3KZYA

Crystal structure of snap-tag
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
176
structure length
162
Chain Sequence
DCEMKRTTLDSPLGKLELSGCEQGLHEIIFLGAAVLGGPEPLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYSHLAALAGNPAATAAVKTALSGNPVPILIPCHRVVQGDLDVGGYEGGLAVKEWLLAHEGHRLGKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SNAP-tag structure
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords SNAP-tag
total genus 47
structure length 162
sequence length 176
chains with identical sequence B
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2009-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3kzyA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 3kzyA01
2BBYA 2H27A 2A6HF 1BN5A 3RI4A 2EV6A 2H6CA 2FF4A 2Y0MA 2V1XA 4HX7A 1XGNA 2QYOA 1KYZA 3REOA 4PDKA 1W7PD 1T98A 2M8EA 1P92A 2LSOA 1R58A 2MD5A 2O61A 4ZZLA 1EH6A 1XN7A 1BOAA 4M71A 5AIQA 3R60A 1O3RA 2COMA 5HLGA 2X0LA 5DV5A 4IRGA 2FBHA 2GZWA 3M7GA 1FBSA 2NNYA 2JPCA 2OBPA 1G3WA 3SZTA 3KP4A 2DW4A 4EM2A 3QU3A 3GYHX 4HLYA 4S04A 1XCBA 2DLLA 5F6FA 1XGMA 2JT1A 4Q47A 4TV7A 3E5UA 1W5SA 1XDUA 2QVOA 2IA1A 1DUXC 1ON1A 3WE3A 2QUFA 4HLXA 1KYWA 3BPXA 3D5LA 3KLNA 2QENA 4P55A 2G7HA 2ZNZA 2XKPA 4FX4A 2MLGA 4UHTA 2Z33A 4KMUX 3KP3A 3BWGA 2FMLA 3WTWC 1Y0UA 2VODA 4M9XA 2OA4A 4LD5A 4RAYA 4HDUA 2JRTA 1Z6TA 2IP2A 4Y17A 4A6DA 3Q5FA 5E20A 1FBQA 5DCMB 3C7JA 5H6RA 2ZNYA 3GUDA 2P7CB 4UV8A 4EVIA 2GIVA 4BQAA 2DTRA 2HYFA 1ON2A 2M45A 4B8XA 1CGPA 1I6XA 2O3FA 1JXSA 3L2CA 4RS8A 4N0BA 4OMYA 2EV5A 4U88A 5DEQA 1TQMA 3HOTA 5DD4A 1FSEA 1USSA 3GFIA 3WGIA 2JPBA 3WTYC 2B0LA 1S3JA 2STWA 4L9VA 5CVJA 5J8CA 1HW5A 2ACJA 4UV9A 3ZMSA 1QZZA 3ZMDA 3K9TA 4Y15A 1SFXA 1BI3A 1FNNA 1C0WA 4IXAA 4KIFA 1HSJA 4HQEA 5FFXA 4ZZDA 3KFWX 2XAGA 2CYYA 5D8LB 1F9NA 3N97A 1SMTA 1ZLKA 3WE2A 4XLPF 4R1HA 4A5MA 3JAMZ 4MTDA 1WQ2A 2P5KA 3RJPA 2ZXJA 2KJBA 1ODDA 4KUMA 2DPUA 2STTA 3SQNA 1SD4A 5CVVA 4N9HA 4B09A 3VEPA 3NRVA 5H20A 2CSOA 3M8FA 1QZYA 1KGSA 5D8KB 5E18F 2X4HA 2PFBA 2DQRA 1LEAA 4G7ZF 4IHSA 