3KZYA

Crystal structure of snap-tag
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
176
structure length
162
Chain Sequence
b'DCEMKRTTLDSPLGKLELSGCEQGLHEIIFLGAAVLGGPEPLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYSHLAALAGNPAATAAVKTALSGNPVPILIPCHRVVQGDLDVGGYEGGLAVKEWLLAHEGHRLGKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SNAP-tag
publication title SNAP-tag structure
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 47
structure length 162
sequence length 176
chains with identical sequence B
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2009-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3kzyA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 3kzyA01
2ZXJA 5J8FA 1UB9A 4KFCA 2VONA 2IA0A 3COAC 1J9IA 5K5QA 4I2OA 2P8TA 2K02A 4NHJA 3TO7A 1XGSA 3GFMA 2K86A 3MQ0A 3CTAA 3TO9A 5LEJA 2K4BA 2FRHA 3V7CA 5LLQA 2HFHA 4L9VA 3RYPA 3RPUA 3T1BA 3V8KA 4HBLA 4RS8A 4B09A 3TO6A 2PLYA 3T5XA 1FP1D 4IRHA 3OOPA 4ENNA 3Q9SA 3FF5A 4L9TA 2BBYA 2CG4A 1UHWA 1I6XA 4LB5A 2PBIA 5L3EA 1R1VA 2A5YB 2OZ6A 2LKPA 5FFZA 1YS7A 1U3EM 3R61A 1OR7A 2PJPA 2KJCA 3ROUA 1PUEE 2IVMA 3K0LA 2K7LA 4M74A 4NQWA 1R1TA 3GWZA 5CVRA 2FNPA 1MZBA 1FSHA 3U1DA 2HGCA 2FBIA 2KRFA 5ILUA 1IF1A 3F8CA 4CGZA 2RQPA 2HR3A 3BP8A 1STZA 5FD6A 1PDNC 1IXSB 1QZYA 4OMYA 2Z99A 1YIOA 4BHPA 1IRGA 5ICFA 2DI3A 4LG0A 3I5UA 1R58A 2L01A 4HDUA 1IN8A 3WGGA 3L9FA 4N9IA 2AXLA 3ELKA 5DCFA 5L3DA 2A61A 4XSZF 4RGRA 5E1ZB 4LLGF 4HX8A 2HWVA 4A12A 5JHUA 4EVIA 3RTRA 1HXDA 3GO5A 3F3XA 3R6SA 5E20A 4F7ZA 1BI0A 5DCMB 4Y17A 2M5WA 1R36A 5BMZA 5LBQA 3C18A 1W4MA 2XHKA 3DKWA 4A5MA 2PFBA 5HLGA 2PI0A 3G3ZA 1LDDA 3QAHA 2HYGD 5K1YA 3GEZA 2O8XA 3CUQA 1SD4A 1H9GA 3DFGA 4S04A 4MQ9F 3J7AO 3QP6A 2DO7A 2QENA 1FX7A 2GA1A 3HIFA 3RKXA 3BWGA 5E8GA 1MGTA 2GXGA 3ZP5A 3FXQA 1ZGJA 3WU1B 4B8XA 4EJVA 2OQGA 3BPXA 1H9TA 3BZ6A 1FP2A 3JW4A 4CDGA 4PDKA 2FMYA 1MJBA 1Q1HA 1FNNA 4BHCA 3EYYA 4KN4X 3GFLA 4LLLA 2DAOA 4RAYA 3R4KA 4G7OF 1HKQA 3B73A 1Z91A 2HTJA 2JPBA 3LFKA 1J5YA 1KYZA 1TLHB 2VBWA 3Q9VA 1O3SA 4ENJA 3F6VA 4ZYGA 4UVCA 2XGXA 3E5UA 3TDZC 2YX4A 1ZGAA 4M9SA 3F23A 2GIVA 4P9FA 5HOOA 4KIBA 1MDMB 1MKMA 3I64A 1IXCA 3P9KA 4G8XA 2MBFA 4RGSA 5FLXK 1TQMA 4MGRA 2V79A 1U8RA 3O6BB 1L3LA 3FXRA 1W7PD 1MJAA 3E97A 3KP7A 1V4RA 3NRVA 4MHGA 5H6RA 2XROA 3CJNA 4FX4A 4EJWA 4MQVA 3RJPA 4YG2F 3CUOA 2OA4A 4BH9A 2P5LC 3SQNA 1S8NA 4U0YA 2QQ9A 1RI7A 3FMQA 4HF2A 3ECHA 5D5XB 3ZN0A 1ZREA 4XLNF 3LA7A 4U0VA 1O57A 3I59A 3V7RA 1ULYA 1ODDA 1EH7A 3VODA 2DQLA 1YQAA 1K6OA 4JK1X 3HRUA 2NAZA 2QYOA 2Z3YA 3KEOA 4PGHA 1ON1A 2AS5F 1USSA 3R60A 3ULQB 4MNUA 3HSRA 2BEOA 2UZKA 5CVIA 1XSXA 3QOPA 4FHTA 1ZAOA 5F6FA 5JFRA 4L0ZB 1CF7A 1OPCA 1SD5A 1IN5A 3FX3A 1ZN2A 1LJ9A 2WV0A 4I7HA 5CVVA 3HOTA 3P7NA 3LWFA 3RIRA 1F5TA 2F5DA 2FQ3A 5ILSA 3ZMTA 2IP2A 2MLGA 3TOBA 5D4SA 2RNJA 1WKMA 3ZMUA 2O0YA 5FLXZ 2RGVA 3WTVC 2VT2A 4UXNA 1FC3A 2IRFG 5FFXA 2Y75A 2GQQA 4KNYA 4L18B 1TW2A 3DV8A 3V4GA 4EM2A 4KYWA 2L4AA 2UXNA 3M7GA 5TRDA 5HS7A 1EH6A 2W24A 5BPDA 2DK8A 1K78A 3REOA 3WGHA 2ISYA 4A6DA 1OYYA 2P4WA 2IT0A 3LA3A 2EFPA 1MD0A 2KIMA 1FOKA 1HSTA 4Q47A 4PCQA 2P7CB 1XGOA 2M8EA 1WI9A 4HLYA 2XRNA 3I4PA 1YTYA 1NHAA 3FXUA 2DQRA 4RAZA 5J8CA 2TDXA 3D5LA 2WTEA 4G7HF 4L5IA 2HOEA 4ENKA 2UWMA 2OQRA 4U7BA 3PFIA 1HQCA 4A5NA 4EV0A 4HF1A 2V6CA 1IAWA 4U7DA 1OMIA 4HAMA 2STWA 3W6JB 4O5VA 1TW3A 2GWRA 5AIQA 1QQIA 3V8LA 1SFEA 4RGUA 4ESFA 1REPC 2QQAA 3WTSC 1L0OC 1YW8A 2H27A 1KYWA 5LHIA 3SFZA 1DPRA 4I0BA 4AWXB 3M1EA 5L3GA 4LLNA 1RUOA 4AD9A 3H3UA 2JRTA 5AIPA 1BI3A 4A0YA 1ZARA 2CYYA 4UNOA 3N97A 5ICEA 3E5QA 5ERIA 2EWNA 2OD5A 3JTHA 2FSWA 2VE8A 4HYEA 4Z2YA 1IN4A 5D6FA 2M45A 3HHHA 4ESJA 5E17F 1WWXA 1X3UA 1FLIA 4K2EA 3MEXA 1A04A 2YX7A 2PMHA 3R0JA 1FBQA 1JGSA 2EFWA 4AIJA 1QZZA 1DUXC 5LGNA 3QU3A 3H92A 5A2QZ 5HDKA 3ECOA 4HQMA 1OYWA 3I0TA 3IWFA 4KIGA 4HX4A 5CVJA 3CO7C 4I98B 5HVQC 3ABUA 2D45A 5D5WB 3HHGA 5D4RA 1FWZA 3E3VA 4UVAA 4Q5SF 4OIOF 4GO1A 1XD7A 2KIUA 2P5KA 3IRRA 1W7PA 1Z7UA 2QVOA 3KETA 4I09A 3WTXC 5FGMA 5TJJA 6PAXA 1KU2A 1LEAA 1ZRFA 3HRSA 2R7DA 1YFHA 3KEQA 3HSFA 3HRMA 2XIGA 4YFXF 2P6TA 5LRRA 3IL2A 2VT3A 1J59A 1U5TB 4P96A 2A68F 4EJOA 1EH8A 3ZMSA 1FYKA 3WTYC 2ACJA 3MZYA 3QPHA 4O3MA 2ESNA 2QBYA 2F2EA 2DFIA 1I27A 4AIHA 2RDPA 3I53A 2M30A 2Z33A 1WSUA 1ZLJA 1UFMA 3LQQA 3MZHA 1FT9A 5JI6A 4H0EA 5CYVA 1RUNA 3WTTC 2DW4A 3GZ5A 3P9CA 3HRTA 2GA2A 4ETSA 4EM0B 4RB2C 2BYVE 5LHHA 2CWEA 1KU7A 1O3TA 1G3TA 5D6EA 4U0WA 2KIFA 1HBXG 3Q5FA 2OBPA 3O2PE 2K27A 3FMSA 5DYMA 2BE5F 3H3ZA 2IJLA 2PQ8A 2HDCA 2FEZA 4EMSA 4ZYDA 3KP5A 1PP7U 4DNCA 2MA3A 4S05A 5D8LB 5HLIA 3L09A 3F22A 3ML6A 3ABTA 4IJAA 4LD5A 1F4KA 1YW7A 2PEXA 1GXPA 1YO5C 3VOEA 1T0FA 2EK5A 3E6CC 4ENMA 1G6NA 3F8MA 4M71A 4LK1F 4CXFA 1F1ZA 3KZYA 3MAJA 2VE9A 3KP4A 1SFXA 2IW5A 4KN7X 3VFZA 2CO5A 4ON0A 2XAQA 1Z9CA 5HDGA 5L3BA 1IW7F 4L0YB 3DEUA 4HDVA 2VN2A 3IKVA 1T39A 3DF8A 1B9NA 1U5TC 2CFXA 3KP2A 3CDHA 4ZYHA 4ZH4F 4IVNA 4KIFA 2NYXA 3F8NA 4P9UA 4Y13A 3E6MA 5E1XA 3BOQA 3RDIA 2BGCA 4HV5A 4HOBA 2DPUA 4XLPF 2L3DA 1KQ0A 2Y48A 2IPQX 2LF8A 5E8IA 4RB3C 1XB4A 2V1UA 1KGSA 3BPVA 4RB0A 3HOSA 4OMZA 5DUKA 2HKOA 5HS8A 1JHHA 4UUVA 2KKOA 5HDNA 1UHMA 