRAA 4DKKA 1HKQA 4Y33A 3TW7A 5F1RA 2VKDA 1EH6A 2JA8J 3GVAA 5F0CA 3RQIA 1UMQA 3Q0WA 2TCTA 5JLXA 3ZQLA 3HTSB 1JUPA 1T98A 5FLMJ 4HOBA 1IQSA 3GLXA 2F5CA 3AAFA 3WTZA 4I8OA 3A4CA 1S5LC 3DF8A 4QPQA 2LRDA 2HDDA 1HKSA 2H09A 3OYAA 1A36A 3P9IA 3VEPA 3E1SA 4N4RB 1FBSA 2BHYA 4LF9E 3HKZA 1R71A 5FRNA 2EPAA 2RNJA 2EMFA 1MMGA 2EWNA 2LSOA 1ETKA 4GO1A 1ZELA 1P4AA 4IEJA 1OPCA 2MC6A 2LKSA 3E6BA 1D0YA 3K4NA 2EQRA 3CCRI 2YTQA 4B8XA 4TUIA 1Y1WJ 2LCEA 1UHMA 3S1MJ 4EMSA 3BJ6A 4LJZF 4BE1A 1WJBA 4DR7E 2A05A 5LEKA 2HC5A 1MW7A 3UK3C 2WB1N 2M1BA 4XN3A 1J9IA 4IHXA 2DPUA 3F6HA 2VN2A 4DYQA 2K85A 1ZGJA 3PQKA 1FKAE 3CF5F 3OIQA 2JP9A 1XMKA 2GIZA 3B6AA 3K4JA 2ZO4A 4G94A 5E1ZB 3L2RA 3RZOJ 1PJSA 2RSMA 2YRHA 1BC7C 5BR8E 3LQQA 2XROA 5A2QK 4AIJA 2HOTA 2QBYB 1FSHA 4L9JA 5JR3A 2R7UA 3WTTC 3CDHA 5M5XJ 3B6CA 3PM1A 5EGOB 3OS1A 2JUCA 2E72A 2VXZA 2LRSA 2B9SA 4XSXF 3A01B 4RAYA 1Y0NA 4FCYA 2ME0A 1BR1A 1YS7A 2COBA 2H1KA 2COMA 2EV5A 2P5VA 3HDDA 2YRKA 1EH7A 2EV0A 5FD6A 3CMEI 2RSIA 3KIOA 1FOWA 1S3JA 4ZYEA 4BCAA 2DOFA 4G9YA 1E0EA 2JOXA 2XPWA 2PX9A 2W24A 2Y0SN 3HGGA 1F1ZA 2C6YA 2A3SA 3CC4I 3KFWX 3ZQGA 1IDZA 2E5NA 2VE8A 4OIOF 2F4IA 4XK4A 2NA2A 4RB1A 4C2TA 4IJDA 1ETWA 3BR2A 3DV8A 3HYIA 2F5EA 4C30A 1B8IA 3R6SA 2CO5A 1X4PA 2X48A 2ZSIB 2PJRA 1IZ1A 3UKGA 4P7DA 2H1LA 2PG4A 4F91B 1HKTA 2ZM6E 4LK0F 1UJ8A 4E70A 1BC8C 4I09A 4NUBA 5CVRA 1EKEA 3RYPA 1BOAA 5ILUA 2IRFG 4DV2E 5HS9A 1PJTA 5E1XA 1G3YA 1ZBQA 4HPQA 1MKMA 1K4TA 4I0AA 1MMSA 4CDGA 3QYBA 5FD5A 5FKKA 3WTUC 4LB5A 3I64A 1RC7A 1LVKA 1X3CA 3FIWA 3I56I 2D2WA 3W3CA 2OZUA 3JAMK 3T0YA 3T1BA 5CVIA 3AKZA 1MNMC 4HQEA 3EETA 2KJBA 1B6AA 1X6EA 3VHTB 1VFCA 2CQXA 4JP0A 3LMMA 1R1TA 3K10A 2ZJPF 2UU9E 3BR3A 3C3WA 2VPLA 2MFZA 5TISC 2Z99A 1KA8A 1FTTA 2I13A 2PMUA 3PUFA 1I6HJ 1KYZA 5EZGA 1LQ1A 4UB6C 2L2KB 1P4WA 2BXZA 2RNGA 3IH2A 5DV5A 2DMUA 2NS8A 3DP7A 5HDKA 1PDAA 1FMWA 2PMZN 3B02A 1TC3C 2EPPA 2HGHA 2KLOA 2TDXA 2JVAA 4HNUA 3VK6A 3CLOA 5AASA 2Y69H 2ZC2A 1WQ2A 3M8EA 3S1RJ 2QSHX 2OZ6A 4A0ZA 1IG7A 4BXFA 4BDZA 3KP7A 5D4SA 4ENMA 2DRPA 3DTEA 2Q8UA 4V2FA 1I94E 1G4DA 4R2EA 4BC9A 3QPHA 4JX4A 3F22A 2DQLA 3FK6A 2DT6A 3V42A 5E20A 1SC7A 2EPKX 3LSGA 5EYRA 5F27A 4HV6A 2JYAA 1U9NA 1N78A 4P96A 1T4OA 2DLQA 1MBFA 3FXJA 4YFKF 2CQQA 2YU8A 3KZIC 3CDLA 2Q1ZB 3A2KA 2A6TA 2R7FA 4IXAA 5J8FA 4E7IA 4UUVA 2VL8A 1X47A 1JT0A 1TWFJ 4ZZDA 1X1DA 1X48A 3L2WA 4HF0A 1QGPA 1ZREA 4A0YA 4M3DA 3ZQQA 1TP4A 3RKWA 3AV0A 2XGDA 4O5GA 2NVQJ 5EEHA 1UG0A 3AG2H 3EQLF 4EEFG 3N4MA 5B5EC 2LYCA 3BT9A 4QLCU 3KLNA 2Z9OA 1A1GA 1JHHA 2KQRA 2EINH 3LSMA 3NARA 3QU6A 2G0EA 2IEKA 2EN4A 1D1AA 4E7KA 4DV6E 1HR0E 2PI0A 2BXYA 4Q48A 4RA2A 3M4OJ 4BEHA 1HC8A 2MW8A 1HNWE 3G73A 2JK3A 3M9AA 2M9AA 5LL6R 3VYYA 1K6YA 3DJWA 2MGQA 2CW8A 5B66C 3EPZA 1K4SA 5IT9K 3OMLA 4IHYA 2QLZA 4JOMA 4HX7A 3EDPA 4BMJA 5F0HA 5DEQA 3ECOA 1S7AA 3VWBA 1R7JA 4S0HB 2EOOA 4II2A 3W2WA 1K78A 4X6AJ 2R7QA 1FBUA 2KFDA 3CP2A 5BNGA 2EFWA 3EPLA 1VQLI 1AH5A 4IHTA 3ECRA 2FOKA 2R7XA 3J81C 3LSIA 5E3NA 3JTZA 5IY5H 2WZOA 2V26A 1TNTA 3CD6I 1P47A 2NXNB 3WTSC 2EFNA 2F5DA 1PUFB 1F43A 2BW3B 2DSYA 1J0RA 4RGXA 3JRIA 2BY1A 1F36A 2RREA 2CV1A 2R7VA 4MTDA 5IXMB 4MTEA 2LBFB 2H94A 3S2DJ 4O24A 1AU7A 1D0ZA 2NYXA 3PFYA 4FTHA 4LMYA 3K70D 2JZYA 4ITVA 1R49A 2EMYA 2QGUA 3QPLA 3IH3A 2LREA 3SDGA 3DEEA 1X1BA 3FWEA 4XLHA 4XKWA 1PVEA 3NEUA 4I6ZA 2PN6A 1W5TA 2H8RA 2L4MA 3SDBA 3HBLA 