3V4GA 5HDKA 2HQRA 4PCQA 2O03A 4QWQA 2FSWA 3BOQA 3E6CC 1E2XA 2OZ6A 1FBUA 2RC4A 3F8NA 4OIQF 1J0RA 1LDDA 4LJZF 2ESHA 1O3TA 3GF2A 2Q8KA 2PI0A 3ZN1A 5H6QA 4OOIA 3EYYA 4I02A 4IRIA 3RTRA 3Q9SA 2P4WA 3J81Z 2QWWA 2PG4A 3KP7A 1RIOH 3LA3A 1U6GA 1T6SA 5ERIA 5DCMA 5L3CA 2ZJ2A 1BI2A 6PAXA 4ENNA 4HYEA 1B6AA 4HQMA 4M6YA 5K1YA 5FLXZ 2XAFA 3I53A 1R5HA 4P5OA 1UFMA 4PGGA 2Z3YA 2D1HA 2OQGA 3GFLA 1QPMA 3K1NA 5AIPA 1LDJA 1H9GA 1U5TB 4R79A 4HA8A 1YW9A 3LWFA 3KEOA 1IZ1A 2VBXA 1O3QA 3LA2A 4JK1X 3IC7A 1R00A 2H6BA 1PP8F 1L3LA 1RUNA 5D5XB 2E7WA 4IVNA 2A68F 1H9TA 2DBBA 5FFZA 1IN4A 3KEQA 3MQ0A 3K0LA 2VONA 3HRTA 4LB5A 3QAHA 3V7RA 4ESBA 1W7PA 2KIMA 1Z7UA 1J75A 4AVPA 2PLYA 3F6OA 5LEJA 3F23A 4RGUA 3O2PE 4A12A 1PDNC 3TO7A 2ESNA 4KMFA 3FXUA 4Z2YA 1ZGJA 2F5FA 1UB9A 2PQ8A 1IN6A 2IW5A 2EK5A 1I1GA 2IT0A 3WTTC 2HFHA 4LB6B 2DI3A 1IXCA 2JZYA 1S29A 1W7PB 3DXJF 4EJTA 2XAHA 1K79A 2FU4A 3KZYA 4YIFA 3F72A 3QP5A 1HW2A 4RB2C 4M9SA 1R1VA 4I09A 2L54A 3TGNA 1W4MA 2HWVA 2ISYA 1XDSA 5LRRA 2FOKA 3MZHA 1ULYA 4LFUA 4HF2A 3PQJA 3FMRA 1UHWA 2M1BA 2EV0A 4NQWA 2LF7A 1YG2A 1MJ9A 1YIOA 1YW8A 4BH9A 3FM3A 4HDVA 2NRAC 3I64A 5A2QK 1R23A 3V8KA 3K1MA 1RI7A 1K78B 1MKMA 2LDUA 2HKXA 2VE8A 5FO5A 3NEUA 5JI6A 4L18B 1JHHA 3GZ6A 4OIPF 5DYMA 4HV6A 2UWMA 4WXDA 1SD6A 2LKPA 1USTA 1EH7A 4O6JA 4CDGA 3E6DA 3I4PA 1G3TA 2D2WA 2PMUA 4KT5C 2O0YA 1OYIA 1KU9A 3BZ6A 5ICCA 4LK0F 1H0MA 1SD7A 4G9YA 3U1DA 4IRHA 4EJOA 1HXDA 4DQ2A 1DPUA 2IRFG 2W25A 4Q5SF 1S7AA 3CJNA 4WXHA 5ILUA 1STZA 2HGCA 5E1WA 5HLIA 5K5OA 1DPRA 5E8IA 3TOAA 3E97A 1I1SA 4EJWA 3AAFA 1P4WA 2OQRA 1IN8A 2FNAA 4LMYA 3KCCA 1YTYA 2Z9OA 1R1TA 5KVRA 1MDMA 1LJ9A 5ICFA 3RIRA 3QRFF 5HOOA 3R6SA 4U7DA 3O3KA 2GWRA 3M9AA 1YS7A 3KP6A 2P6SA 1Z91A 3ZMZA 2A6EF 1SFUA 3FMSA 1LEBA 1IUYA 3J7AO 3V7CA 5E17F 5FB2A 4HF0A 2A5YB 4ETSA 1FYKA 4L0ZB 2WC2A 5CYVA 1XCVA 1ZRDA 4XRFA 3QPHA 2QQAA 2YPRA 1FLIA 3VB2A 4RGXA 5JVTA 2UZKA 1G6NA 1IXSB 4MNUA 1FY7A 2VBWA 4UVAA 3GLXA 3DF8A 1BIBA 1IN5A 2ADUA 3M1EA 4AIKA 1U5TC 4BHPA 1IXRC 4EJUA 4GO1A 2ZMEB 2UXXA 1TNTA 3RPUA 1DDNA 