1S6LA 1FYLA 1O7FA 4MTEA 1I1SA 2LF7A 2P6SA 1O3RA 4AIKA 1GVJA 1JHFA 1LDJA 4GYIA 3TDUC 2P7VB 2FA5A 3RKYA 2FE3A 4GCVA 5E1WA 3GFIA 5D5UB 3PQJA 1BC8C 4G6QA 5BQTA 4M9XA 2ZMEA 3QU6A 4EGZA 2DT5A 2D1VA 3ZMVA 3GX4X 2EV0A 1PP8F 2LDUA 2Q2EA 2R7FA 2PN6A 2FXAA 3TKYA 2V1XA 3LAPA 5KK1A 5ICCA 1SFUA 1I1GA 1P92A 4EJUA 2EJRA 1FBSA 1RZ4A 4TV7A 2E7WA 3GXOA 3QP5A 4KMUX 4HV6A 3HTSB 3GUDA 3FM3A 1P6RA 1P4XA 1KU9A 1XDUA 1HW2A 3ZPLA 2X4HA 5DUIA 2HQRA 4D0PA 1IZ1A 2XKPA 5KVRA 4G94A 2EFNA 3WTZA 1WRJA 2H94A 3E6BA 2GXBA 3U2RA 4ZZDA 1U2WA 3K69A 3QRFF 1ONVA 4LB6B 4CHUA 4LK0F 4G6DA 1ZG1A 5AONA 4M73A 5LGTA 2QQBA 1Y0UA 2G7UA 1XGMA 3E6DA 1ZG5A 2JZYA 4UVBA 1QBJA 3M9AA 3V7SA 2ZNYA 5EEGA 3L00A 2QLZA 2XASA 4IHTA 1P2FA 2WWYA 4HLXA 3N4MA 3WTUC 1ZRCA 3WE2A 5IT9K 2BV6A 1B59A 3IC7A 1QGPA 3ERED 2JTVA 2HQNA 4DQ2A 4KUMA 2CGPA 4YIIA 2VODA 4BYYA 4G9YA 1HSJA 4LG0B 1RIOH 3L2CA 3I71A 1B9MA 2Q8KA 2O03A 4A2UA 1ZRDA 2UXXA 3MFKA 3F8BA 1S3JA 4WWCA 3GW2A 2F5CA 1R5HA 1YG2A 2JT1A 2D1HA 1DDNA 4MEXF 5DCMA 3C3WA 1R00A 1JE8A 2VBZA 4OOIA 3WU0A 2L02A 3ZQ7A 1SD7A 1H0MA 3HYIA 4KMFA 2FBKA 2QZ8A 3ZN1A 3CUQB 1USTA 1OKRA 2M1BA 2GAUA 4JQFA 2A6EF 3DPLC 1K7AA 4OIRF 2G7HA 5H6QA 4WXDA 4N9HA 1B1BA 1SMYF 2XV4S 5FD5A 2OU2A 1GHCA 1UCRA 4Q48A 4QLCU 2VBYA 3KLOA 3GF2A 3M8FA 4JBAA 2QWWA 4BHBA 1AWCA 4IRGA 3WGIA 1VTNC 1P4AA 3BJ6A 4A0XA 2YPRA 4KDPA 2KJBA 3LA2A 3OV8A 2HS5A 2NRAC 5IT9Z 2EV5A 2ETHA 5CLSA 4UV9A 1MDMA 4WXHA 3GLXA 3B02A 1Z05A 2E1CA 3VEPA 2NNYA 1DPUA 5BOXA 3DPTA 1C0WA 2J5PA 5HS9A 4BAYA 2H09A 1T2KA 2O3FA 4CO8A 3RPQA 2XAHA 2YU3A 1IN6A 4WX9A 4WXCA 2B0LA 1TNSA 4YIFA 5JR3A 5L3CA 5D5VB 4MTDA 1J0RA 5ICGA 4BNCA 2DTRA 5HLHA 3GVAA 5ILVA 3I59B 2X0LA 1BJAA 3J80K 3IHUA 5DEQA 5LGUA 3CUQC 3EDPA 1U6GA 2XUBA 2D2WA 2LSOA 4P5OA 3JAMK 3K2ZA 1LVAA 2FOKA 3FMRA 2NNNA 1MJ9A 1XDSA 1D5VA 5LEKA 2L4MA 4L9NA 1S7OA 1R7JA 1CF7B 2W85A 3BROA 3BJAA 3MCZA 5CJ9A 2C6YA 2FNAA 5F64A 3P9IA 3GYHX 5LHGA 1TNTA 3IWZA 1HW5A 2DU9A 3FWEA 2A3SA 2IA2A 1YS6A 2RV8A 1RNLA 3HTUA 3FZVA 2XKOA 4HA8A 5D8KB 1FYMA 1TQIA 1BN5A 3JSOA 2ELHA 3K1NA 1FBUA 1KQ9A 3F8FA 4U88A 3WG9A 4KICA 4WK8F 1HW1A 2H6CA 4IXAA 2ZJ2A 3T0YA 1SMTA 1Z6TA 2CQKA 4GXOA 1O7LA 5BS6A 2ZNZA 4PGGA 2V1DA 5FO5A 1K78B 4EM1A 2W57A 3KFWX 3K1PA 2YR2A 2FF4A 4ESBA 2WC2A 1S7AA 4WCGA 1DP7P 2VC1A 2RKHA 1XSVA 4AVPA 4EJTA 2E7XA 2DPDA 4OIQF 1B4AA 1XSDA 5JVTA 5DD4A 2DK5A 3J80Z 1J2XA 1KU3A 1W5SA 1BC7C 3DXJF 3EQLF 3I58A 4QWQA 4IPAA 2VXZA 1T98A 2FMLA 3LQRA 4N0BA 3E5XA 3R0AA 4YFNF 3V8JA 1XMAA 3JAMZ 3W6KB 2K4JA 1HKTA 4G7ZF 2XAFA 4OU0A 3J81K 1Z1DA 2EV6A 2HYFA 3KP6A 5EEHA 2MH2A 3CO6C 1TTYA 3DP7A 4BXUA 2A6HF 3JSPA 1KA8A 2CW0F 4R1HA 2ZFWA 3MWMA 3KE2A 2O6GE 5FB2A 4OINF 1YYVA 5F1RA 4IF4A 3BJOA 1R23A 2W84A 4PZJA 2YSRA 2DBBA 1E17A 2Y0MA 1BM9A 2STTA 1J75A 2HTSA 2ZO4A 1D3YA 4ZZLA 1ON2A 1QPMA 3QPTA 2PMUA 2JSCA 3K1MA 4LFUA 1I5ZA 2MH9A 4EGYA 4HF0A 4HQEA 1B6AA 2QM3A 1WQ2A 4UV8A 2ESHA 2GZWA 3SZPA 1IXRC 3KZZA 2OZUA 3DQVC 2HZTA 2VOPA 4A0ZA 2VBXA 1E2XA 2HEOA 5ED4A 1BI2A 5IT3A 2XAGA 4LMYA 1BIBA 3IRQA 2EA4A 1BBYA 5LRSA 4GYGA 1TBXA 1ZHFA 2MD5A 3L7WA 4WF2A 1QO0D 3D0SA 1IUYA 2LNBA 4FX0A 1KQ8A 2MC3A 3EUHA 1P4WA 3KP3A 1XN7A 4IHSA 4I02A 3WE3A 4HW0A 3C1DA 1FSEA 2A07F 4A6EA 2FBHA 1D8JA 4CYDA 5E18F 5L3FA 3CLOA 1SAXA 3J81Z 1T38A 2R3SA 2RN7A 1ZG3A 1G4DA 1YW9A 2PG4A 4BQAA 1W7PB 2J5OA 2JPCA 3FM5A 2QUFA 4MEYF 2FU4A 4FT8A 1XCVA 2ZBKA 3PQKA 3TQNA 3ZMZA 2ZCWA 1Z6RA 1LDKB 2Z5UA 4I0AA 1G3WA 1JXSA 4M72A 4XSXF 4Y15A 3G73A 1U5TA 2O61A 3K9TA 1G3YA 2F5EA 3EETA 2NS0A 2ZKZA 4CZZA 2EB7A 4R79A 2XAJA 2RC4A 5K5OA 4KA4A 1K79A 3AAFA 1O3QA 1ZLKA 1SD6A 4LGWA 2COMA 5K5RA 2RVCA 2QBYB 1LQ1A 5DD8A 2MLKA 3WTWC 4E70A 4RGXA 1U78A 1LEBA 1TQPA 1ZYRF 1G3SA 2A69F 3U9GA 3JTGA 2M87A 1XCBA 2OAZA 2CSOA 2DLLA 3ISPA 1R22A 3TGNA 3KCCA 4RB1A 1LNWA 5DV5A 3NQOA 4I01A 1IRFA 3HUGA 4M9ZA 2VOOA 3F72A 3HSEA 4CICA 3BY6A 1HKSA 3SZTA 2E1NA 3F21A 4HX7A 1FZPB 3NEUA 2HKXA 4M6YA 2XVCA 3GFJA 1IN7A 2G9WA 5CVUA 5A2QK 2V9VA 2VC0A 3EYIA 1OYIA 4O6JA 1FY7A 2W25A 3KLNA 2IA1A 4R8HA 3C7JA 5H20A 4OIPF 1T6SA 1GXQA 1R1UA 1ZH5A 2Z9OA 3O3KA 4XBFA 2F5FA 3F6OA 3IKTA 3SXYA 3RKWA 3T8TA 3FHZA 3M8EA 4ZYEA 4LJZF 1YLFA 3RI4A 1XGNA 2P5VA 3LAJA 1W5TA 2H6BA 2EFQA 1FPQA 1AOYA 1V3FA 4P55A 4L5JA 1QNTA 4EQQA 1CGPA 4UHTA 4M6XA 4KT5C 4IRIA 1J7KA 2ADUA 3LSTA 1EV7A 1BIAA 4L9JA 3WODF 1BOAA 5DDGA 1R5GA 1BI1A 5J6XA 3TOAA 3GZ6A 4NB5A 4GGGA 1LB2A 4YFKF 4XRFA 3BDDA 2ISZA 5BPIA 1D8KA 2Q0OA 1F9NA 3I54A 1XMKA 2L54A 1S29A 3SHFA 3RYRA 3S2WA 2EFOA 4HZFA 4ASNA 2EA2A 3T8RA 2ZMEB 3VB2A 3ZMDA 4Q4ZF
chains in the Genus database with same CATH superfamily