1SVOA 5J6XA 2AXLA 3M7GA 1A6QA 3W6VA 1ZBTA 2EM0A 3EUHC 2P6TA 2ACJA 3MZ8A 1YO5C 2LNBA 4JI7E 3OIOA 2L9RA 3KYCB 1MMNA 2CUEA 2KZVA 2NVUB 2NVXJ 2M8EA 4BY7J 1MSEC 3HTUA 1ITYA 3S3NA 2UUCE 5DCMB 3VYSB 2EL4A 5J4YA 5GTIC 2YTGA 1DGCA 4MNUA 1UG2A 3BROA 3ISPA 4LB6B 4JI8E 4HLXA 2EB7A 1YIJI 2EJRA 2AQEA 2GZWA 5JLWA 4J8ZA 5CFFE 2PLYA 2E34A 1T56A 2DO7A 2Q2EB 1WGXA 2QYOA 2Y0SA 3R0AA 3LSPA 2QEXI 4KT5C 4C9YA 4TUGA 5HOOA 3GX4X 4E7SA 1ZHFA 2ISYA 3VYRB 2JXPA 1UB9A 2IHR1 1IRGA 2EQ3A 1J5YA 2BYVE 2EZ6A 2JMWA 5E18F 2IS4A 2L8TA 2VONA 3THOB 5IYBJ 2K5CA 2LK2A 5F08A 2ZXJA 2Z33A 3P9KA 3C18A 3C2GA 4FISA 3J81Z 4KN7X 1S29A 2DFIA 3ADIA 2YR2A 3GTGJ 2PJRB 2A68F 5CQEA 1ENHA 5K5QA 1HDDC 3J7Yp 3F8NA 2R1FA 2VKEA 2R7TA 1N25A 3IRQA 1ZG5A 3BBGA 1EV7A 5C4XJ 2M2EA 4DR3E 2HOAA 3WTXC 1K78B 1ZGWA 2M5WA 3K70C 2L2OA 3OYIA 1Z0XA 2DOEA 5F04A 3BPVA 4QSHA 1UHWA 5ILSA 1QPIA 2Y9YA 3FXUA 2LTSA 2DA7A 3D0SA 3U9GA 4XQFA 1TL8A 4IOAF 4L5EA 1APLC 3S1NJ 3THNA 4PFPA 3JRCA 4M0VA 2BBGA 1YJNI 4U7DA 2MKDA 2RQQA 3HKZN 5AE3A 2WAEA 3HOYJ 2AQFA 1XNQE 2GA2A 2VUMJ 1WI3A 1N3GA 4EJWA 2WTEA 4DW6A 4E7LA 2JA7J 3WG9A 2EM5A 2YSPA 3P1XA 4WWCA 3LMLA 1Z3XA 3K0LA 2KJCA 4BDYA 3S17J 2WBUA 2LDUA 3T1YE 4DZPA 3KPHA 3F6OA 4KN4X 3WTYC 5TJJA 1IO2A 3K1NA 1TWAJ 4E7HA 4HF1A 3OV8A 1ZN2A 3PNVA 1Z21A 2JQ7A 5LRRA 5IOZA 4NC6A 3H3UA 2XIGA 2Y0MA 4R2CA 3G2BA 5HVQC 1TBXA 2LBFA 4IHWA 1U8BA 4LF6E 3JW4A 1IGNA 3ZXSA 1LJ9A 2MD5A 4NQWB 3GTLJ 3J80Z 1PUFA 4AIHA 4MEYF 2Y9ZA 4IKFA 3FXQA 2GLOA 3I71A 2EN3A 2DLLA 3LAJA 3JU0A 3CMMA 2E2IJ 2HS5A 2EQ1A 2M7AA 3J7AO 2IA0A 3FHNA 5DS9A 2CUZA 2DFHA 2HKXA 4ABZA 2WY8Q 1W7PD 2V6EA 5CQGA 4B09A 1FNNA 1U9OA 4BXXJ 3HUGA 5M3FJ 1S7EA 2AXTC 2ZXHA 3E97A 5ED4A 1IBKE 1OCPA 1Z6RA 2KP6A 3A1YA 4A3BJ 3P7NA 5BS6A 1RIOH 1GZ6A 3MHSC 3DBHB 3P9CA 1PP8F 4PJNA 1AKHA 4A3MJ 4M73A 1OR7C 1FTZA 1J5EE 3OWTA 2VE9A 1XD7A 4B47A 3RDIA 4KITB 3ESWB 3ZPLA 4UVCA 4ZDLA 1D1BA 1W1WE 1NG6A 3F23A 3FXOA 4RAZA 4YIFA 2E60A 1O0WA 1XMOE 1V54H 1A1HA 2R7ZJ 3ZQIA 2YTNA 2XUBA 3KEYA 4LF7E 3BJOA 2RKHA 4DBQA 3FMSA 4B43A 5F1JA 2YSRA 3F72A 2K40A 5IT3A 2EMWA 2EP3A 4HBLA 3UNGC 3RKXA 4NNJA 1X3ZB 3MEXA 4B4CA 2QQ9A 5HLIA 1XPXA 3NRVA 1LFPA 1U5TA 2EM8A 3BF2A 1FX7A 2LG4A 2HDWA 2CFOA 3H35A 3F8BA 2XAGA 3HTXA 4Y15A 5D4RA 1ZH5A 2HHHE 4W1UA 3KE2A 1ZK8A 3ROUA 4EM0B 4PDKA 3DLAA 3HEFA 1QZEA 3FMQA 4KZSA 1WKMA 4BL0B 1RMDA 4DBRA 3DKYA 5KCMA 4KFCA 2JA5J 2P81A 2F8BA 4CO8A 3OYMA 3DKXA 3QYEA 2EMLA 1S9HA 3DF6A 4RMNA 3CJRB 2ECCA 4ANJA 1VQ7I 3I3LA 1YX3A 1JJ8C 1LVAA 3HRUA 4CCKA 1G3TA 4E4HA 3A03A 3IWZA 5DM6F 2VT2A 3C7JA 3CJTB 4BY1J 4M3FA 4R2QA 4DNCA 2CW0F 1FC3A 3VYTB 2F5FA 5JVTA 3K4BA 1BA5A 1A5JA 2EE8A 3CQZJ 3OYFA 3R60A 4WXHA 1QVUA 1LEBA 1ON2A 4PFOA 2LC2A 3KLOA 4CCNA 2LE2A 3K1PA 4XORA 2O3FA 1BN5A 2EZKA 2CQKA 2JRMA 3RPUD 1YJWI 4DUZE 1JK1A 3T8RA 3S14J 2EBIA 3FBNB 1W36D 1JE8A 2E5LE 3TKYA 1YOVB 2IGOA 3LA7A 2DK8A 4IS1C 3ZQCA 1WJ5A 2M1SA 3H1CA 5KAIC 3BCAA 1FPQA 2E71A 4PJ0C 3OSFA 3HOSA 2W1OA 3NWTA 1SD4A 3OS2A 4V2GA 1TQPA 1T4NA 4ENJA 3G4SI 4GCVA 5GPAA 1X3UA 2CV2A 3F0CA 1DI2A 3AG4H 1YTYA 1ULYA 4J01A 2MBFA 2P0WA 2K27A 4UUSA 2DDAA 4G7OF 2JR1A 3CTAA 4DOZA 3IKVA 2RS6A 2DYSH 3VYUB 2K7LA 2EFPA 2Z3YA 4HX4A 3MVPA 1E3HA 1CF7B 1Z1DA 1XGNA 2PFBA 1B8IB 3K2AA 1RKWA 1LB2A 1R1VA 2DJIA 4AWXB 1MD0A 1XDUA 2IVMA 2X0LA 2Q8KA 1JGSA 3KWRA 3GTKJ 2MC4A 4DR6E 4R79A 3IRRA 3PUBA 1LE8B 2ZXIA 1BB8A 3KP3A 3IP4B 