2QBYA 2NS0A 3ZMUA 3LQQA 5BPDA 3H3UA 3JSPA 2DK8A 1ZLJA 3V8JA 4HAMA 3RKXA 2HS5A 2XRNA 5ED4A 2NNNA 3H3ZA 2DAOA 4M9ZA 1OR7A 3J80K 4EMSA 3WTUC 3T5XA 3JAMK 1D8KA 4HX8A 3JW4A 3HHHA 4L5IA 4CZZA 5D6FA 4A0XA 1XB4A 2DU9A 3LAJA 4O5VA 1R36A 5F64A 1P6RA 4A0YA 3OV8A 1I27A 1LVAA 5FLXK 2D1VA 3FWEA 3KZZA 3V7SA 3B73A 2DO7A 4YG2F 1D8JA 4D0PA 3S2WA 3LAPA 4GGGA 1CF7A 1B1BA 3FM5A 1Z6RA 1BI0A 2HOEA 2LF8A 4Q48A 2Q0OA 2VC0A 4CGZA 4ZYGA 1HKTA 5LGUA 2CFXA 2EWNA 1U2WA 5IT3A 4KNYA 4LK1F 2GQQA 2QLZA 2VBYA 2G7UA 3ML6A 3LQRA 2MH2A 4FX0A 3RKWA 2XKOA 2P5LC 2A07F 1I5ZA 1O3SA 1WI9A 5AONA 3KP2A 4HV5A 2KJCA 3BJAA 4P9UA 3KETA 1FP2A 4YFXF 3GWZA 2YX4A 3N4MA 3T0YA 4A2UA 4AIJA 2Q2EA 1WRJA 2VOOA 3R0AA 3IWZA 1F1ZA 2RQPA 3DPTA 5E1XA 2FXAA 3QU6A 4LLLA 2RGVA 5LRSA 3WTVC 4MEYF 2R7FA 1X3UA 3GX4X 4G7OF 1XMKA 3CTAA 2ZMEA 4U0WA 1SAXA 1Z1DA 2D45A 2BYVE 2WTEA 2QBYB 3GFJA 4KIBA 1YQAA 4XSXF 4QLCU 3WGHA 3IRRA 1K78A 5EEGA 3GW2A 5D5WB 5LEKA 3LSTA 2M87A 2PMHA 4A0ZA 3DP7A 3E3VA 3F6VA 4Q4ZF 2WWYA 3W6KB 1D5VA 4KYWA 3HYIA 3WGGA 3E5QA 3PQKA 3I0TA 2CG4A 2RDPA 3TDUC 3IKTA 2W57A 1S7OA 4R8HA 2GA1A 4CO8A 3RYPA 4HX4A 4KICA 1G4DA 1OKRA 3HHGA 2GXGA 2A61A 1ZYRF 3RPQA 1ZH5A 1JE8A 2R7DA 2YU3A 4GYIA 4EGZA 3P7NA 4L5JA 3R0JA 5ILSA 3VFZA 4BXUA 1FSHA 5A2QZ 1TLHB 1ZAOA 2BGCA 5JFRA 4OMZA 4WX9A 4P96A 1QNTA 4KN4X 3MCZA 4HW0A 5HVQC 2A69F 1BIAA 2RKHA 2PN6A 4I2OA 4AIHA 2ZBKA 3T8TA 2FMYA 2KKOA 2MC3A 2QZ8A 2QQBA 1Z9CA 2EB7A 1S6LA 2KIFA 3ZN0A 2ZFWA 1U3EM 3SXYA 1FPQA 1ZG1A 3WODF 1T38A 3M8EA 3GEZA 1UHMA 2YSRA 4HF1A 2L01A 3F22A 5FD6A 1B9NA 3IWFA 4XBFA 4RB1A 3I58A 4RGRA 1Z05A 5LHHA 3ZP5A 3RKYA 3MFKA 3IHUA 4G7HF 1QBJA 4ZYHA 2BV6A 5L3FA 3WTZA 1TW3A 4DNCA 3CDHA 1RUOA 4OIOF 2EA4A 2QM3A 4EM0B 2UXNA 5ICEA 3QP6A 3K2ZA 5K5RA 1TQPA 3BY6A 5CLSA 2DT5A 3ULQB 4F7ZA 1DP7P 3JTHA 1EV7A 2XAQA 4K2EA 2Z5UA 3K1PA 1XSXA 4N9IA 1FX7A 2V1DA 1HKSA 3GVAA 4RB3C 1J2XA 3DFGA 1AOYA 3KLOA 2O8XA 5DCFA 1D3YA 3U9GA 1ZRFA 2XV4S 3CO7C 2M30A 4I0AA 3WTSC 2W24A 2BEOA 1HSTA 4LG0B 1G3SA 4L9TA 4MEXF 5EEHA 1HW1A 3CUQA 3MAJA 3L9FA 