4BMJA 5KL2A 2ZXJA 5J8FA 1UB9A 4HNTA 2R7OA 4C2MJ 3M4OJ 2A6TA 4KFCA 3M3YJ 4OX9E 2ID6A 2Q2EB 2XF5A 3AL0C 2WBUA 2VONA 3S2HJ 2V87A 5E3LA 4BCAA 2ZSHB 4BQNA 1X19A 2XRLA 2IA0A 4NUBA 5EGOA 1R9TJ 3COAC 1J9IA 5K5QA 2G0EA 2IEKA 2PJRA 4F55A 1VQ6I 2P0WA 4I2OA 2P8TA 4O43A 4KT6A 2K02A 4Y3OA 4NHJA 2DMNA 2CV1A 3PM1A 4DZJA 2YTJA 3TO7A 9ANTA 1XGSA 3GFMA 2K86A 4ZYAA 2VXDA 3CTAA 3MQ0A 3TO9A 4DMIA 5LEJA 5LMUE 1QU3A 1DP3A 4X9JA 2K4BA 2VLAA 2FRHA 3V7CA 5LLQA 1JTYA 1RR7A 2IGNA 2HFHA 1SEUA 4L9VA 1NH3A 3RYPA 1A35A 4DV1E 3BTLA 3RPUA 3T1BA 3V8KA 4HBLA 1LE8B 3CCEI 4RS8A 2ZM6E 4B09A 3TO6A 4RLQA 4H4KC 4E7KA 3LSJA 2OJED 3OR1C 3T5XA 2PLYA 4A3LJ 1MEYC 2ZJRF 1FP1D 4IRHA 5IWAE 2MKDA 2HVQA 2L7KA 1HR0E 1ZELA 4BE1A 3OOPA 2N3GA 2IHR1 2GLOA 2JMWA 4ENNA 1OCCH 1QRYA 3Q9SA 2VL8A 3CJTB 3TW7A 3BTCA 2CJJA 3FF5A 5GAHJ 3BG9A 4X66E 3HZJA 4L9TA 4BDZA 4L5NC 1IGNA 2BBYA 2CG4A 2L5QA 2JOBA 1UHWA 1I6XA 4LB5A 1N77A 2PBIA 4RMNA 5L3EA 1R1VA 2A5YB 2OZ6A 2LKPA 5FFZA 1YS7A 5T6JA 4NXNE 1U3EM 2M4GA 3ZQHA 2BOLA 1YUJA 2JP9A 3R61A 4LF4E 1OR7A 1VFCA 1E3OC 3K4CA 4MFDA 1IDZA 2Y9YA 2PJPA 3DEEA 1SVMA 2YU8A 2KJCA 5HNHA 3JRFA 3K2AA 3ROUA 1PUEE 5FRNA 2IVMA 3MHSC 3K0LA 2K7LA 4GFBA 1O4XA 4M74A 4NQWA 2EN1A 3CC7I 4JI2E 1WJAA 1R1TA 2EN6A 2YZTA 3ZR8X 3DWLE 4QPQA 3GWZA 5CVRA 2FNPA 2MGQA 1JKRC 2ME6A 3L2QA 1MZBA 1FSHA 3U1DA 2HGCA 2FBIA 3ZOBA 2KRFA 5ILUA 1IF1A 2NVXJ 4M2ZA 5BNGA 4XOPA 3F8CA 4CGZA 2RQPA 2HR3A 3HPGA 2JXPA 3BP8A 3KYDB 2EOZA 1MH3A 1STZA 5M5YJ 5FD6A 1YUIA 1UN6B 3PL8A 1PDNC 2XF6A 1IXSB 1QZYA 4OMYA 1PJSA 2O8KA 1OISA 2OPTA 2Z99A 1YIOA 2ENHA 3BGHA 2F4IA 4HTGA 4BHPA 5KL6A 1IRGA 4AC0A 5ICFA 2DI3A 2ELYA 3FXLA 2EM3A 4DR4E 1HDPA 4MLQA 2ZMEC 3G1LA 4LG0A 1JKOC 1YYWA 4J8ZA 3I5UA 1R58A 2L01A 2QF7A 1Y8QB 4CCMA 4HDUA 1IDYA 1IQSA 1IN8A 1JT0A 3WGGA 1U9OA 2M3AA 2MC4A 3OS0A 3L9FA 4N9IA 1WJDA 2EM8A 2AXLA 3OYJA 3OYHA 3ELKA 5DCFA 3HOVJ 2ENAA 4XM3A 4MFEA 5L3DA 4F9AB 2L9NA 2DRPA 2A61A 2DMQA 4RGRA 2M9HA 3LSKA 4XSZF 5E1ZB 2HPIA 2ZJPF 2F5VA 1K4TA 2B7VA 2DMYA 4R03A 4LLGF 3OMYA 2L9VA 1AA7A 3CDIA 4HX8A 2HWVA 4JP0A 2IXSA 5J1YA 1GDTA 4A12A 2YTOA 5JHUA 4EVIA 4M0VA 3RTRA 1HXDA 3GO5A 3ZQGA 3F3XA 3R6SA 5E20A 1TWFJ 4F7ZA 5F08A 1BI0A 5DCMB 1X3WB 2M5WA 1R36A 4Y17A 5DTDA 5BMZA 5LBQA 2EPMX 3C18A 2R1FA 2MW8A 2LMDA 1W4MA 5FLXC 1I3AA 2XHKA 4YHHE 3DKWA 1TWHJ 4A5MA 2PFBA 3JTZA 3L2VA 1FJLA 5HLGA 2PI0A 3G3ZA 3CMYA 1LDDA 3QAHA 2HYGD 5K1YA 3GEZA 2O8XA 4BS9A 4C2UA 5IY5H 1XMXA 3CUQA 3AKZA 2QKLB 3ZQQA 2XB0X 1SD4A 2W00A 2VUMJ 2CQNA 4M3BA 4WSGA 1H9GA 3DFGA 1X6FA 1MIJA 4S04A 3ABMH 1WXRA 4MQ9F 1JKQC 3J7AO 3QP6A 4AM3A 2DO7A 4RM3A 2QENA 3H35A 1FX7A 2GA1A 4Q35B 3BG5A 2EPNA 3HIFA 3RKXA 4HG2A 4MLOA 3BWGA 1A1JA 4CH7A 1YZ9A 3CQZJ 5E8GA 1MGTA 2EILH 2GXGA 4PUSA 2E5NA 3FXQA 3ZP5A 1ERDA 2NS7A 1ZGJA 3WU1B 5FJ8J 2CS3A 2UUZA 2PRTA 4B8XA 4EJVA 2OQGA 5DNYA 1MMNA 1YJ9I 3BPXA 2HXIA 2RQQA 2TCTA 4FK5C 1H9TA 3BZ6A 1N32E 4BDYA 1DQUA 1FP2A 3JW4A 4CDGA 4PDKA 2FMYA 1MJBA 1Q1HA 2RREA 2LO3A 1FNNA 4BHCA 3EYYA 4KN4X 3GFLA 4LLLA 2DAOA 1VQ5I 1NK3P 2O9LA 4IHVA 2RSMA 4RAYA 3R4KA 4EATA 2M7BA 2V7FA 1X6HA 1A1GA 2E34A 2B3TB 1LFBA 3PO3J 2R92J 2EOEA 1YITI 1A1KA 2DODA 4G7OF 3B73A 1HKQA 1WI3A 1ZK8A 1Z91A 3CZ6A 2HTJA 2JPBA 3DTEA 2E36A 3LFKA 2PMZN 1J5YA 1GZ6A 1N75A 1KYZA 2DLQA 1TLHB 2VBWA 2EN3A 3Q9VA 1O3SA 4ENJA 3F6VA 3HC7A 4ZYGA 4UVCA 1RKTA 2XGXA 3E5UA 3TDZC 2YX4A 4F92B 1ZGAA 4M9SA 2YTPA 2EH3A 5E79C 4XOTA 3F23A 2GIVA 4P9FA 2ZC2A 2JSPA 1R4NB 5HOOA 4A3MJ 4KIBA 3S15J 1X1AA 1MKMA 1MDMB 5EZHA 3HOYJ 3I64A 4LG3A 1IXCA 4V2FA 4IL6C 3P9KA 4G8XA 4LF7E 2MBFA 4RGSA 4RAFA 5FLXK 5J4VA 1TQMA 3BZKA 4MGRA 2V79A 2X6OA 1U8RA 1SAUA 3O6BB 1L3LA 4IOAF 2IGMA 3FXRA 1W7PD 1FTTA 4FASD 1MJAA 3E97A 3ADLA 3RPUD 2KPMA 3PUBA 4A3EJ 4F52A 2RS7A 1A36A 3KP7A 3TP0A 1V4RA 3NRVA 4XIDA 4MHGA 5H6RA 2XROA 3CJNA 4D7NA 4FX4A 1MH4A 1IJWC 2JUGA 4EJWA 3KX2A 4KHPE 4MQVA 3RJPA 4YG2F 3CUOA 1B8IB 2OA4A 4XKWA 1WFXA 4UB8C 4BH9A 1X5WA 1APLC 2P5LC 2M1SA 3SQNA 1S8NA 4U0YA 3C4TA 2QQ9A 3J7YJ 1RI7A 3FMQA 4HF2A 1I6HJ 3ECHA 3HB9A 1FKAE 3AG3H 4X64E 5D5XB 5EG0B 3VSKA 2WAQA 3ZN0A 4FE7A 1ZREA 4HEA2 4XLNF 2XSDC 1AKHB 3LA7A 3O8GA 4U0VA 1O57A 2XF7A 4JI5E 3I59A 3V7RA 3ADIA 1ULYA 1ODDA 1EH7A 5TSEA 3VODA 4UUSA 2LCEA 1ZAAC 2DQLA 1BJZA 1YQAA 2DLKA 4D5FA 2EE8A 1K6OA 4JK1X 3HRUA 2X51A 2MKNA 2NAZA 2QYOA 2Z3YA 3K4NA 3KEOA 4PGHA 1ON1A 2BB8A 2AS5F 1USSA 4QPOA 3R60A 2LY2A 3H0DA 3ULQB 3KPHA 2BHYA 4JV5E 4MNUA 1UAAA 3HKZA 1MW7A 3A2KA 3HSRA 1W5CC 2BEOA 1N34E 4OAZA 2UZKA 5A69A 3HEFA 5CVIA 4IO9F 1XSXA 3QOPA 4GDFA 2EPXA 1IRZA 4FHTA 1ZAOA 1K83J 5F6FA 3CC4I 4PFPA 5JFRA 4L0ZB 1G2HA 3FHNA 2KHXA 1CF7A 2N8XA 5A2QC 1OPCA 1SD5A 2UXDE 1IN5A 3FX3A 2YTQA 1E3PA 1SR9A 4GRIA 1ZN2A 1I39A 3VSLA 5IYCJ 5HODA 1E0EA 5E3OA 1R71A 1LJ9A 2X1EA 2NVTJ 1WZ2A 2WV0A 4I7HA 3BR6A 3HBLA 5CVVA 3HOTA 3P7NA 1N78A 3LWFA 4KZSA 2I10A 3RIRA 1F5TA 3BC8A 5KL5A 2YT4A 1F2IG 3PUFA 4R2CA 2F5DA 2JA8J 4C3JJ 4FE4A 2RPCA 2FQ3A 2KFDA 3LLHA 5ILSA 4RHBB 3VYUB 3ZMTA 2IP2A 2MLGA 3TOBA 1X1BA 5D4SA 2W4SA 1W36D 2TRTA 4R2PA 4R2QA 2RNJA 5J4YA 3RQIA 1TT5B 3OSFA 2FTXB 2VPRA 2JPAA 1ETYA 2CRGA 4JI4E 1QA6A 1WKMA 3ZMUA 2O0YA 5FLXZ 1X4OA 2RGVA 3WTVC 3CDLA 2LY1A 2VT2A 4E7SA 4UXNA 1FC3A 2IRFG 2EQ3A 5FFXA 2Y75A 2GQQA 3GCMA 1MNDA 4KNYA 4L18B 1TW2A 3DV8A 3V4GA 2IS1A 2M4IA 3OL4A 4EM2A 2D9HA 3DKYA 4KYWA 2L4AA 4B47A 4IZZA 1N33E 2UXNA 3M7GA 2X1DA 5TRDA 4DW6A 1LKXA 5HS7A 1EH6A 2ZXIA 1Z3XA 3AFHA 2W24A 4WPYA 5BPDA 2DK8A 1K78A 3REOA 1VQ8I 2CQ7A 2ISYA 3WGHA 2JA7J 4A6DA 5A6BA 1OYYA 2P4WA 3N05A 2IT0A 3LA3A 3QQAA 4P7DA 3FISA 2EFPA 3A01B 1MD0A 2KIMA 3DBLB 3SDGA 2JA5J 1FOKA 1HSTA 4Q47A 4PCQA 4F9BB 2P7CB 1XNQE 2NOGA 1XGOA 5EJCA 2XGDA 2CU7A 2BXZA 2M8EA 1WI9A 4HLYA 2X48A 2MYSA 2XRNA 3I4PA 1CQTA 1RC9A 2QCOA 4R2SA 4JI6E 3QPLA 