1WJPA 4PZJA 3E5QA 5CVUA 4F54A 3BTIA 1T08B 2A61A 3JRGA 3V8LA 2VPRA 4LG3A 3W6KB 2HQRA 3EYIA 2BOLA 2OBPA 1KZHA 2TRTA 2PQ8A 1Z7UA 1L4SA 3HJEA 4MFEA 2CQNA 1Q1HA 2XF5A 1AKHB 3O8HA 2VJIA 1XSDA 2FOWA 3IKTA 2M4IA 2ZXWH 4WFTA 4JI2E 3Q3SA 2VI6A 4UXNA 2WAQN 4P5OA 2HZTA 1MIJA 1VQNI 3TEDA 1BIAA 3BTLA 2EMZA 1DGWY 3P5JA 3HPHA 3SJMA 1PUEE 3F6GA 5L3CA 3ASOH 2QQBA 2ZBKA 4D5FA 4ENKA 1MDMB 3WTWC 2N3GA 4OIRF 4UVBA 4XONA 4JX6A 1ZKGA 4JYAE 1HQCA 5H6QA 3WG7H 1OLTA 2M3AA 2V89A 2VBXA 3MFKA 2RC4A 1WJFA 1YYOA 2JSPA 3DTIA 2Y48A 3ELKA 2R76A 1PJQA 1T4LB 3FXRA 1TF6A 5GPCA 2FGGA 1FOYA 1S72I 3BR1A 1WVRA 1ZARA 2WV0A 4OIQF 3GXOA 2B0LA 5EEAA 3EUAA 2ENCA 3CF2A 1O3RA 4OMYA 1FLIA 3QRFF 2VIXA 1R22A 2M0MA 2HXIA 1N75A 2EPRA 4BC7A 2DMNA 2J5OA 3LSKA 4F2JC 1ZGAA 3DTKA 4GEQB 1C0WA 2M8GX 5H6RA 4FETA 1RPWA 1Z3YA 2IP2A 4D9JA 3GFIA 1U3EM 1AOYA 2OCCH 3H0GJ 2Z2SB 2DBBA 2OQRA 4N0BA 4FHTA 3RPQA 2UXBE 1VQ4I 1ETYA 4YRVA 1X4OA 2YTEA 1YUIA 1YW9A 4RHBB 6PAXA 2E1OA 1IRFA 4EM1A 4X9JA 1OCRH 3OR2C 2Z1DA 4HV5A 4AYBN 4G6QA 2R7RA 5ERIA 2EPUA 2CS3A 2J5PA 2A5YB 4BUPA 4S05A 2P4WA 2OJED 2VE7C 2V1NA 2CMPA 1HXDA 1TTYA 1O57A 4O5VA 2MABA 2K9SA 4BJTA 1N36E 3BG5A 4M3EA 3CCSI 1MGTA 3ZOBA 2KOUA 2B7TA 4KUMA 1Z9CA 1LDKB 1Y6IA 2ZB9A 2EZHA 2PBIA 1MH3A 3L7WA 2FBHA 2PMZA 1ZR2A 1RQ0A 3S1QJ 5T6JA 4DQ2A 4J00A 5IP6A 1RR7A 1HNZE 1VQ6I 2FEZA 2MC3A 2Y2ZA 5KL6A 1D1CA 2N8XA 4AQYE 4U0YA 1RNLA 5BMZA 2A5WA 5J1UA 1AA7A 1UZCA 1W5SA 3BTCA 1FOKA 2R7SA 3HQ1A 2NOGA 1ONVA 2LJHA 1OFCX 2D1VA 3BTJA 1BJZA 2LY1A 1WCMJ 4ESJA 1B4AA 1POGA 3QU3A 1IW7F 3DKWA 2EWLA 2FD5A 4DYCA 2DA3A 2BHZA 3LWFA 5E3MA 4XRSG 5JVGF 4OIPF 2WB1A 3BGHA 1BI1A 4GYGA 2V1XA 2O03A 5LFAA 3F8MA 5AC5A 1A04A 2MSYA 1T95A 5A6AA 3HHGA 2HQ5A 5J4VA 3TBIA 1SMTA 4CHUA 1CQTA 1WH5A 2EOSA 1K83J 2L0KA 4CCJA 3HOZJ 3CC2I 1SAXA 3PL8A 1T38A 2EIKH 1I3AA 3U1KA 2EMGA 2NS0A 3MZYA 4DV3E 1NHAA 5KL4A 1ZLJA 5KL3A 3KCCA 1HBXG 2QBYA 1G3SA 1QBJA 4PJMA 2V1UA 3E7LA 2ENAA 1XMQE 3IWCA 4JI3E 2CWEA 4Q28A 2MH2A 5M3MJ 3OYDA 1X3WB 3MQ0A 4D5CA 2M7BA 3CMAI 1J7KA 2EN8A 3ZMDA 3OYNA 4JYKA 4RS8A 4B3XA 2BBYA 3FBIB 3SEQA 2WY7Q 5ICEA 2EFQA 4E7JA 2VB6A 2WBMA 1ZR9A 1UBDC 1WZ2A 4B3RE 3J80K 3AFHA 4UB8C 2XAJA 1MJBA 1V5FA 3V4GA 3Q5FA 1U6GA 4PSXA 3ZMUA 1FYMA 1B1BA 3REOA 4M74A 3SEZA 2CUJA 3OOUA 2DGCA 4UUTA 2H36X 1I6XA 2PJPA 3CP8A 2EN2A 1FSEA 1U5TC 2UXXA 5CVJA 2YUSA 3EUKL 3BPXA 2L7ZA 5IPAA 3KP5A 3TOAA 3WE3A 4N9IA 3MSWA 4YFNF 3KEOA 4EVIA 4Z2YA 4R2AA 1NEIA 3NWSA 4FX4A 2L7MP 1VQOI 2ELJA 4B1RA 3PJRA 3MAJA 3OYKA 1B9NA 2DMYA 2GPIA 3S2HJ 5DD4A 3DEUA 4W97A 3V7RA 1YITI 1GVJA 3CJNA 2EORA 1TWGJ 2ZJQF 1YI2I 1WWXA 4F3QA 3OTOE 2IS6A 2NUFA 4L0ZB 1W5CC 3FXMA 4A12A 4DR5E 4BEHB 3TMOA 2E19A 2V4JC 2L2NA 2A6HF 2X4HA 1BR4A 3NAUA 3JTHA 1D8JA 2N3HA 2XB5A 1VQ8I 2QCOA 4MIMA 3C2BA 4O6JA 5EJCA 1JGGA 2JOBA 4CYCA 4HSRA 1BOBA 3QOEA 1FP1D 4ON0A 3H5AA 2RVCA 3H5RA 2L33A 4IVNA 5F0FA 1FEXA 2FRHA 5GP9A 4EQQA 1GXQA 4EM2A 2EPOA 2YT4A 1DQUA 1XC5A 2L3DA 2ZJRF 2X6XA 5EDNA 1X6HA 2YSOA 2L4AA 4GKKE 4V19K 1SVLA 1J75A 4LOCA 3ZCOA 2RGVA 5FRMA 2EOIA 3ABKH 4I0BA 2ZFWA 4A3KJ 1XB4A 3BG3A 3EPKA 3H5NA 3GLLA 3WHCA 2X6WA 4CUGA 2DJNA 4A3JJ 4PK4A 4WXDA 2F4VE 2JPCA 2HEOA 2IJLA 3I4NJ 1MJ9A 1JJ6C 1BI3A 4LF8E 3G6EI 1Z7LA 4MGRA 2XAQA 1QA6A 5F64A 2HXOA 2WBSA 1UN6B 2EILH 5J47A 1B9MA 2NRAC 2MYSA 2B7VA 2DLKA 5AIQA 4OMZA 5ICGA 1XCVA 3SXYA 5HODA 4ZYDA 1IBME 4LFAE 1TNSA 