2RV8A 4UXNA 1QQIA 3WG9A 3HTSB 4XLNF 2QQ9A 3HRSA 2Y48A 1XGOA 2VC1A 4ENKA 1YO5C 3HIFA 3WU1B 4UNOA 3BP8A 5BMZA 5D4SA 2V9VA 1T2KA 3HUGA 3T8RA 3FXQA 3J81K 4O3MA 1TNSA 3LFKA 5L3BA 3HSFA 2EJRA 2HR3A 4ZYEA 2L02A 4ENMA 5LHIA 2K02A 3Q9VA 1E17A 2EA2A 4U0VA 2HDCA 3L7WA 2WV0A 4RB0A 1KU2A 1MJBA 2ZKZA 4FT8A 5DD8A 5HLHA 4AD9A 1VTNC 3CUQC 2AS5F 4P9FA 5FD5A 1GHCA 3F8FA 2P5VA 4YIIA 1GXPA 5HS8A 2FA5A 1FOKA 4ENJA 1OMIA 4KA4A 2K4JA 2IJLA 4PGHA 3DV8A 3R4KA 3I59B 3ZMVA 4GYGA 1K6OA 3NQOA 4M74A 5LLQA 3RDIA 4XSZF 3MEXA 1P4XA 2FBIA 1J7KA 3FX3A 3PFIA 5HDGA 5DUIA 5FGMA 3P9CA 1ONVA 4EM1A 3R61A 2P7VB 2XVCA 2XHKA 1OPCA 3TQNA 4OINF 3ZMTA 2VBZA 1U8RA 2XGXA 3VOEA 3IKVA 2MBFA 3F21A 3HSRA 5LGNA 2HTJA 2R3SA 5D4RA 2E7XA 3IRQA 1T0FA 5CVUA 1WWXA 3ELKA 4AWXB 1YFHA 2HEOA 3FHZA 1MD0A 5D5VB 3CUOA 1GVJA 4L9JA 2CO5A 3H92A 2ZCWA 1NHAA 1EH8A 3I71A 1MGTA 1IRFA 2AXLA 1LDKB 4I98B 1O7FA 5CJ9A 2F5DA 3I54A 2GA2A 4ASNA 1BJAA 4IHTA 3V8LA 4M72A 1WSUA 1KU7A 2J5OA 4HOBA 4FHTA 3BDDA 1IN7A 1TBXA 2K27A 1IF1A 2JTVA 1Q1HA 2O6GE 2HQNA 1XGSA 1R22A 3DQVC 4MQ9F 5ILVA 5BS6A 5JR3A 2ELHA 2OAZA 2W84A 2E1CA 3U2RA 3ABUA 1RNLA 3ABTA 1F5TA 3GFMA 1ZRCA 4LGWA 1TQIA 3D0SA 2FNPA 2XASA 2DQLA 3BJ6A 4S05A 2P6TA 2YX7A 1J5YA 2HKOA 4E70A 1HBXG 3HSEA 2PBIA 3O6BB 3L00A 2F5CA 3W6JB 1FYMA 2P8TA 3LA7A 3FMQA 4I01A 4RAZA 1O7LA 2ZO4A 4UVCA 3EDPA 5TJJA 1ZGAA 1MJAA 1PP7U 4I7HA 5ICGA 1FWZA 5KK1A 4WK8F 3MZYA 1XSVA 3E6BA 1BI1A 1FZPB 3P9IA 3F8BA 4A5NA 1B4AA 1QO0D 1YW7A 2OD5A 4LLNA 4EV0A 2RN7A 3FF5A 2Y75A 3IL2A 5L3GA 2CW0F 2YR2A 3WTXC 2K86A 2V79A 1KA8A 1R5GA 1R1UA 5L3EA 3JTGA 3HTUA 4RGSA 4CICA 2VT3A 1ZHFA 2EFPA 1BC7C 2NAZA 1V3FA 1KQ8A 4OU0A 1LNWA 5DDGA 4L9NA 2DFIA 2HZTA 3F3XA 2IA0A 3KE2A 2CGPA 1LQ1A 1P4AA 2E1NA 3COAC 5BOXA 3T1BA 5HS9A 1V4RA 3GXOA 3L09A 4YFNF 3ZQ7A 1YLFA 3CUQB 1AWCA 1YYVA 3B02A 3VODA 2V1UA 4M73A 1MZBA 4EGYA 1BC8C 1OYWA 2XAJA 2RVCA 2CQKA 2XROA 3P9KA 3TO9A 3EQLF 4G8XA 2CWEA 3EUHA 4JBAA 4U7BA 5BPIA 5D6EA 4OIRF 3SHFA 4KIGA 2VT2A 2L3DA 4PZJA 2PJPA 3EETA 4MTEA 5HDNA 2LNBA 4UUVA 1YS6A 4ON0A 