4DR6E 4JI7E 4XICA 1YTYA 3M8JA 1NHAA 2R4GA 3FXUA 4F3QA 1OLTA 1XC5A 1ZTRA 4BY7J 3UR3C 3FK7A 2K7IA 2DQRA 2WADA 3QODA 1MNEA 4RAZA 5J8CA 1U0JA 2TDXA 4F9CB 2LJUA 3D5LA 2DA5A 2VJ4A 2WTEA 3JRAA 4G7HF 2CFOA 4DJAA 3GTMJ 4L5IA 2GPIA 2DA6A 1MMGA 2HOEA 4QIWN 4ENKA 2UWMA 2OQRA 1YJNI 3S1MJ 4NC6A 3A4CA 4LF5E 4U7BA 2XGEA 4XRMA 1BA5A 3PFIA 1HQCA 4A5NA 4EV0A 4HF1A 3HPSA 4B3ME 2V6CA 1BOBA 4GKJE 1IAWA 4JYKA 3I9V2 2RAEA 4U7DA 5LD2C 1OMIA 4V19K 4HAMA 3DEWA 1WHQA 1FIAA 4ANJA 3HKZN 2STWA 4GKKE 2VE7C 3W6JB 4F2JC 2MDGA 4O5VA 1LVKA 1TW3A 2GWRA 4DV0E 4PJMA 2AQFA 5AIQA 1QQIA 4Y33A 1QZEA 3HTXA 3S8PA 3RCOA 3V8LA 3HM5A 3SYTA 1SFEA 4RGUA 1S9HA 1NTCA 5B5EC 2EZ6A 2X1CA 3THNA 1OCTC 4ESFA 1REPC 2QQAA 3WTSC 1L0OC 1A6QA 3QYBA 4F54A 2RQLA 1YW8A 2W1OA 3CCSI 2H27A 4CCLA 1KYWA 3S3NA 1M1EB 3FBNB 4M3FA 5LHIA 5FKNA 3SFZA 4A93J 1DPRA 2M0CA 2M7AA 2YRMA 4I0BA 4AWXB 3M1EA 3H5AA 2HU9A 2B7TA 2MG4A 5L3GA 2EOXA 3JRIA 4LLNA 1RUOA 4AD9A 3LSGA 4ZJZA 3QYFA 1DI2A 3H3UA 3HPHA 4B48A 2JRTA 5TGTA 5AIPA 2DDBA 3HQ1A 1BI3A 4A0YA 1ZARA 1ZQ3P 2DIXA 4V2GA 2CYYA 4UNOA 2VKHA 1V5FA 2A05A 4E7ZA 3N97A 4D5CA 2L9SA 2V9KA 1ENHA 2L7FP 4BE2A 3S16J 5ICEA 3GTGJ 3E5QA 3CP8A 5ERIA 2EWNA 2OD5A 3JTHA 2FSWA 2VE8A 4HYEA 4Z2YA 1IN4A 5D6FA 2F4OB 1P47A 2M45A 2HXOA 3DPUA 3FXJA 3HHHA 3OWTA 4ESJA 3D5SC 5E17F 1HOMA 1WWXA 1X2NA 3SEZA 1PJTA 1X3UA 5TISC 3FK6A 2R7TA 1EF4A 1FLIA 2XPWA 4K2EA 3OYAA 5FLVA 2K3PA 2MDRA 2JA6J 3MEXA 1A04A 2YX7A 2PMHA 3R0JA 1FBQA 1JGSA 3DU6A 2EFWA 4AIJA 1G2DC 2KT0A 1QZZA 4DV3E 3JRDA 1DUXC 5LGNA 2EIKH 3MZ8A 3S17J 1PUFB 3QU3A 4FISA 3RQ4A 2Q8UA 2CMPA 3H92A 5A2QZ 2VQHA 1LFUP 2E1OA 5HDKA 4X62E 4KITB 3ECOA 4HQMA 1OYWA 1V5GA 4DV6E 3I0TA 2F8BA 1AH5A 3GTOJ 5IYBJ 4NNJA 2ELZA 2EMKA 2X6YA 2BBGA 3IWFA 4KIGA 1T0FC 3ZRGA 1SC7A 3J7Yp 4HX4A 5CVJA 3CO7C 1UHZA 4I98B 2V1NA 5HVQC 2V8QB 3OYBA 3S2DJ 3ABUA 1UG2A 3ZGKA 2EM6A 1ETVA 3ERMA 4BBRJ 5D5WB 2D45A 1UZCA 3S14J 4DYRA 4A3KJ 3S1QJ 2IS4A 3LSMA 2H1KA 2CUZA 3HHGA 5D4RA 1TF3A 4BEHA 1Y39A 1FWZA 3E3VA 4UVAA 5C44J 4Q5SF 3GMEA 2RSIA 2DOFA 4OIOF 1Y56A 4CA0A 4GO1A 4GZNC 1XD7A 4I76A 3H36A 2KIUA 4NXME 2P5KA 3ZQCA 2GXAA 3G2BA 3JREA 4DBQA 3IRRA 3O8HA 1O0WA 2DCEA 1MNMC 1W7PA 1Z7UA 2QVOA 2WB1N 3W6VA 4ABZA 3D1NI 2NABA 3KETA 2M9AA 4A3BJ 4BY1J 4I09A 3IH4A 2EIJH 2XPVA 3BCBA 3WTXC 5FGMA 5TJJA 6PAXA 1KU2A 1LEAA 1ZRFA 3HRSA 1G8XA 2R7DA 1YFHA 3C2GA 3KEQA 3PIOF 2WAEA 3HSFA 4CCJA 3HRMA 2DTZA 4BC9A 2XIGA 4YFXF 2P6TA 5LRRA 2M8GX 3IL2A 3BG3A 2LBFA 1D1CA 2KL4A 2VT3A 1J59A 1U5TB 4P96A 2A68F 2YSOA 4EJOA 2ADRA 1I50J 1EH8A 3I3LA 4X8WA 3ZMSA 5KCMA 4AYBN 1FYKA 3WTYC 2ACJA 2N3HA 5A6BD 3AG1H 1OCRH 3CCQI 3MZYA 4AUXA 3QPHA 2E19A 4M3GA 4O3MA 2ESNA 3OYKA 2QBYA 3GTLJ 2F2EA 2DFIA 1I27A 3HOZJ 2EZHA 1FJGE 4AIHA 2RDPA 4A3IJ 3I53A 1TP4A 1UG0A 2M30A 3OOUA 1DGRM 2Z33A 1HNXE 1QHGA 1WSUA 2HHHE 2BY1A 4GEQB 1ZLJA 1UFMA 3LQQA 4CSWA 2PMZA 3MZHA 1N36E 3ASOH 5IP9J 1FT9A 5JI6A 1IV6A 1X58A 2HZDA 1VQ7I 4H0EA 4TUGA 5CYVA 4XORA 1RUNA 2H8WA 2E35A 4IQJA 2EL4A 3WTTC 2DW4A 2L7ZA 3OYIA 3GZ5A 3P9CA 1Z77A 2L3CA 2NUGA 1BW6A 3HRTA 2GA2A 1MSEC 2E72A 4ETSA 4FCYA 4EM0B 1UILA 4RB2C 2L3JA 4Y4RA 5GAGJ 1QVUA 4WYQB 2BY3A 2BYVE 3J7ZI 5LHHA 2CWEA 2ICWG 3QPSA 4ZC3A 1KU7A 1O3TA 1FOXA 2JWTA 1RETA 1JUPA 1G3TA 5D6EA 1LPQA 4U0WA 2Q1ZB 2KIFA 1YRNA 3C2HA 1HBXG 3JRHA 4LOCA 3Q5FA 2OBPA 4XLHA 2CUJA 3O2PE 3IWDA 4BE0A 1U9NA 2K27A 2KDZA 3FMSA 2JN6A 2VI6A 5DYMA 2BE5F 1S7EA 3H3ZA 2IJLA 2PQ8A 2HDCA 2FEZA 1TN9A 1HF0A 4EMSA 1PDAA 4UB6C 1EKEA 1RESA 4ZYDA 2EMYA 3KP5A 1PP7U 2HOSA 5LMNE 3HUGB 2ENCA 5EZGA 4DNCA 5JVGF 2MA3A 4S05A 2JVHA 4O5GA 3IAS2 2R5ZA 5B66C 5D8LB 3CMAI 5B3SH 5HLIA 2QKMB 3W2VA 3DTKA 3L09A 3F22A 3ML6A 2B7EA 3ABTA 3NAUA 4IJAA 2EZIA 4LD5A 1F4KA 5A6AA 1YW7A 2CTDA 2KOUA 2JOXA 2PEXA 1GXPA 1YO5C 3VOEA 2K9LA 1T0FA 3CCVI 3G1MA 3L2UA 2HOAA 2EK5A 2RNGA 3E6CC 4ENMA 4M9VC 3C6KA 1G6NA 2LK2A 3A02A 2YPNA 3W2AA 1I3QJ 3F8MA 3S3OA 4M6VA 4M71A 4LK1F 3GZNB 4CXFA 1F1ZA 3SJMA 4L8NA 3KZYA 3MAJA 4A3GJ 2CUFA 2VE9A 2M34A 2K4VA 1PVEA 2XGCA 3KP4A 1SFXA 3DU5A 2IW5A 2W82A 4KN7X 1AAYA 2CT1A 3L2WA 3VFZA 2CO5A 4ON0A 4BBSJ 2XAQA 2R5YA 5HDGA 1Z9CA 5L3BA 1IW7F 4L0YB 3DEUA 4NBQA 4HDVA 1SFOJ 2VN2A 2EOMA 2M0MA 3IKVA 1T39A 2E5LE 3DF8A 3I55I 1DU6A 3IAM2 1B9NA 1U5TC 2CFXA 1ZGWA 3KP2A 3MSWA 4J00A 3CDHA 4Q28A 2OCEA 4ZYHA 2MC6A 4ZH4F 4IVNA 4XKBA 2GHFA 2EWLA 4XRSA 4KIFA 3OIQA 2NYXA 3CLQA 4JX5A 4CYCA 4XMYA 3F8NA 3D5RC 2X6XA 1X48A 4P9UA 2LRSA 1FMWA 1POGA 5CQGA 1P7JA 2JJ7A 1MBEA 4Y13A 4LIVA 2JY9A 3K4MA 2NUEA 2EOQA 1VQ9I 1AU7A 3E6MA 4J19A 2I9IA 2UU9E 5E1XA 3BOQA 1X3CA 3RDIA 2BGCA 2HPMA 4HV5A 1ZR4A 2ZXWH 1X1DA 3PSIA 1KZHA 4AQYE 4HOBA 2DPUA 4D7MA 4XLPF 2L3DA 3EPKA 2VQGA 2LP0A 4DV5E 3VYYA 1KQ0A 2Y48A 2EMAA 2IPQX 3CMMA 2LF8A 5E8IA 4RB3C 1XB4A 1XS9A 3F9KA 3LSIA 1KGSA 3PIPF 2V1UA 3BPVA 4RB0A 3HOSA 4OMZA 5DUKA 2N8GA 4KISA 2EN7A 2HKOA 1W0TA 5HS8A 3K70C 1JHHA 3JRBA 4LF6E 4UUVA 2KKOA 2EIMH 4B3TE 5HDNA 1UHMA 4KWYA 1V54H 1S6LA 1XX5A 1GVDA 1FYLA 1B72A 2DJNA 2YTIA 2L8TA 1YOVB 1O7FA 4MTEA 1T33A 1I1SA 2LF7A 2P6SA 5KL4A 3HOXJ 1WPKA 2R7WA 3DLLF 2LTSA 2BW3B 1O3RA 4AIKA 5E3NA 4R2DA 1JHFA 1GVJA 1LDJA 2E1MB 4GYIA 3IWBA 5EDNA 2FJ1A 5CKTA 5IPAA 4IX7A 4A3JJ 3EPZA 