2D9HA 4LF4E 1B59A 3F6VA 5C3EJ 2ZMEA 5FKMA 2EPXA 2DW4A 4JK1X 1ETXA 3I4MJ 1FIPA 2VRDA 2CQ7A 1IAWA 1NK3P 1P6RA 2DA4A 2HZDA 2E2JJ 1OJLA 3I5UA 2P6SA 2AHQA 1OMIA 2GBYA 2JUGA 4L0YB 1TT0A 4LG0B 5HLGA 2QM3A 4KA4A 3HOVJ 3VPRA 2GAUA 2Q2EA 5C44J 3QQAA 5FLXZ 2XKOA 1ZRDA 2E1MB 1O3QA 2E1MA 3KZYA 4I01A 4BU2A 4A3CJ 2G9WA 1QO0D 1YYVA 3E0JB 3CUQA 3JRFA 1WJEA 2ODRD 1ZYRF 2VODA 3LNQA 4J19A 4FE7A 2ESHA 5L3FA 3DBLB 3WODF 2W25A 3M8FA 1KGSA 3RPUA 4L9NA 3S3OA 4Q35B 3J7AY 2R4GA 2KDOA 3CJQB 3PO2J 1R23A 3SQNA 2E1MC 1ZU1A 3CCYA 5IT9Z 4L5IA 2ETHA 2YX7A 3JSPA 3C6KA 4IPAA 3MN2A 3QPSA 2HNHA 3CCUI 2XRLA 3K4MA 4P78A 4LFUA 1IV8A 1OYIA 1USSA 5JFRA 2W4SA 4M9SA 2ADRA 4GDFA 1HW2A 5J1RA 4HYEA 1GUUA 5BQTA 1A1LA 1N77A 1IC8A 2CW7A 2OPTA 1XGSA 2BY3A 3BWGA 1LLMC 3VDXA 2BE5F 2XGXA 1YSAC 2XSDC 2DMTA 3OL3A 5J8CA 3FZVA 4LLNA 5E79C 4A69C 2V6CA 2YTJA 3L2VA 2F6CA 5E3LA 4X62E 1BL0A 4YHHE 2EOXA 1YIOA 3EQ1A 1UFMA 3CCMI 3BC8A 2A25A 4ZC3A 4IJAA 1BW6A 3V7CA 1D8KA 3SFZA 3EUHA 4A6EA 1AWCA 1HSTA 2F5VA 2WAFA 2EFOA 1ETQA 1I27A 1BI2A 2ZNZA 2R7DA 1FIAA 4BBRJ 3SYTA 1ZG1A 4AIDA 4EJOA 3ZN0A 2EM7A 3K6GA 1F5TA 4KIGA 4HTGA 2V8QB 5LD2C 2P7CB 3K9TA 3KP6A 2W00A 2STWA 3K2ZA 3MHHC 2KIFA 5K7ZA 1FOXA 1X5WA 3RZDJ 4ZZLA 2BEOA 3DBRB 2A6EF 2FMYA 4MFDA 4BQQA 2HR3A 3MKWB 2CUFA 2IS2A 3RJPA 2ISZA 5IV8B 3SFIA 3T5XA 1MSFC 2DN0A 5CJ9A 5KVRA 5D5VB 2FQ3A 1QPMA 2P5LC 1JKPC 1AHDP 3KETA 2JWTA 3BZ6A 4XLNF 2GWRA 3ZMVA 4ZH4F 1DGRM 2K4BA 4RBOA 4LK1F 1RESA 2NS7A 2VQEE 4FT8A 2DT7B 1EJ9A 3WU0A 4AIKA 1YE9A 2MLGA 4YELA 4BBYA 2W82A 4C3HJ 3L1PA 2GOMA 1DU0A 3M07A 1A1JA 2EMKA 2MH9A 5KNLA 5H20A 2OA4A 3D5RC 4FASD 5AONA 1CF7A 2EMIA 3GMEA 2L7FP 2XF6A 4PSWA 5DD8A 4N4OB 3GBGA 1SFKA 4LFCE 2EA2A 2ID3A 2LP0A 3DU5A 2EPLX 1XDSA 1I1GA 3G71I 2L01A 4UHTA 2OCEA 4GGGA 1G8XA 2DMPA 3X2QH 4B48A 4EGYA 4UVAA 1WPKA 2YPNA 1IUYA 4OWRB 3DFGA 1HSJA 2OU2A 4G7HF 4YFXF 4AUXA 2ELZA 2WAQA 3RQ4A 4F92B 5D5WB 4KMUX 2HI3A 3JRBA 5A69A 4F9CB 1T8IA 1TF3A 1SR9A 2R92J 2FQ4A 3H9GA 2GM4A 2ZJ2A 3ZOQB 1MBEA 3DPTA 1GXPA 4TV7A 1A6IA 3HXLA 4EJTA 2EOEA 1ZTRA 2KL4A 3OYLA 3L2CA 2R5ZB 5KL7A 4F9AB 2FMLA 3L9FA 3ULQB 4PJJA 1RI7A 2K4VA 4WPYA 4M30A 4BACA 2LO3A 2HJJA 3ZMSA 3QAHA 4KICA 4RGSA 2G7UA 4B3TE 3AG1H 4DV4E 3CUQB 1PKPA 1IV6A 1SEUA 1HW5A 2MDRA 2L7KA 4YEJA 4O4KA 1XSXA 2DCEA 1KQ0A 3S3MA 1H88C 1PDNC 3WE2A 2VC0A 1DPUA 1XCBA 1FWZA 3O8GA 4LG0A 1M1EB 4ESBA 1JK2A 1Q1VA 1VZ0A 1U2WA 2KISA 4LU9A 1QRYA 3O2PE 3JRDA 1QNTA 2WV1A 1RKTA 2FU4A 4BGDA 2F4MB 3ZMZA 3J81K 2ADUA 1EKZA 3TP0A 1H8AC 2HGCA 3F8FA 1SFOJ 5IWAE 1OISA 2ZMEB 2L92A 2P5KA 3WU1B 3HIFA 1R58A 5A2QC 2EN6A 3G3ZA 2MDGA 1V55H 2M7QA 2L3CA 4DUYE 1YLFA 1G2FC 1JKOC 5B3SH 1Z05A 2XAHA 4OU0A 1TQIA 1WH7A 4HQMA 2ELKA 3D1NI 4DR2E 4N4NB 4AC0A 3CO6C 2L9VA 3JREA 1T0FC 3RKQA 1SD6A 3OOPA 2EPCA 2V1DA 1EH8A 2BY0A 3N05A 2X1EA 3DXJF 4XLFA 4RB2C 4XOPA 3BR0A 1STUA 3H36A 2DQRA 4Q47A 2KIUA 3CDIA 3CCQI 2OD5A 1NK2P 1ON1A 2RN7A 1WHNA 2JTVA 3H9JA 1N34E 1HCRA 5EG0B 4WF2A 2M4GA 3OSGA 1K7AA 4JX5A 2HQNA 1YS6A 2EIMH 2WC2A 1X19A 2EPFA 4DV0E 2NUEA 5DCMA 1XTAA 1NTCA 2ZKZA 3HSRA 3FIGA 4Y7NJ 1IN8A 4N9HA 2R93J 2R7OA 3S16J 4IHSA 4KNYA 2PEXA 2ZMEC 3OIPA 5HLTA 4AM3A 4DV7E 2VBZA 1G6NA 2EMCA 4O3MA 1LNWA 2IPQX 4BH9A 5DTDA 3H09A 4F6MA 2L5QA 3FMRA 2LF8A 3HSFA 2XKPA 2ECBA 4IHVA 1U78A 4OINF 4M2ZA 4F7ZA 5FLXC 4BXUA 4HW0A 3W2AA 3RTRA 4K2EA 2LMZA 3L09A 3Q0UA 4RH8A 2EQ0A 