1YI2I 2GOXB 1JK1A 2K9SA 3TDUC 2LBSB 5ADZA 4XLAA 4B44A 2E2HJ 3SFIA 2P7VB 2FA5A 3RKYA 4DBRA 5GTHC 2FE3A 1MMSA 2YUSA 2ID3A 4GCVA 2EQ0A 5E1WA 2LJHA 2EM4A 1XPXA 3HG9A 3GFIA 2V85A 4HSTA 5D5UB 3PQJA 3H9JA 1BC8C 4LFBE 4G6QA 2H1LA 2LR8A 2ELKA 5BQTA 2Y30A 2ZMEA 4M9XA 3QU6A 4LU9A 1H8AC 3MHHC 4EGZA 2DT5A 3VK6A 2D1VA 3ZMVA 2LTPA 2L7MP 5CQEA 2EV0A 2A5WA 3GX4X 3W2WA 1PP8F 4LFAE 2LDUA 2Q2EA 4JX4A 2NVYJ 2R7FA 1WJFA 1D0XA 2CSHA 4YELA 3OYCA 1LFPA 3UKGA 3G1OA 5F0FA 4BJ5C 2CH0A 2DA3A 3WG7H 3IH3A 2PN6A 3OSGA 2FXAA 3TKYA 2NA2A 4R8OA 2E5ZA 5EGOB 2V1XA 4C3HJ 2RS6A 3BQZA 3LAPA 3LSHA 2PJRB 2DYSH 5AASA 2ME0A 5KK1A 4MO7A 5IT9C 5ICCA 1SFUA 1I1GA 1BW5A 2FOWA 1NK2P 1P92A 4EJUA 2DMTA 2EJRA 1FBSA 1L4SA 5EYRA 1HDDC 3GTJJ 2GIZA 2EZLA 5GTIC 1RZ4A 2JA2A 4TV7A 2Y9ZA 1LE8A 1Z1BA 4M3EA 3TL4X 2E7WA 5K7ZA 3GXOA 2GLIA 3OIOA 3QP5A 4KMUX 4QSHA 2CV2A 4HV6A 3HTSB 5KL3A 2EPLX 3OR2C 3GUDA 3RSNA 3FM3A 3QYEA 2X85A 5IOZA 1P6RA 1P4XA 1KU9A 1PJQA 2LYCA 1XDUA 5JHFA 4PK4A 2K9QA 2XB5A 5FLMJ 3JR9A 1HW2A 2QSGX 3ZPLA 4II3A 2X4HA 3OIPA 5DUIA 2DB2A 1X4PA 2HQRA 4D0PA 1IZ1A 3H09A 3BBGA 2VKDA 2VPLA 2CV0A 3CCYA 1UELB 2E60A 2XKPA 3CD6I 4AU7A 3J7AY 5KVRA 2K85A 4G94A 2EOIA 2EFNA 2UUAE 2BVLA 5A6KA 3WTZA 1WRJA 3OY9A 2H94A 3E6BA 1WGXA 1YX3A 4B3AA 1VNDA 3U2RA 4ZZDA 3BG6A 1U2WA 3K69A 4CZCA 2GXBA 1A1IA 4PJ0C 3QRFF 1ONVA 4IHWA 2XAUA 4LB6B 1UBDC 4CHUA 4LK0F 2R7QA 2XC7A 3BR0A 2AXTC 4G6DA 4OAYA 1ZG1A 5IXMB 4D9JA 2EOJA 2VJ5A 3FBIB 3UK3C 5AONA 3PNYA 4M73A 3TP3A 5LGTA 2QQBA 1Y0UA 2G7UA 4DZPA 2WZOA 1XGMA 3BF2A 1YE9A 4W1UA 3E6DA 1ZG5A 1VQOI 1WJCA 1S5LC 2FUG2 3A0HC 2JZYA 4UVBA 1FIPA 4C3IJ 1QBJA 4NQWB 3M9AA 3V7SA 2ZNYA 5EEGA 2JRMA 5CPRB 4IJDA 2E1MC 2UXBE 1HCRA 3L00A 2JQ7A 4PJJA 2QLZA 2Z16A 2VQFE 1ETKA 4E7IA 2XASA 4IHTA 1GQEA 1P2FA 5F3WA 1EKZA 2WWYA 4HLXA 3CF5F 4XN3A 1WJPA 1BR4A 2L9RA 3N4MA 3WTUC 5IOYA 1ZRCA 3WE2A 5IT9K 3ADGA 5AE2A 4PFOA 2BV6A 1B59A 2VASA 3IC7A 3THOB 1QGPA 2EMWA 3ERED 3ECRA 4XKVA 2L2KB 4TUIA 2JTVA 4FQGA 1T4OA 4XRSG 5IP6A 3FIGA 2AO9A 1P7IA 2HQNA 3ZXSA 4DQ2A 4EEFG 1RMDA 1UMQA 4KUMA 5GP9A 5F0HA 2CGPA 1HA8A 1GV2A 4YIIA 4DIQA 4YRVA 1PJRA 2DFHA 4BYYA 2VODA 1NEIA 4G9YA 4BC7A 1GT0C 1HSJA 4LG0B 1RIOH 1BR1A 4F91B 3L2CA 3J7AG 3I71A 1DGCA 3OS1A 4ZTJA 4A69C 3MKZA 1B9MA 5E3MA 3CJQB 2Q8KA 5IP7J 2O03A 4IQ4A 2K40A 3BR2A 4A2UA 1ZRDA 2UXXA 5FKLA 4C9YA 3MFKA 2K9MA 3MKYB 1ZBTA 3F8BA 1S3JA 1JUSA 4WWCA 3GW2A 2L2NA 2F5CA 1VQMI 2EPCA 1SVLA 1TWGJ 1R5HA 2ECCA 1YG2A 2JT1A 3CF2A 4HPQA 2LUQA 3VYTB 4CUGA 2D1HA 1DDNA 2DYRH 4I99C 3E0JB 4MEXF 5DCMA 3C3WA 2VRDA 4E6KG 1Z67A 1FOWA 2KP6A 1MSFC 1KYQA 2WB1A 1TC3C 1R00A 1JE8A 3IH2A 1XMQE 4NC7A 2VBZA 3BQYA 3I56I 2DSYA 2EJ4A 4OOIA 3WU0A 2L02A 3ZQ7A 1SD7A 1H0MA 1VF9A 1DGWY 1K4SA 3ADJA 3HYIA 4A3FJ 4DV4E 4KMFA 4N4OB 4X6AJ 2FBKA 3C6MA 2QZ8A 3BTJA 3ZN1A 3OYLA 2EMFA 2EM0A 2LG4A 3G4SI 3CUQB 3DF6A 1USTA 1OKRA 2M1BA 5BR8E 2GAUA 4JQFA 1TF6A 2EN2A 5AC5A 2A6EF 3DPLC 1F36A 1K7AA 4OIRF 2G7HA 1GTKA 4FETA 2EMBA 1OFCX 2K9NA 5H6QA 4J01A 2YU5A 4WXDA 4N9HA 3HOUJ 2JR1A 2R7ZJ 1B1BA 4AYBA 5K7FA 1VZ0A 4X65E 1SMYF 2XV4S 2I5UA 2JVGA 2QEXI 5FD5A 2OU2A 3CCMI 1GHCA 4HNVA 1E3HA 1UCRA 2CQQA 2ZJQF 4Q48A 4QLCU 1XNRE 2E2IJ 1R49A 2ZSIB 2LE2A 2VBYA 3F6GA 3KLOA 1TZLA 2KDOA 4DV7E 3GF2A 4O4KA 3M8FA 2YTFA 1T4LB 3PO2J 1OR7C 4JBAA 4DR5E 3LL7A 2M2EA 2DFEA 2QWWA 4BHBA 1AWCA 4IRGA 3WGIA 2UUCE 1VTNC 1HLVA 3WU2C 3J80C 1P4AA 3BJ6A 4A0XA 2YPRA 2NXNB 4KDPA 2OV7A 2WV1A 3K7AJ 2DMPA 4E4HA 1EJ9A 2KJBA 3KZIC 3LA2A 3HPZA 3PFYA 1R4MB 2HS5A 3OV8A 2NRAC 1IV8A 2EV5A 5IT9Z 4WSPA 2ETHA 3MMYB 5CLSA 2OUMA 4DV2E 2MABA 1MBGA 1NCSA 1Q1VA 4UV9A 4ZTFA 2LVHA 4NC8A 4XN0A 3JAMC 3GTQJ 2V4JC 5GPAA 1MDMA 1MMAA 1Y1WJ 4WXHA 3GLXA 2IS2A 2DFFA 3K4LA 5IV8B 1JK2A 2F6CA 2JYAA 2NVQJ 4MIMA 2EM9A 2COBA 1VI0A 3FKIJ 1WJEA 4JI3E 3B02A 3B6AA 2L92A 1PKPA 1Z05A 1NG7A 3TMOA 3BIDA 2DA7A 2E1CA 2DGCA 2GM4A 4X0GA 1H88C 3DKXA 3VEPA 3CCRI 4R2RA 1IC8A 3OYEA 2NNYA 1DPUA 2YTEA 2LTRA 1F43A 2NVUB 2Y69H 5BOXA 3DPTA 2FQ4A 2EM2A 1C0WA 2KRCA 4II2A 2V86A 2WBTA 5A6JA 3HXLA 3H3VK 2J5PA 5HS9A 1MBJA 3VYSB 3BG7A 5HLTA 3G71I 4BAYA 2H09A 1T2KA 1B8IA 4BGDA 2O3FA 4CO8A 3IV5A 3RPQA 2E2JJ 2XAHA 2IAIA 2YU3A 1ZR2A 2EMZA 3SDBA 3OYDA 1IN6A 4WX9A 4PSXA 4WXCA 4ZDOA 3QOEA 3S32A 3ZQLA 5FKKA 5EG0A 3BLYA 3HL2A 4OOGC 2B0LA 1JI8A 1G2FC 1TNSA 4YIFA 5JR3A 5L3CA 1AKHA 5D5VB 4DR3E 4MTDA 3QG5C 1J0RA 5ICGA 1YHQI 4BNCA 1X2MA 2DTRA 2VQLA 4ITVA 3EUKL 3WHBA 5J1RA 5HLHA 3GVAA 2QSFX 3JRGA 5ILVA 4DKKA 2D5VA 3I59B 1LLMC 2X0LA 1BJAA 2ZB9A 3OS2A 3J80K 3IHUA 1Z7LA 4RA2A 4UUSB 2UXCE 5DEQA 5LGUA 3TW6A 4I6ZA 4RM2A 3CUQC 1SANA 4P1WA 1A5JA 3NWTA 1VQLI 3EDPA 1XTAA 1U6GA 3KEYA 2CW8A 2XUBA 2LUPB 2B63J 1K6YA 2D2WA 2LSOA 2Y31A 5K7HA 5M3FJ 4P5OA 1K61A 2EM7A 3JAMK 2CW7A 2EMGA 4IHXA 1ITYA 3K70D 5KAFC 3K2ZA 3TEDA 1Z21A 5J1UA 1BB8A 1LVAA 2FOKA 3FMRA 1WH5A 4BU2A 2NNNA 3Q0VA 2ODRC 1MJ9A 1XDSA 1D5VA 5EF6A 3LMLA 5LEKA 2L4MA 1X3ZB 4L9NA 2B9SA 1S7OA 2EL6A 3FDYA 1ZU1A 1R7JA 1TWAJ 4RDUA 4R2AA 1CF7B 2GBYA 2W85A 3BROA 2UUBE 3BJAA 3W3CA 2EPOA 3MCZA 5CJ9A 2C6YA 3BZCA 2EQRA 1OCZH 2FNAA 4PJLA 5F64A 3MN2A 3P9IA 3GYHX 2EP3A 1XMOE 1V55H 5LHGA 1TNTA 3IWZA 3GBGA 2ECBA 3L1PA 2HNHA 2LREA 1HW5A 2V88A 2DU9A 2FD5A 4FTHA 3AG4H 4B3XA 2YWQA 3FWEA 1J5EE 2A3SA 4BKXA 2IA2A 1DU0A 4B3SE 1YS6A 1UHSA 2RV8A 1RNLA 1JJ6C 3HTUA 2YTGA 3FZVA 2XKOA 3JCUC 4HA8A 5D8KB 1FYMA 2QA4I 1TQIA 1BN5A 1ETXA 3JSOA 2ELHA 3GTPJ 2EPUA 1UJ8A 2DT7B 3K1NA 4CCOA 4R2EA 1FBUA 1KQ9A 3OL3A 3F8FA 4U88A 3BT9A 3WG9A 5F1JA 1QPIA 3J81C 4KICA 4WK8F 2EPAA 3ASNH 3DBRB 1HW1A 2H6CA 1MBFA 2DA1A 2LH9A 3VPRA 4BJ6C 2EORA 2KZVA 3L2RA 1T8IA 1Y0NA 2H36X 2DDAA 4IXAA 1VQ4I 2ZJ2A 2Y0SN 3QWLA 3T0YA 1SMTA 1Z6TA 2AQEA 2QQ8A 2Z2SB 3Q0WA 2CQKA 5LFAA 5M5XJ 2LOOA 4GXOA 5KAIC 4CCNA 1O7LA 2JWOA 5BS6A 4RBOA 2ZNZA 4PGGA 1WHUA 3CCLI 3K4JA 2O7OA 2V1DA 5FO5A 1K78B 1OCPA 2R7UA 4JYAE 4EM1A 2W57A 3KFWX 3K1PA 2YR2A 4DYCA 1ZKGA 2BXYA 2R0QC 3A01A 3JU0A 2LT7A 2O5RA 4XLEA 4F6MA 3RMPA 3G6EI 2FF4A 1NG6A 3SEQA 4ESBA 3EUHC 1JUMA 2WC2A 3AV0A 3GTKJ 4XR6A 2EPKX 1S7AA 4WCGA 1R6RA 3OYNA 2VC1A 3ZQIA 1DP7P 1BBGA 3M99B 2RKHA 1XSVA 3VYXA 3H5RA 3IUOA 2X9DA 4AVPA 4EJTA 2E7XA 2EMCA 2V26A 2DPDA 4OIQF 1T56A 4IKFA 1QU6A 1B4AA 1XSDA 5LL6R 5JVTA 1BBOA 5DD4A 2DK5A 4G6TB 3NARA 2EZKA 4XLFA 5JLXA 3J80Z 3RKQA 1J2XA 1KU3A 1B69A 2LD5A 1W5SA 1BC7C 3DXJF 4RH8A 3EQLF 3MKWB 3C4BA 2FV4B 1A1FA 3I58A 4QWQA 4IPAA 1TL8A 2YU9J 2LKSA 2VXZA 1T98A 2V83A 2FMLA 4C30A 3LQRA 4N0BA 1P9QC 1ETWA 1QVTA 2YS9A 3E5XA 3E7LA 3R0AA 4RLFA 4YFNF 4F93B 5JLWA 3V8JA 3S1RJ 3KYCB 5C4JJ 1RR8C 4O24A 1GUUA 2UV1A 4YEJA 1XMAA 3JAMZ 5H2FC 2OCCH 3W6KB 3LOCA 4JI8E 4JI1E 4LF9E 2K4JA 1HKTA 1OJLA 3VWBA 5KL7A 4G7ZF 2XAFA 1D0ZA 2ZXHA 5FKMA 1YYKA 4OU0A 4Z6YA 2GOMA 5F0CA 2EMLA 2VKVA 2YTNA 2HYJA 2XSJC 1YX5A 2L6MA 2HGHA 3J81K 1Z1DA 3BR3A 2LLKA 3LNQA 2EV6A 2HYFA 3BR5A 2WAFA 3KP6A 5EEHA 2MH2A 3CO6C 1TTYA 2DJIA 3DP7A 4BXUA 2A6HF 3JSPA 3FKJA 3H9QA 4HSRA 4S0HB 1VQPI 2KZGA 1ETOA 3UNGC 1KA8A 2CW0F 1JGGA 1FOYA 4R1HA 2R7SA 2EBIA 5CFFE 4JI0E 2ZFWA 3MWMA 2EOFA 3EQ1A 2LRDA 2HVSA 3KE2A 4U87A 4KJZA 3I4NJ 2O6GE 2EOSA 1SFKA 3CC2I 4D1QA 1HNWE 5FB2A 4OINF 1KONA 2XPUA 1YYVA 4BQQA 5F1RA 4IF4A 5KHDA 2VB6A 3BJOA 4X1EA 1R23A 2W84A 4PZJA 2YSRA 2DBBA 3OTOE 1E17A 2Y0MA 3ZCOA 1BR2A 1BM9A 3LMMA 2STTA 1J75A 4Y52J 3FXMA 1JKPC 4JOMA 2HTSA 2ZO4A 3DCFA 1D3YA 1MMDA 2EMHA 3DTIA 4ZZLA 4HNUA 3C2BA 1X47A 1ON2A 1QPMA 3QPTA 4ZDLA 3H0GJ 2HDDA 2PMUA 5FKOA 2JSCA 3K1MA 4LFUA 1I5ZA 2MH9A 1A31A 4BXFA 5C3EJ 2WBSA 3E1SA 3ZQFA 5KNLA 4HF0A 4EGYA 4HQEA 1X6EA 1B6AA 1FEXA 2QM3A 1WQ2A 3U21A 3PNTA 4UV8A 2ESHA 2GZWA 4BL0B 2H8RA 3SZPA 2IS6A 4IHYA 3MVPA 1IXRC 3KZZA 1GV5A 1D5YA 2OZUA 4AVZA 2K3FA 3T1YE 3DQVC 3FIWA 1WVRA 2HZTA 3M07A 2VOPA 4P78A 2BY0A 5J47A 1Z0XA 4PSWA 3LSRA 4A0ZA 1N3GA 2VBXA 3K6QA 1OCOH 2Y2ZA 2L2OA 3VDXA 3KWRA 1E2XA 2DXIA 2HEOA 5ED4A 1PUFA 1BI2A 3A03A 4E7HA 5IT3A 2XAGA 4LFCE 4AIDA 4LMYA 1BIBA 1X1CA 2CUEA 3F0CA 3CCUI 4NHRA 2IGKA 3IRQA 2BY2A 3OYGA 2V89A 2EA4A 2PX9A 1BBYA 4ZDPA 4IOCF 2KQRA 5LRSA 4GYGA 1TBXA 3U1KA 1X1PA 1ZHFA 2MD5A 3L7WA 4WF2A 4XKCA 1QO0D 4BXXJ 1X49A 4BUPA 2VQCA 3D0SA 2LNBA 1IUYA 1R5ID 4FX0A 1KQ8A 2MC3A 3EUHA 1P4WA 2M4KA 1XN7A 3KP3A 4JX6A 4IHSA 3BTIA 4I02A 3BCAA 4HW0A 3WE3A 2EPPA 3C1DA 4M30A 4HRIA 1FSEA 2L33A 2A07F 4A6EA 2FBHA 1D8JA 1FTZA 4CYDA 1J26A 5IYDJ 3S1NJ 4BEHB 1OQYA 2E71A 5E18F 5L3FA 3MKLA 4E7JA 1N25A 3EPHA 1AHDP 3CLOA 4BQOA 3V42A 4B3RE 1SAXA 3OMLA 3J81Z 1SVOA 1T38A 5DM7F 2R3SA 3FXKA 2RN7A 4XONA 1ZG3A 4E7LA 1G4DA 1YW9A 2KIQA 2EPRA 2J7JA 4G12A 1Y1VJ 2PG4A 4BQAA 1W7PB 3S3MA 2J5OA 2JPCA 3FM5A 4B4CA 3AUZA 2QUFA 4MEYF 2LFBA 2FU4A 4FT8A 4XL9A 1YIJI 1XCVA 5B1BH 2OF7A 2VJIA 1MBKA 2DN0A 5F04A 3VHTB 1IQOA 2ZBKA 3PQKA 3CCJI 2WY8Q 5EEAA 2VF1A 2EOYA 3TQNA 5DM6F 1IO2A 3ZMZA 2ZCWA 2NUFA 1Z6RA 3ABLH 2V9PA 1LDKB 1LUJB 2WA0A 4XQFA 2Z5UA 4I0AA 1G3WA 2HI3A 1JXSA 2EPZA 4M72A 4XSXF 5FROA 3K4BA 4Y15A 3G73A 1U5TA 2LBFB 2F4VE 2ZFUA 2O61A 4BACA 2HJJA 4YY3E 3K9TA 1G3YA 2EN4A 2F5EA 3RZOJ 2W48A 2LC2A 3EETA 1YJWI 2NS0A 2ZKZA 4CZZA 1GLNA 2EB7A 2Z1DA 2IGOA 1WJ5A 2EN8A 4R79A 2XAJA 1MBHA 2RC4A 4RAGA 5K5OA 3F6HA 2CPNA 4KA4A 1Z3YA 1K79A 3P5JA 4W97A 1A6IA 3AAFA 1O3QA 1ZLKA 2HC5A 2RTXA 5AE3A 1SD6A 4LGWA 1IG7A 4XNFA 2B9DA 2COMA 2WBMA 3CP2A 3H9GA 3K10A 2CQXA 5FRMA 2I8DA 5K5RA 2RVCA 2QBYB 1LQ1A 3Q3SA 4DUZE 4IS1C 5DD8A 2MLKA 3WTWC 4E70A 1W1WE 4RGXA 1U78A 1LEBA 2R76A 1TQPA 1ZYRF 1RRJA 5F27A 2DT6A 3DBHB 1G3SA 2A69F 2KLOA 3CJRB 3U9GA 2EPFA 4Y7NJ 2LV2A 3LFUA 1FMVA 3VYRB 4I8OA 4PJNA 2F48A 2NS8A 2MFZA 3LSPA 4HEIA 3A0BC 3JTGA 4UY8I 4M3DA 3IP4B 4OWRB 3FXOA 2EM5A 2M87A 1XCBA 3M1CA 4LITA 2OTJI 2LKXA 2EQ1A 5B1AH 1RKWA 3Q0UA 3T1HE 2YRKA 4L5EA 4DR1E 2EMXA 1DQ3A 2OAZA 2CSOA 4BJTA 2R93J 1XG1A 2EL5A 2DLLA 3ISPA 1R22A 3TGNA 3KCCA 2XDVA 1YRNB 1T95A 2R7RA 2EMIA 5J40A 4DUYE 1J09A 3HOWJ 2HOTA 4RB1A 2LY9A 1LNWA 5DV5A 4IEJA 1D1AA 3NQOA 1ZR9A 4I01A 1IRFA 4NDLA 2KHMA 3HUGA 1Y8RB 4BBYA 4M9ZA 2HVRA 2EOOA 1BL0A 2M7QA 2DOAA 2VOOA 4LF8E 1IUFA 3X2QH 5GADJ 2W7NA 3F72A 3HSEA 4CICA 3BY6A 1HKSA 3SZTA 2E1NA 2R5ZB 3OYFA 3F21A 4HX7A 5GPCA 1FZPB 2JVAA 3NEUA 2A25A 2YRHA 5AC4A 2HKXA 4M6YA 1TWCJ 2ELJA 1ETQA 4K0KE 2XVCA 3SZGA 4MLVA 4B43A 3GFJA 1IN7A 2G9WA 2WAQN 5CVUA 4DR7E 5A2QK 3DJWA 3BR1A 2ODRD 1I94E 1WCMJ 4LIUA 2V9VA 3AL0B 2VC0A 1S72I 2MC5A 1PYVA 3GLLA 3EUAA 1JT6A 4DGWB 3EYIA 1OYIA 2K5CA 4O6JA 1FY7A 2KMUA 2W25A 