1VQ5I 4IZZA 3RSNA 1RETA 4ETSA 1YYWA 4M3BA 3J7YJ 1XGOA 4B3AA 5BPDA 1I39A 1X1PA 4DIQA 1YJ9I 4G7ZF 2BW3A 1R4NB 2XF7A 4IQ4A 5EEGA 5L3EA 4EGZA 1R6RA 1JXSA 2OF7A 5E1WA 3GFJA 2CGPA 2EZIA 5E17F 1OYWA 3RYRA 5FKOA 1T0FA 4BQNA 4Z6YA 5K5RA 1LFBA 1MEYC 1FJGE 1STZA 3HPSA 4I98B 2K9NA 5FFZA 3HOUJ 1CGPA 1T2KA 5M5YJ 3K69A 4R2DA 1R5HA 3M3YJ 1X1CA 4IO9F 2IBDA 3QP5A 3IWBA 1O3TA 1O3SA 1J59A 2I5UA 3S2WA 1L3LA 4I2OA 1HF0A 5HDNA 1QU6A 3HRSA 3LQRA 2ID6A 4HX8A 3CCVI 4M72A 2LJUA 1W36C 2MLKA 2V9PA 2W85A 1U0JA 2F4OB 1IRXA 4ZTFA 4RAFA 4NHRA 4RM2A 1LFUP 2CSOA 1JI8A 4M6XA 1RRJA 2UUAE 1WJDA 5HS7A 4BBSJ 3BR6A 2WA0A 2MG4A 5FKNA 4R8HA 2X9DA 4XN0A 4BHPA 1A1IA 2LF7A 1JUSA 3BCBA 4KHPE 2E7XA 3ZN1A 3BLYA 4HA8A 2LMDA 2QSFX 1MBHA 3DPLC 3S32A 4WSGA 5F6FA 5BPIA 3K6QA 2I10A 3ADJA 1GT0C 1LE8A 3CO7C 1ZLKA 3ZMTA 2RPCA 1KQ8A 1Z1BA 2HVSA 2YU9J 4OOGC 5GAEJ 2EN1A 4AYBA 4WYQB 5CLSA 4L8NA 3BJAA 3GCMA 2FUG2 2GOXB 4G6TB 3OYCA 2LTRA 3RMPA 2X1CA 3QG5C 4Y3OA 3HSEA 5ILVA 2YWQA 4L18B 1RR8C 2YPRA 4CXFA 2CRGA 2HPMA 1FP2A 2E7WA 1R5GA 5IP9J 1IXRC 3HPGA 3EPJA 3CLQA 3H0DA 1JTYA 3TP3A 2R5YA 2ME6A 2LUPB 1BBYA 1ZQ3P 2H27A 3SHFA 3LOCA 2EOHA 5CVVA 3ZQ7A 2YU5A 4CGZA 4QPOA 5IOYA 1A1KA 3G1LA 4DZJA 2RAEA 1S6LA 4A3DJ 2KMUA 1P7JA 2K7IA 1W7PA 1Y39A 3VB2A 3D5SC 3FHZA 2EMXA 2HPIA 2FNAA 4QWQA 2VJ5A 4M9ZA 3HPZA 3CMYA 1RC9A 4M9XA 4M9VC 4Y4RA 3BZCA 1WFXA 2OTJI 4F6NA 4B3ME 3HB9A 4RDUA 2DTRA 1VQMI 2BB8A 2NABA 1GV5A 3LSHA 3MWMA 2VQLA 5DYMA 3V8JA 4DJAA 1WI9A 1Z6TA 4KISA 5AE2A 1PYVA 2XVCA 2WWYA 1QQIA 3DLLF 2IT0A 2D5VA 1Y8RB 1KU2A 4LGWA 4OAZA 5A2QZ 4AVZA 3FM5A 4P9UA 3L2UA 3I0TA 2ZSHB 1MMAA 2GXBA 3ZR8X 1JHFA 3CC7I 2V7FA 3E3VA 3HRTA 2HTJA 5K5OA 2KHXA 1TW2A 1I3QJ 1NG7A 2NUGA 1JKQC 3DEWA 5D8KB 1IN6A 1OCCH 4KJZA 2DPDA 4XL9A 4ESFA 1BI0A 2DTZA 4R2PA 1Z67A 2I8DA 4P55A 1YRNB 3GTPJ 4JV5E 2KKOA 1WJCA 2FNPA 3E5XA 1X1AA 2DA5A 5AIPA 3JAMC 2LVHA 4NXME 1HNXE 2ESNA 2JA2A 4S04A 1EF4A 2J7JA 4CH7A 4X64E 4L5JA 5J40A 2I9IA 2MKNA 3LFUA 2XGEA 4ZYAA 2LKXA 1U5TB 2EMAA 2B7EA 4NXNE 1GLNA 4KIBA 4GXOA 2DAOA 3DWLE 1D5YA 1WHUA 1B72B 1BBOA 3QPTA 4RLFA 2XHKA 2HDCA 4A93J 2LUQA 2YU3A 3M8JA 4MLVA 1X2NA 4JI6E 5IYCJ 4DGWB 2CTDA 5C4JJ 3KEQA 1MBKA 2QZ8A 3DCFA 2K02A 3S93A 3A01A 3KX2A 3LFKA 5LLQA 4GFBA 2EH3A 1NH3A 2EL5A 4NHJA 2WCC3 4LFBE 3IV5A 4I7HA 1FT9A 4Y17A 3OYJA 1MNDA 1VF9A 2ZCWA 5FKLA 1FY7A 2FSWA 2KZGA 4C3JJ 1TW3A 2YX4A 2UUBE 2XV4S 3BG7A 4CSWA 4GRIA 1VQPI 2QUFA 1MBJA 4Q4ZF 1BBGA 1LEAA 1XNRE 1YG2A 2V9VA 3FDYA 4A3LJ 1DP3A 2NOJB 4KYWA 2VLAA 2RQLA 4M6YA 5F3WA 1D3YA 2DYRH 4H4KC 1G3WA 1I50J 3RI4A 3M99B 4L9VA 3FKJA 4F55A 2OTLI 2FF4A 4CZZA 2VKHA 2STTA 2VASA 4D0PA 2M9HA 1OYYA 2M4KA 2Y30A 4WCGA 2CU7A 3ABUA 1HDPA 2FE3A 3BY6A 2IAIA 3O3KA 5AC4A 2JSCA 2GA1A 3Q9SA 2ZFUA 1X58A 1LPQA 2L2MA 2ENHA 1H9TA 4PCQA 3TO6A 1UHZA 4R2RA 2L3JA 2EM3A 4XNFA 3A02A 3IAM2 1QZZA 4CYDA 1VQKI 5D5XB 1OKRA 1TT5B 2IGKA 2Z5UA 2VOPA 1TLHB 2RS7A 1OCTC 1J2XA 2E36A 2CYYA 3CUQC 2L9NA 2GXGA 4HDUA 3ONQA 4U0WA 3BQZA 4D7NA 2M34A 3SZGA 1L0OC 2EM2A 3K1MA 3BQYA 3CCLI 4HLYA 3R61A 1XS9A 3LA2A 2IW5A 2EPNA 3OL4A 4HRIA 2OV7A 5HDGA 4G12A 1ACIA 4DV1E 2LY9A 2LT7A 5LGTA 2EPMX 4X0GA 1J26A 2H6CA 2DDBA 3JRHA 3BOQA 5FLXK 4F9BB 1UELB 2R7WA 4GZNC 4P9FA 2AS5F 1REPC 1F9NA 1R1UA 2XC7A 1KU7A 4C2UA 2K9QA 2V87A 3BG9A 4XLAA 2YS9A 3TQNA 1OQYA 1ZRCA 4MQ9F 3AUZA 1XMXA 2YTOA 2DODA 3V7SA 4IQJA 4B44A 3DU6A 3FM3A 3K7AJ 3GUDA 1XX5A 2E1CA 2VQHA 3CZ6A 1V5EA 1IXCA 2K3PA 2EL6A 1IXSB 2QENA 2EM4A 4LF5E 3ZQHA 4B3SE 1P4XA 3GF2A 4C3IJ 2X6OA 1DU6A 2HYJA 2KT0A 2O8XA 2B9DA 3Q0VA 4A5MA 4DMIA 5CPRB 1S7OA 1K79A 3HHHA 1E17A 4BHCA 3E6MA 2JN6A 1U8RA 1YYKA 2LD5A 1JKRC 3WHBA 1QZYA 2M30A 1GHCA 4JI1E 4L9TA 1X6FA 2GHFA 2DFFA 3ECHA 1AAYA 1YUJA 1SVMA 4D7MA 1TQMA 1A31A 2VOOA 2B3TB 2DA1A 4A3EJ 3ML6A 3PNTA 1IN7A 1GQEA 2BZTA 5DNYA 2EK5A 1I5ZA 1T6SA 2F2EA 4IRIA 2O0YA 2VXDA 4BQAA 3N97A 3C4TA 1HLVA 2ELYA 1IN4A 1ETOA 1VI0A 1GTKA 2LTPA 4NZVA 3IWDA 2R0QC 4NBQA 2OUMA 1WJAA 2A69F 2DA6A 3ASNH 3QODA 2AO9A 2XASA 3L00A 4MO7A 4DR1E 2VBYA 3D5LA 3PNYA 2NAZA 2KRFA 3HOTA 4IX7A 3L2QA 1BM9A 4G8XA 1OCOH 1UILA 2GXAA 1E3PA 5D8LB 2HTSA 2FBIA 2KRHA 5FGMA 5E8IA 1V3FA 2JT1A 4KT6A 2Y75A 4BS9A 1NCSA 4UNOA 2X51A 1EA3A 3CCEI 4JBAA 2XSJC 2JRTA 4RLQA 4HNVA 4XR6A 2CJJA 3PSFA 3G1OA 3I58A 3K4CA 4EATA 3JSOA 2O61A 2QVOA 5LGUA 3I59A 2K9MA 2EOZA 3J80C 5EZHA 3DPUA 1LDJA 3H92A 5HNHA 2FA5A 5KL2A 2E5ZA 2LY2A 1IUFA 4UV9A 1IBLE 1SFXA 2CSHA 4RM3A 3ZP5A 3H3VK 4HSTA 4ZYGA 4KWYA 4XMYA 1UCRA 1YPNA 3VODA 1DUXC 3C6MA 2L6MA 3W2VA 5HNFA 3MKZA 2EM6A 2LR8A 3IC7A 3KP4A 2DT5A 4D1QA 1V4RA 2VQCA 2YZTA 2D45A 4BHBA 1Z77A 2JA6J 4AU7A 3JR9A 1S8NA 3U2RA 2VT3A 3GTJJ 3NQOA 1WXRA 2WADA 2OC6A 3SZPA 1SFUA 1X2MA 3R4KA 1QHHD 2QKLB 2ICWG 5D6EA 2EV6A
chains in the Genus database with same CATH topology
2GQQA 4CICA 5TRDA 2V79A 4IF4A 4EJUA 2XRNA 2BGCA 1FBQA 3BP8A 3I4PA 1YFHA 5FO5A 2L54A 3PFIA 2VBWA 5BOXA 2QWWA 3GW2A 2R3SA 2Q0OA 2M45A 4RB3C 4UV8A 4KDPA 3EYYA 4FX0A 4WK8F 1FYLA 3E5UA 4BNCA 4HAMA 5ICCA 1W4MA 2BV6A 3BDDA 3GFLA 4WX9A 2W57A 2HKOA 1RUNA 2P7VB 2HYGD 2UXNA 2L02A 3IL2A 1IN5A 5LEJA 3RKYA 5DUIA 5K1YA 1YQAA 3F3XA 1FZPB 3GZ5A 3V8KA 4XLPF 4H0EA 1RZ4A 3JAMZ 3MZHA 5LBQA 1YW7A 4IRHA 5HLHA 3SZTA 2PMHA 1XGMA 1MZBA 3TO7A 4MHGA 1I1SA 1F4KA 3VOEA 4RGRA 1R36A 3FX3A 3W6JB 1W7PB 1DPRA 3U1DA 3IHUA 5L3BA 1BJAA 4HDVA 1IF1A 3GYHX 2ZNYA 2HFHA 4MEXF 3ERED 4ZYHA 2UZKA 3FF5A 1YW8A 4A0XA 4A2UA 3LAPA 3TDZC 3I54A 2LKPA 1SD7A 4A6DA 4XRFA 5LHGA 4IRGA 2IA2A 2O6GE 3O6BB 1PP7U 3ABTA 3M1EA 4MQVA 4WXCA 1H9GA 2W84A 5LHIA 5E8GA 4U7BA 1KQ9A 4GYIA 2QQAA 3MCZA 2VC1A 2HOEA 4LLLA 1VTNC 1Z91A 5L3DA 5HS8A 3HRMA 2CFXA 3IWFA 5JHUA 2K4JA 3PQJA 3RIRA 4XSZF 1DP7P 5LHHA 4A5NA 4I02A 3TGNA 3LSTA 2CG4A 2A07F 5DUKA 3T8TA 1XN7A 2NNNA 4NQWA 3I53A 5L3GA 4BYYA 4ENNA 1O7FA 1Y0UA 5D5UB 1R00A 1HW1A 4M71A 3LA3A 1MJAA 4XBFA 4NB5A 4HF2A 3WTVC 2JPBA 1WRJA 5ICFA 1P2FA 3VFZA 2DK5A 5FFXA 4YG2F 3B73A 1E2XA 2MA3A 5KK1A 1RUOA 2UWMA 1XMAA 1D5VA 2NNYA 1SFEA 4EJVA 5DDGA 3JTGA 2RV8A 1XSVA 2M87A 3GO5A 4PGGA 1ZAOA 3E6DA 2IA1A 4EV0A 4YIIA 2OAZA 2RQPA 2K86A 5DCFA 3TO9A 1ZRFA 3GEZA 2XAFA 1DDNA 5LGNA 3WGHA 4JQFA 5FB2A 4R1HA 3WGGA 2RDPA 3I59B 3DQVC 2DI3A 1KU3A 3COAC 4BAYA 1OR7A 4U88A 2GIVA 1USTA 3Q9VA 3E6CC 4AVPA 3F8CA 4G6DA 4KMFA 1ODDA 2P8TA 3QP6A 2KIMA 4U0VA 2D1HA 3C1DA 4Q5SF 1WSUA 2EA4A 3KZZA 1LDDA 1KU9A 2HWVA 1K6OA 3CUOA 4PGHA 3F21A 1FYKA 3KP2A 3H3ZA 5D6FA 4AD9A 5JI6A 1SMYF 4ASNA 1SD5A 2HYFA 4RB0A 4KIFA 1T39A 4HZFA 2DU9A 2FXAA 1H0MA 3GFMA 4Y13A 1BIBA 2ELHA 3QOPA 3TOBA 4OOIA 2H6BA 2FBKA 3R0JA 3GZ6A 1MDMA 1ZG3A 3WGIA 2OQGA 5CYVA 1KYWA 4LD5A 1O7LA 4LLGF 5LRSA 4RGUA 3TDUC 1P92A 2E1NA 2G7HA 3GWZA 1HKQA 5F1RA 1EH6A 3GVAA 3HTSB 1T98A 4HOBA 3GLXA 2F5CA 3AAFA 3WTZA 3DF8A 1HKSA 2H09A 3P9IA 3VEPA 