2KISA 3KLNA 2IA1A 4R8HA 3C7JA 5H20A 4OIPF 1QHHD 1T6SA 3IWCA 1GXQA 1R1UA 1ZH5A 2YSPA 2L2MA 2R5YB 2HDWA 2JUCA 3PNVA 4NZVA 1A1HA 2L0KA 2Z9OA 3O3KA 2R7XA 1H89C 4XBFA 2F4MB 2F5FA 3F6OA 2I13A 2BZTA 4C2TA 2R7VA 3IKTA 3PJRA 3WHCA 2OTLI 3CMEI 3I4MJ 3SXYA 3A1YA 3RKWA 1U8BA 1D1BA 3HGGA 2QSHX 3T8TA 2VIXA 2FGGA 2V6EA 2DOEA 3FHZA 3M8EA 4ZYEA 1TT0A 4LJZF 1YLFA 4CYCB 3RI4A 4DYQA 1ORKA 1IRXA 1XGNA 2P5VA 2NOJB 3LAJA 1W5TA 2H6BA 2VQEE 1RC7A 2EOHA 5M5WJ 1WHNA 2EINH 2FX0A 5GAEJ 2EFQA 2IBDA 1JTXA 3TQMA 1D0YA 2MSYA 3K6GA 3HDDA 1WJBA 2OC6A 4UUTA 1G59A 1FPQA 3HJEA 1AOYA 4WFTA 1EA3A 1V3FA 3CESA 4YIRX 4P55A 4DR2E 4L5JA 1QNTA 1T4NA 4EQQA 2QGUA 5DS9A 1CGPA 4UHTA 1V5EA 4A3DJ 4M6XA 1W0UA 5AE1A 4KT5C 1ACIA 4N4RB 2JK3A 3RZDJ 1HNZE 4IRIA 1J7KA 2VJJA 1STUA 2ADUA 3ESWB 1JJ8C 1ZBQA 3LSTA 1IBLE 2HQAA 1KJKA 2LVSA 1EV7A 1BIAA 2KRHA 3PSFA 2WY7Q 3ABKH 1WH7A 2MD0A 1B72B 2YTDA 1IBME 1YSAC 3KIOA 4DOZA 2BW3A 2X6WA 4L9JA 3ONQA 2E1MA 4A3CJ 3S93A 4CCKA 1IBKE 3WODF 1BOAA 5DDGA 3OYMA 5C4XJ 3DLAA 2VKEA 2Y0SA 3ZOQB 1R5GA 1BI1A 2P81A 5J6XA 3KYLA 5HNFA 3TOAA 4N4NB 3GZ6A 3P1XA 3EPLA 1RQ0A 4NB5A 4GGGA 1LB2A 4YFKF 4XRFA 3B6CA 3BDDA 1T08B 4XK4A 2WCC3 3HGYA 2ISZA 1RPWA 2BVMA 2DA4A 5BPIA 2BHZA 1D8KA 3H1CA 4B1RA 2DA2A 2HQ5A 1VQNI 4F6NA 2Q0OA 1F9NA 1Y6IA 2LMZA 3I54A 1XMKA 2L54A 4QTRA 1S29A 1W36C 1HC8A 3H5NA 3SHFA 3RYRA 3S2WA 2EFOA 3MD2A 4HZFA 3NWSA 1VQKI 2AHQA 2KONA 1YPNA 3JRCA 3TBIA 1A1LA 4ASNA 4XLCA 3AG2H 2DMIA 4LTYA 2DMUA 2EA2A 2ZMEB 3T8RA 5J3LA 3VB2A 5M3MJ 1YYOA 3ZMDA 3EPJA 3K4KA 4Q4ZF 1IMUA
chains in the Genus database with same CATH topology
2ZXJA 5J8FA 1UB9A 4KFCA 2VONA 2IA0A 3COAC 1J9IA 5K5QA 4I2OA 2P8TA 2K02A 4NHJA 3TO7A 1XGSA 3GFMA 2K86A 3MQ0A 3CTAA 3TO9A 5LEJA 2K4BA 2FRHA 3V7CA 5LLQA 2HFHA 4L9VA 3RYPA 3RPUA 3T1BA 3V8KA 4HBLA 4RS8A 4B09A 3TO6A 2PLYA 3T5XA 1FP1D 4IRHA 3OOPA 4ENNA 3Q9SA 3FF5A 4L9TA 2BBYA 2CG4A 1UHWA 1I6XA 4LB5A 2PBIA 5L3EA 1R1VA 2A5YB 2OZ6A 2LKPA 5FFZA 1YS7A 1U3EM 3R61A 1OR7A 2PJPA 2KJCA 3ROUA 1PUEE 2IVMA 3K0LA 2K7LA 4M74A 4NQWA 1R1TA 3GWZA 5CVRA 2FNPA 1MZBA 1FSHA 3U1DA 2HGCA 2FBIA 2KRFA 5ILUA 1IF1A 3F8CA 4CGZA 2RQPA 2HR3A 3BP8A 1STZA 5FD6A 1PDNC 1IXSB 1QZYA 4OMYA 2Z99A 1YIOA 4BHPA 1IRGA 5ICFA 2DI3A 4LG0A 3I5UA 1R58A 2L01A 4HDUA 1IN8A 3WGGA 3L9FA 4N9IA 2AXLA 3ELKA 5DCFA 5L3DA 2A61A 4XSZF 4RGRA 5E1ZB 4LLGF 4HX8A 2HWVA 4A12A 5JHUA 4EVIA 3RTRA 1HXDA 3GO5A 3F3XA 3R6SA 5E20A 4F7ZA 1BI0A 5DCMB 4Y17A 2M5WA 1R36A 5BMZA 5LBQA 3C18A 1W4MA 2XHKA 3DKWA 4A5MA 2PFBA 5HLGA 2PI0A 3G3ZA 1LDDA 3QAHA 2HYGD 5K1YA 3GEZA 2O8XA 3CUQA 1SD4A 1H9GA 3DFGA 4S04A 4MQ9F 3J7AO 3QP6A 2DO7A 2QENA 1FX7A 2GA1A 3HIFA 3RKXA 3BWGA 5E8GA 1MGTA 2GXGA 3ZP5A 3FXQA 1ZGJA 3WU1B 4B8XA 4EJVA 2OQGA 3BPXA 1H9TA 3BZ6A 1FP2A 3JW4A 4CDGA 4PDKA 2FMYA 1MJBA 1Q1HA 1FNNA 4BHCA 3EYYA 4KN4X 3GFLA 4LLLA 2DAOA 4RAYA 3R4KA 4G7OF 1HKQA 3B73A 1Z91A 2HTJA 2JPBA 3LFKA 1J5YA 1KYZA 1TLHB 2VBWA 3Q9VA 1O3SA 4ENJA 3F6VA 4ZYGA 4UVCA 2XGXA 3E5UA 3TDZC 2YX4A 1ZGAA 4M9SA 3F23A 2GIVA 4P9FA 5HOOA 4KIBA 1MDMB 1MKMA 3I64A 1IXCA 3P9KA 4G8XA 2MBFA 4RGSA 5FLXK 1TQMA 4MGRA 2V79A 1U8RA 3O6BB 1L3LA 3FXRA 1W7PD 1MJAA 3E97A 3KP7A 1V4RA 3NRVA 4MHGA 5H6RA 2XROA 3CJNA 4FX4A 4EJWA 4MQVA 3RJPA 4YG2F 3CUOA 2OA4A 4BH9A 2P5LC 3SQNA 1S8NA 4U0YA 2QQ9A 1RI7A 3FMQA 4HF2A 3ECHA 5D5XB 3ZN0A 1ZREA 4XLNF 3LA7A 4U0VA 1O57A 3I59A 3V7RA 1ULYA 1ODDA 1EH7A 3VODA 2DQLA 1YQAA 1K6OA 4JK1X 3HRUA 2NAZA 2QYOA 2Z3YA 3KEOA 4PGHA 1ON1A 2AS5F 1USSA 3R60A 3ULQB 4MNUA 3HSRA 2BEOA 2UZKA 5CVIA 1XSXA 3QOPA 4FHTA 1ZAOA 5F6FA 5JFRA 4L0ZB 1CF7A 1OPCA 1SD5A 1IN5A 3FX3A 1ZN2A 1LJ9A 2WV0A 4I7HA 5CVVA 3HOTA 3P7NA 3LWFA 3RIRA 1F5TA 2F5DA 2FQ3A 5ILSA 3ZMTA 2IP2A 2MLGA 3TOBA 5D4SA 2RNJA 1WKMA 3ZMUA 2O0YA 5FLXZ 2RGVA 3WTVC 2VT2A 4UXNA 1FC3A 2IRFG 5FFXA 2Y75A 2GQQA 4KNYA 4L18B 1TW2A 3DV8A 3V4GA 4EM2A 4KYWA 2L4AA 2UXNA 3M7GA 5TRDA 5HS7A 1EH6A 2W24A 5BPDA 2DK8A 1K78A 3REOA 3WGHA 2ISYA 4A6DA 1OYYA 2P4WA 2IT0A 3LA3A 2EFPA 1MD0A 2KIMA 1FOKA 1HSTA 4Q47A 4PCQA 2P7CB 1XGOA 2M8EA 1WI9A 4HLYA 2XRNA 3I4PA 1YTYA 1NHAA 3FXUA 2DQRA 4RAZA 5J8CA 2TDXA 3D5LA 2WTEA 4G7HF 4L5IA 2HOEA 4ENKA 2UWMA 2OQRA 4U7BA 3PFIA 1HQCA 4A5NA 4EV0A 4HF1A 2V6CA 1IAWA 4U7DA 1OMIA 4HAMA 2STWA 3W6JB 4O5VA 1TW3A 2GWRA 5AIQA 1QQIA 3V8LA 1SFEA 4RGUA 4ESFA 1REPC 2QQAA 3WTSC 1L0OC 1YW8A 2H27A 1KYWA 5LHIA 3SFZA 1DPRA 4I0BA 4AWXB 3M1EA 5L3GA 4LLNA 1RUOA 4AD9A 3H3UA 2JRTA 5AIPA 1BI3A 4A0YA 1ZARA 2CYYA 4UNOA 3N97A 5ICEA 3E5QA 5ERIA 2EWNA 2OD5A 3JTHA 2FSWA 2VE8A 4HYEA 4Z2YA 1IN4A 5D6FA 2M45A 3HHHA 4ESJA 5E17F 1WWXA 1X3UA 1FLIA 4K2EA 3MEXA 1A04A 2YX7A 2PMHA 3R0JA 1FBQA 1JGSA 2EFWA 4AIJA 1QZZA 1DUXC 5LGNA 3QU3A 3H92A 5A2QZ 5HDKA 3ECOA 4HQMA 1OYWA 3I0TA 3IWFA 4KIGA 4HX4A 5CVJA 3CO7C 4I98B 5HVQC 3ABUA 2D45A 5D5WB 3HHGA 5D4RA 1FWZA 3E3VA 4UVAA 4Q5SF 4OIOF 4GO1A 1XD7A 2KIUA 2P5KA 3IRRA 1W7PA 1Z7UA 2QVOA 3KETA 4I09A 3WTXC 5FGMA 5TJJA 6PAXA 1KU2A 1LEAA 1ZRFA 3HRSA 2R7DA 1YFHA 3KEQA 3HSFA 3HRMA 2XIGA 4YFXF 2P6TA 5LRRA 3IL2A 2VT3A 1J59A 1U5TB 4P96A 2A68F 4EJOA 1EH8A 3ZMSA 1FYKA 3WTYC 2ACJA 3MZYA 3QPHA 4O3MA 2ESNA 2QBYA 2F2EA 2DFIA 1I27A 4AIHA 2RDPA 3I53A 2M30A 2Z33A 1WSUA 1ZLJA 