1FBSA 2RNJA 2EWNA 2LSOA 4GO1A 1P4AA 1OPCA 3E6BA 4B8XA 1UHMA 4EMSA 3BJ6A 4LJZF 5LEKA 2M1BA 1J9IA 2DPUA 2VN2A 1ZGJA 3PQKA 1XMKA 4G94A 5E1ZB 2ZO4A 1BC7C 3LQQA 2XROA 5A2QK 4AIJA 2QBYB 1FSHA 4L9JA 5JR3A 3WTTC 3CDHA 2VXZA 4XSXF 4RAYA 1YS7A 2COMA 2EV5A 2P5VA 1EH7A 2EV0A 5FD6A 1S3JA 4ZYEA 4G9YA 2W24A 1F1ZA 2C6YA 2A3SA 3KFWX 2VE8A 4OIOF 4RB1A 3DV8A 3HYIA 2F5EA 3R6SA 2CO5A 1IZ1A 2PG4A 1HKTA 4LK0F 4E70A 1BC8C 4I09A 5CVRA 3RYPA 1BOAA 5ILUA 2IRFG 5HS9A 5E1XA 1G3YA 1MKMA 4I0AA 4CDGA 5FD5A 3WTUC 4LB5A 3I64A 2D2WA 2OZUA 3JAMK 3T0YA 3T1BA 5CVIA 4HQEA 3EETA 2KJBA 1B6AA 1R1TA 3C3WA 2Z99A 1KA8A 2PMUA 1KYZA 1LQ1A 1P4WA 5HDKA 5DV5A 3DP7A 3B02A 2TDXA 3CLOA 1WQ2A 3M8EA 2OZ6A 4A0ZA 3KP7A 5D4SA 4ENMA 1G4DA 3QPHA 3F22A 2DQLA 5E20A 4HV6A 4P96A 4YFKF 2R7FA 4IXAA 5J8FA 4UUVA 4ZZDA 4HF0A 1QGPA 1ZREA 4A0YA 3RKWA 5EEHA 3EQLF 3N4MA 4QLCU 3KLNA 2Z9OA 1JHHA 3QU6A 2PI0A 4Q48A 3G73A 3M9AA 5IT9K 2QLZA 4HX7A 3EDPA 5DEQA 3ECOA 1S7AA 1R7JA 1K78A 1FBUA 2EFWA 4IHTA 2FOKA 1TNTA 3WTSC 2EFNA 2F5DA 1J0RA 4RGXA 4MTDA 4MTEA 2H94A 2NYXA 4LMYA 2JZYA 3FWEA 3NEUA 2PN6A 1W5TA 2L4MA 5J6XA 2AXLA 3M7GA 2ACJA 2P6TA 1YO5C 2LNBA 2M8EA 3HTUA 5DCMB 4MNUA 3BROA 3ISPA 4LB6B 4HLXA 2EB7A 2EJRA 2GZWA 2PLYA 2DO7A 2QYOA 3R0AA 4KT5C 5HOOA 3GX4X 1ZHFA 2ISYA 1UB9A 1IRGA 1J5YA 2BYVE 5E18F 2VONA 2ZXJA 2Z33A 3P9KA 3C18A 3J81Z 4KN7X 1S29A 2DFIA 2YR2A 2A68F 5K5QA 3F8NA 3IRQA 1ZG5A 1EV7A 3WTXC 1K78B 2M5WA 3BPVA 1UHWA 5ILSA 3FXUA 3D0SA 3U9GA 4U7DA 2GA2A 4EJWA 2WTEA 3WG9A 4WWCA 3K0LA 2KJCA 2LDUA 3WTYC 3F6OA 4KN4X 5TJJA 3K1NA 4HF1A 3OV8A 1ZN2A 5LRRA 2Y0MA 2XIGA 3H3UA 5HVQC 1TBXA 3JW4A 1LJ9A 2MD5A 3J80Z 4AIHA 4MEYF 3FXQA 3I71A 2DLLA 3LAJA 2HS5A 3J7AO 2IA0A 2HKXA 1W7PD 4B09A 1FNNA 3HUGA 5ED4A 3E97A 1Z6RA 3P7NA 5BS6A 1RIOH 1PP8F 3P9CA 4M73A 2VE9A 1XD7A 3RDIA 3ZPLA 4UVCA 3F23A 4RAZA 4YIFA 2XUBA 3BJOA 2RKHA 3FMSA 2YSRA 3F72A 5IT3A 4HBLA 3RKXA 3MEXA 2QQ9A 5HLIA 3NRVA 1U5TA 1FX7A 3F8BA 2XAGA 4Y15A 5D4RA 1ZH5A 3KE2A 3ROUA 4EM0B 4PDKA 3FMQA 1WKMA 4KFCA 4CO8A 1LVAA 3HRUA 1G3TA 3IWZA 2VT2A 3C7JA 4DNCA 2CW0F 1FC3A 5JVTA 2F5FA 3R60A 4WXHA 1LEBA 1ON2A 3KLOA 3K1PA 2O3FA 1BN5A 2CQKA 3T8RA 1JE8A 3TKYA 3LA7A 2DK8A 1FPQA 3HOSA 1SD4A 1TQPA 4ENJA 4GCVA 1X3UA 1YTYA 1ULYA 2MBFA 2K27A 4G7OF 3CTAA 3IKVA 2K7LA 2EFPA 2Z3YA 4HX4A 1CF7B 1Z1DA 1XGNA 2PFBA 1LB2A 1R1VA 4AWXB 1MD0A 1XDUA 2IVMA 2X0LA 2Q8KA 1JGSA 4R79A 3IRRA 3KP3A 4PZJA 3E5QA 5CVUA 2A61A 3V8LA 3W6KB 3EYIA 2HQRA 2OBPA 2PQ8A 1Z7UA 1Q1HA 1XSDA 3IKTA 4UXNA 4P5OA 2HZTA 1BIAA 1PUEE 5L3CA 2QQBA 2ZBKA 1MDMB 4ENKA 3WTWC 4OIRF 4UVBA 1HQCA 5H6QA 2VBXA 3MFKA 2RC4A 3ELKA 2Y48A 3FXRA 1ZARA 2WV0A 4OIQF 3GXOA 2B0LA 1O3RA 4OMYA 1FLIA 3QRFF 1R22A 2J5OA 1ZGAA 1C0WA 5H6RA 3GFIA 2IP2A 1U3EM 1AOYA 2DBBA 2OQRA 4N0BA 4FHTA 3RPQA 1YW9A 6PAXA 1IRFA 4EM1A 4HV5A 4G6QA 5ERIA 2J5PA 2A5YB 4S05A 2P4WA 1HXDA 1TTYA 1O57A 4O5VA 1MGTA 4KUMA 1Z9CA 1LDKB 2PBIA 3L7WA 2FBHA 4DQ2A 2FEZA 2MC3A 4U0YA 1RNLA 5BMZA 1W5SA 1FOKA 1ONVA 2D1VA 4ESJA 1B4AA 3QU3A 1IW7F 3DKWA 3LWFA 4OIPF 1BI1A 4GYGA 2V1XA 2O03A 3F8MA 1A04A 3HHGA 1SMTA 4CHUA 1SAXA 1T38A 2NS0A 3MZYA 1NHAA 1ZLJA 3KCCA 1HBXG 2QBYA 1G3SA 1QBJA 2V1UA 2CWEA 2MH2A 3MQ0A 1J7KA 3ZMDA 4RS8A 2BBYA 5ICEA 2EFQA 3J80K 2XAJA 1MJBA 3V4GA 3Q5FA 1FYMA 1U6GA 3ZMUA 1B1BA 3REOA 4M74A 1I6XA 2PJPA 1FSEA 1U5TC 2UXXA 5CVJA 3BPXA 3KP5A 3TOAA 3WE3A 4N9IA 4YFNF 3KEOA 4EVIA 4Z2YA 4FX4A 3MAJA 1B9NA 5DD4A 3DEUA 3V7RA 1GVJA 3CJNA 1WWXA 4L0ZB 4A12A 2A6HF 2X4HA 3JTHA 1D8JA 4O6JA 1FP1D 4ON0A 2RVCA 4IVNA 2FRHA 4EQQA 1GXQA 4EM2A 2L3DA 2L4AA 1J75A 2RGVA 4I0BA 2ZFWA 1XB4A 4WXDA 2JPCA 2HEOA 2IJLA 1MJ9A 1BI3A 4MGRA 2XAQA 5F64A 1B9MA 2NRAC 5AIQA 5ICGA 4OMZA 1XCVA 3SXYA 4ZYDA 1TNSA 1B59A 3F6VA 2ZMEA 2DW4A 4JK1X 1IAWA 1P6RA 3I5UA 2P6SA 1OMIA 4L0YB 4LG0B 5HLGA 2QM3A 4KA4A 2GAUA 2Q2EA 5FLXZ 2XKOA 1ZRDA 1O3QA 3KZYA 4I01A 2G9WA 1QO0D 1YYVA 3CUQA 1ZYRF 2VODA 2ESHA 5L3FA 3WODF 2W25A 3M8FA 1KGSA 3RPUA 4L9NA 1R23A 3SQNA 5IT9Z 4L5IA 2ETHA 2YX7A 3JSPA 4IPAA 4LFUA 1OYIA 1USSA 5JFRA 4M9SA 1HW2A 4HYEA 5BQTA 1XGSA 3BWGA 2BE5F 2XGXA 5J8CA 3FZVA 4LLNA 2V6CA 1YIOA 1UFMA 4IJAA 3V7CA 1D8KA 3SFZA 3EUHA 4A6EA 1AWCA 1HSTA 2EFOA 1I27A 1BI2A 2ZNZA 2R7DA 1ZG1A 4EJOA 3ZN0A 1F5TA 4KIGA 2P7CB 3K9TA 3KP6A 2STWA 3K2ZA 2KIFA 4ZZLA 2BEOA 2A6EF 2FMYA 2HR3A 3RJPA 2ISZA 3T5XA 5D5VB 5CJ9A 5KVRA 2FQ3A 1QPMA 2P5LC 3KETA 3BZ6A 3ZMVA 4XLNF 2GWRA 4ZH4F 2K4BA 4LK1F 4FT8A 3WU0A 4AIKA 2MLGA 2MH9A 5H20A 2OA4A 5AONA 1CF7A 5DD8A 2EA2A 1XDSA 1I1GA 2L01A 4UHTA 4GGGA 4EGYA 4UVAA 1IUYA 3DFGA 1HSJA 2OU2A 4G7HF 4YFXF 5D5WB 4KMUX 2ZJ2A 3DPTA 1GXPA 4TV7A 4EJTA 3L2CA 2FMLA 3L9FA 3ULQB 1RI7A 3ZMSA 3QAHA 4KICA 4RGSA 2G7UA 3CUQB 1HW5A 1XSXA 1KQ0A 1PDNC 3WE2A 2VC0A 1DPUA 1XCBA 1FWZA 4LG0A 4ESBA 1U2WA 3O2PE 1QNTA 2FU4A 3J81K 3ZMZA 2ADUA 2HGCA 3F8FA 2ZMEB 2P5KA 3WU1B 3HIFA 1R58A 3G3ZA 1YLFA 1Z05A 2XAHA 4OU0A 1TQIA 4HQMA 3CO6C 1SD6A 3OOPA 2V1DA 1EH8A 4RB2C 3DXJF 2DQRA 4Q47A 2KIUA 2OD5A 1ON1A 2RN7A 2JTVA 4WF2A 1K7AA 2HQNA 1YS6A 2WC2A 5DCMA 2ZKZA 3HSRA 1IN8A 4N9HA 4IHSA 4KNYA 2PEXA 2VBZA 1G6NA 4O3MA 1LNWA 2IPQX 4BH9A 3FMRA 2LF8A 3HSFA 2XKPA 1U78A 4OINF 4F7ZA 4BXUA 4HW0A 3RTRA 4K2EA 3L09A 4ETSA 1XGOA 5BPDA 4G7ZF 5EEGA 5L3EA 4EGZA 1JXSA 2CGPA 5E1WA 3GFJA 5E17F 1OYWA 3RYRA 1T0FA 5K5RA 1STZA 4I98B 5FFZA 1CGPA 1T2KA 3K69A 1R5HA 3QP5A 1O3TA 1O3SA 1J59A 3S2WA 1L3LA 4I2OA 5HDNA 3HRSA 3LQRA 4HX8A 4M72A 2MLKA 2W85A 2CSOA 4M6XA 5HS7A 4R8HA 4BHPA 2LF7A 2E7XA 3ZN1A 4HA8A 3DPLC 5F6FA 5BPIA 3CO7C 1ZLKA 3ZMTA 1KQ8A 5CLSA 3BJAA 3HSEA 5ILVA 4L18B 2YPRA 4CXFA 1FP2A 2E7WA 1R5GA 1IXRC 1BBYA 2H27A 3SHFA 5CVVA 3ZQ7A 4CGZA 1S6LA 1W7PA 3VB2A 3FHZA 2FNAA 4QWQA 4M9ZA 4M9XA 2DTRA 3MWMA 5DYMA 3V8JA 1WI9A 1Z6TA 2XVCA 2WWYA 1QQIA 2IT0A 4LGWA 1KU2A 5A2QZ 3FM5A 4P9UA 3I0TA 2GXBA 1JHFA 3E3VA 3HRTA 2HTJA 5K5OA 1TW2A 5D8KB 1IN6A 2DPDA 4ESFA 1BI0A 4P55A 2KKOA 2FNPA 3E5XA 5AIPA 2ESNA 4S04A 4L5JA 1U5TB 4KIBA 4GXOA 2DAOA 3QPTA 2XHKA 2HDCA 2YU3A 3KEQA 2QZ8A 2K02A 3LFKA 5LLQA 4NHJA 4I7HA 1FT9A 4Y17A 2ZCWA 1FY7A 2FSWA 1TW3A 2YX4A 2XV4S 2QUFA 4Q4ZF 1LEAA 1YG2A 2V9VA 4KYWA 4M6YA 1D3YA 3RI4A 1G3WA 4L9VA 2FF4A 4CZZA 2STTA 4D0PA 1OYYA 4WCGA 3ABUA 2FE3A 3BY6A 3O3KA 2JSCA 2GA1A 3Q9SA 1H9TA 4PCQA 3TO6A 1QZZA 4CYDA 5D5XB 1OKRA 2Z5UA 2VOPA 1TLHB 1J2XA 2CYYA 3CUQC 2GXGA 4HDUA 4U0WA 1L0OC 3K1MA 4HLYA 3R61A 3LA2A 2IW5A 5HDGA 5LGTA 2H6CA 5FLXK 3BOQA 4P9FA 2AS5F 1REPC 1F9NA 1R1UA 1KU7A 3TQNA 1ZRCA 4MQ9F 3V7SA 3FM3A 3GUDA 2E1CA 1IXCA 1IXSB 2QENA 1P4XA 3GF2A 2O8XA 4A5MA 1S7OA 1K79A 3HHHA 1E17A 4BHCA 3E6MA 1U8RA 1QZYA 2M30A 1GHCA 4L9TA 3ECHA 1TQMA 2VOOA 3ML6A 1IN7A 2EK5A 1I5ZA 1T6SA 2F2EA 4IRIA 2O0YA 4BQAA 3N97A 1IN4A 2A69F 2XASA 3L00A 2VBYA 3D5LA 2NAZA 2KRFA 3HOTA 1BM9A 4G8XA 5D8LB 2HTSA 2FBIA 5FGMA 5E8IA 1V3FA