1UFMA 3LQQA 3MZHA 1FT9A 5JI6A 4H0EA 5CYVA 1RUNA 3WTTC 2DW4A 3GZ5A 3P9CA 3HRTA 2GA2A 4ETSA 4EM0B 4RB2C 2BYVE 5LHHA 2CWEA 1KU7A 1O3TA 1G3TA 5D6EA 4U0WA 2KIFA 1HBXG 3Q5FA 2OBPA 3O2PE 2K27A 3FMSA 5DYMA 2BE5F 3H3ZA 2IJLA 2PQ8A 2HDCA 2FEZA 4EMSA 4ZYDA 3KP5A 1PP7U 4DNCA 2MA3A 4S05A 5D8LB 5HLIA 3L09A 3F22A 3ML6A 3ABTA 4IJAA 4LD5A 1F4KA 1YW7A 2PEXA 1GXPA 1YO5C 3VOEA 1T0FA 2EK5A 3E6CC 4ENMA 1G6NA 3F8MA 4M71A 4LK1F 4CXFA 1F1ZA 3KZYA 3MAJA 2VE9A 3KP4A 1SFXA 2IW5A 4KN7X 3VFZA 2CO5A 4ON0A 2XAQA 1Z9CA 5HDGA 5L3BA 1IW7F 4L0YB 3DEUA 4HDVA 2VN2A 3IKVA 1T39A 3DF8A 1B9NA 1U5TC 2CFXA 3KP2A 3CDHA 4ZYHA 4ZH4F 4IVNA 4KIFA 2NYXA 3F8NA 4P9UA 4Y13A 3E6MA 5E1XA 3BOQA 3RDIA 2BGCA 4HV5A 4HOBA 2DPUA 4XLPF 2L3DA 1KQ0A 2Y48A 2IPQX 2LF8A 5E8IA 4RB3C 1XB4A 2V1UA 1KGSA 3BPVA 4RB0A 3HOSA 4OMZA 5DUKA 2HKOA 5HS8A 1JHHA 4UUVA 2KKOA 5HDNA 1UHMA 1S6LA 1FYLA 1O7FA 4MTEA 1I1SA 2LF7A 2P6SA 1O3RA 4AIKA 1GVJA 1JHFA 1LDJA 4GYIA 3TDUC 2P7VB 2FA5A 3RKYA 2FE3A 4GCVA 5E1WA 3GFIA 5D5UB 3PQJA 1BC8C 4G6QA 5BQTA 4M9XA 2ZMEA 3QU6A 4EGZA 2DT5A 2D1VA 3ZMVA 3GX4X 2EV0A 1PP8F 2LDUA 2Q2EA 2R7FA 2PN6A 2FXAA 3TKYA 2V1XA 3LAPA 5KK1A 5ICCA 1SFUA 1I1GA 1P92A 4EJUA 2EJRA 1FBSA 1RZ4A 4TV7A 2E7WA 3GXOA 3QP5A 4KMUX 4HV6A 3HTSB 3GUDA 3FM3A 1P6RA 1P4XA 1KU9A 1XDUA 1HW2A 3ZPLA 2X4HA 5DUIA 2HQRA 4D0PA 1IZ1A 2XKPA 5KVRA 4G94A 2EFNA 3WTZA 1WRJA 2H94A 3E6BA 2GXBA 3U2RA 4ZZDA 1U2WA 3K69A 3QRFF 1ONVA 4LB6B 4CHUA 4LK0F 4G6DA 1ZG1A 5AONA 4M73A 5LGTA 2QQBA 1Y0UA 2G7UA 1XGMA 3E6DA 1ZG5A 2JZYA 4UVBA 1QBJA 3M9AA 3V7SA 2ZNYA 5EEGA 3L00A 2QLZA 2XASA 4IHTA 1P2FA 2WWYA 4HLXA 3N4MA 3WTUC 1ZRCA 3WE2A 5IT9K 2BV6A 1B59A 3IC7A 1QGPA 3ERED 2JTVA 2HQNA 4DQ2A 4KUMA 2CGPA 4YIIA 2VODA 4BYYA 4G9YA 1HSJA 4LG0B 1RIOH 3L2CA 3I71A 1B9MA 2Q8KA 2O03A 4A2UA 1ZRDA 2UXXA 3MFKA 3F8BA 1S3JA 4WWCA 3GW2A 2F5CA 1R5HA 1YG2A 2JT1A 2D1HA 1DDNA 4MEXF 5DCMA 3C3WA 1R00A 1JE8A 2VBZA 4OOIA 3WU0A 2L02A 3ZQ7A 1SD7A 1H0MA 3HYIA 4KMFA 2FBKA 2QZ8A 3ZN1A 3CUQB 1USTA 1OKRA 2M1BA 2GAUA 4JQFA 2A6EF 3DPLC 1K7AA 4OIRF 2G7HA 5H6QA 4WXDA 4N9HA 1B1BA 1SMYF 2XV4S 5FD5A 2OU2A 1GHCA 1UCRA 4Q48A 4QLCU 2VBYA 3KLOA 3GF2A 3M8FA 4JBAA 2QWWA 4BHBA 1AWCA 4IRGA 3WGIA 1VTNC 1P4AA 3BJ6A 4A0XA 2YPRA 4KDPA 2KJBA 3LA2A 3OV8A 2HS5A 2NRAC 5IT9Z 2EV5A 2ETHA 5CLSA 4UV9A 1MDMA 4WXHA 3GLXA 3B02A 1Z05A 2E1CA 3VEPA 2NNYA 1DPUA 5BOXA 3DPTA 1C0WA 2J5PA 5HS9A 4BAYA 2H09A 1T2KA 2O3FA 4CO8A 3RPQA 2XAHA 2YU3A 1IN6A 4WX9A 4WXCA 2B0LA 1TNSA 4YIFA 5JR3A 5L3CA 5D5VB 4MTDA 1J0RA 5ICGA 4BNCA 2DTRA 5HLHA 3GVAA 5ILVA 3I59B 2X0LA 1BJAA 3J80K 3IHUA 5DEQA 5LGUA 3CUQC 3EDPA 1U6GA 2XUBA 2D2WA 2LSOA 4P5OA 3JAMK 3K2ZA 1LVAA 2FOKA 3FMRA 2NNNA 1MJ9A 1XDSA 1D5VA 5LEKA 2L4MA 4L9NA 1S7OA 1R7JA 1CF7B 2W85A 3BROA 3BJAA 3MCZA 5CJ9A 2C6YA 2FNAA 5F64A 3P9IA 3GYHX 5LHGA 1TNTA 3IWZA 1HW5A 2DU9A 3FWEA 2A3SA 2IA2A 1YS6A 2RV8A 1RNLA 3HTUA 3FZVA 2XKOA 4HA8A 5D8KB 1FYMA 1TQIA 1BN5A 3JSOA 2ELHA 3K1NA 1FBUA 1KQ9A 3F8FA 4U88A 3WG9A 4KICA 4WK8F 1HW1A 2H6CA 4IXAA 2ZJ2A 3T0YA 1SMTA 1Z6TA 2CQKA 4GXOA 1O7LA 5BS6A 2ZNZA 4PGGA 2V1DA 5FO5A 1K78B 4EM1A 2W57A 3KFWX 3K1PA 2YR2A 2FF4A 4ESBA 2WC2A 1S7AA 4WCGA 1DP7P 2VC1A 2RKHA 1XSVA 4AVPA 4EJTA 2E7XA 2DPDA 4OIQF 1B4AA 1XSDA 5JVTA 5DD4A 2DK5A 3J80Z 1J2XA 1KU3A 1W5SA 1BC7C 3DXJF 3EQLF 3I58A 4QWQA 4IPAA 2VXZA 1T98A 2FMLA 3LQRA 4N0BA 3E5XA 3R0AA 4YFNF 3V8JA 1XMAA 3JAMZ 3W6KB 2K4JA 1HKTA 4G7ZF 2XAFA 4OU0A 3J81K 1Z1DA 2EV6A 2HYFA 3KP6A 5EEHA 2MH2A 3CO6C 1TTYA 3DP7A 4BXUA 2A6HF 3JSPA 1KA8A 2CW0F 4R1HA 2ZFWA 3MWMA 3KE2A 2O6GE 5FB2A 4OINF 1YYVA 5F1RA 4IF4A 3BJOA 1R23A 2W84A 4PZJA 2YSRA 2DBBA 1E17A 2Y0MA 1BM9A 2STTA 1J75A 2HTSA 2ZO4A 1D3YA 4ZZLA 1ON2A 1QPMA 3QPTA 2PMUA 2JSCA 3K1MA 4LFUA 1I5ZA 2MH9A 4EGYA 4HF0A 4HQEA 1B6AA 2QM3A 1WQ2A 4UV8A 2ESHA 2GZWA 3SZPA 1IXRC 3KZZA 2OZUA 3DQVC 2HZTA 2VOPA 4A0ZA 2VBXA 1E2XA 2HEOA 5ED4A 1BI2A 5IT3A 2XAGA 4LMYA 1BIBA 3IRQA 2EA4A 1BBYA 5LRSA 4GYGA 1TBXA 1ZHFA 2MD5A 3L7WA 4WF2A 1QO0D 3D0SA 1IUYA 2LNBA 4FX0A 1KQ8A 2MC3A 3EUHA 1P4WA 3KP3A 1XN7A 4IHSA 4I02A 3WE3A 4HW0A 3C1DA 1FSEA 2A07F 4A6EA 2FBHA 1D8JA 4CYDA 5E18F 5L3FA 3CLOA 1SAXA 3J81Z 1T38A 2R3SA 2RN7A 1ZG3A 1G4DA 1YW9A 2PG4A 4BQAA 1W7PB 2J5OA 2JPCA 3FM5A 2QUFA 4MEYF 2FU4A 4FT8A 1XCVA 2ZBKA 3PQKA 3TQNA 3ZMZA 2ZCWA 1Z6RA 1LDKB 2Z5UA 4I0AA 1G3WA 1JXSA 4M72A 4XSXF 4Y15A 3G73A 1U5TA 2O61A 3K9TA 1G3YA 2F5EA 3EETA 2NS0A 2ZKZA 4CZZA 2EB7A 4R79A 2XAJA 2RC4A 5K5OA 4KA4A 1K79A 3AAFA 1O3QA 1ZLKA 1SD6A 4LGWA 2COMA 5K5RA 2RVCA 2QBYB 1LQ1A 5DD8A 2MLKA 3WTWC 4E70A 4RGXA 1U78A 1LEBA 1TQPA 1ZYRF 1G3SA 2A69F 3U9GA 3JTGA 2M87A 1XCBA 2OAZA 2CSOA 2DLLA 3ISPA 1R22A 3TGNA 3KCCA 4RB1A 1LNWA 5DV5A 3NQOA 4I01A 1IRFA 3HUGA 4M9ZA 2VOOA 3F72A 3HSEA 4CICA 3BY6A 1HKSA 3SZTA 2E1NA 3F21A 4HX7A 1FZPB 3NEUA 2HKXA 4M6YA 2XVCA 3GFJA 1IN7A 2G9WA 5CVUA 5A2QK 2V9VA 2VC0A 3EYIA 1OYIA 4O6JA 1FY7A 2W25A 3KLNA 2IA1A 4R8HA 3C7JA 5H20A 4OIPF 1T6SA 1GXQA 1R1UA 1ZH5A 2Z9OA 3O3KA 4XBFA 2F5FA 3F6OA 3IKTA 3SXYA 3RKWA 3T8TA 3FHZA 3M8EA 4ZYEA 4LJZF 1YLFA 3RI4A 1XGNA 2P5VA 3LAJA 1W5TA 2H6BA 2EFQA 1FPQA 1AOYA 1V3FA 4P55A 4L5JA 1QNTA 4EQQA 1CGPA 4UHTA 4M6XA 4KT5C 4IRIA 1J7KA 2ADUA 3LSTA 1EV7A 1BIAA