5BQTA 2TDXA 1ZG3A 1MDMB 3FZVA 4MQVA 2FBKA 5J8FA 2Z99A 3ZPLA 3HOSA 3E6MA 3C3WA 1FP1D 1B59A 1B9MA 2OU2A 4I0BA 3HRMA 3OOPA 3E5XA 1A04A 2F5EA 3QPTA 1BBYA 2J5PA 5LBQA 2MH9A 4EJVA 5TRDA 1UCRA 1JHFA 1W5TA 5E1ZB 4IF4A 5IT9K 2W85A 4LLGF 5HS7A 1SMYF 5CVRA 3DEUA 3TKYA 2K7LA 2DK5A 4LG0A 2ETHA 3RYRA 2MLKA 3F8CA 1XMAA 3MWMA 4Y13A 1T39A 2VN2A 1U5TA 1LB2A 2VXZA 3EYIA 4G6QA 4HBLA 4UVBA 1P2FA 3SFZA 3ERED 1JGSA 4BHCA 4CHUA 4GCVA 3ECOA 4IPAA 4A6EA 1KU3A 4MGRA 4CYDA 1XD7A 4WWCA 1FYLA 2XUBA 2H09A 1R7JA 1ZN2A 4MHGA 2L4MA 1IRGA 3ROUA 2BE5F 2EFWA 3BPVA 2GAUA 1HQCA 2KIUA 1XSDA 4BNCA 5L3DA 1F4KA 5LGTA 2GXBA 1BM9A 3ISPA 4YFKF 5J6XA 3BROA 3TDZC 3G73A 4KN7X 5IT9Z 2FE3A 2G9WA 5E8GA 2IPQX 1ZREA 2FQ3A 2VOPA 2K4BA 4ESFA 1ZG5A 1REPC 5LHGA 4HZFA 2F2EA 2PEXA 4ESJA 3JSOA 1O57A 3I59A 4ZYDA 1L0OC 4BAYA 2H94A 3KP5A 5JHUA 4NB5A 1CF7B 5DUKA 3ECHA 2IVMA 1WKMA 3TOBA 4WF2A 5D5UB 4G6DA 2IA2A 2ISZA 3BJOA 4H0EA 2OZUA 4CXFA 2HYGD 4GXOA 1K7AA 4WXCA 4BHBA 1SD5A 4L0YB 3I5UA 5CVIA 1FT9A 3FXRA 3DKWA 3CO6C 2HTSA 2M5WA 2VE9A 3CLOA 1U78A 1S8NA 1ZARA 1G3YA 1J59A 2FEZA 1HKQA 4IJAA 5F1RA 1GXQA 4U0YA 3DPLC 4ZH4F 1KQ0A 4WCGA 1SFEA 1RZ4A 2EFOA 3SZPA 3QOPA 4G94A 3G3ZA 3C1DA 1IAWA 4M6XA 4JQFA 2RNJA 3GZ5A 3GO5A 4NHJA 2JSCA 3K69A 3WU0A 2EFQA 1FC3A 1TW2A 2C6YA 1J9IA 1TTYA 2L4AA 3J80Z 4KDPA 3TO6A 5K5QA 2KRFA 3HRUA 4KFCA 3F8MA 2NYXA 1QGPA 3C18A 4BYYA 2A3SA 4EQQA 1OYYA 1PUEE 2XIGA 2EFNA 2MA3A 2FRHA 2V6CA 2DPDA 1KQ9A 1IW7F
chains in the Genus database with same CATH superfamily
2BBYA 1MBKA 2H27A 2YRMA 2A6HF 3M99B 1BN5A 3RI4A 4WFTA 2VB6A 4CZCA 2EV6A 2XGEA 2H6CA 2FF4A 2Y0MA 1YZ9A 2V1XA 4HX7A 1XGNA 2QYOA 2JOBA 4F9CB 3H0GJ 4D7MA 4BBYA 1KYZA 2KQRA 3REOA 4PDKA 1W7PD 2DSYA 3VYTB 5JHFA 1W0TA 1T98A 3JRFA 1X1BA 1P92A 2M8EA 2LSOA 1R58A 3RKQA 2MD5A 2O61A 2EWLA 1FMWA 2K9LA 4ZZLA 1VF9A 2R93J 1EH6A 3ZXSA 1XN7A 2HC5A 1BOAA 4M71A 5AIQA 2I13A 3U1KA 3OMLA 3R60A 3H35A 2I8DA 1GQEA 1MMGA 3PUFA 1QRYA 2COMA 1O3RA 2NVXJ 5HLGA 2Y30A 5FKNA 2X0LA 5GTHC 5DV5A 4D9JA 4IRGA 2CT1A 2FBHA 2GZWA 3M7GA 2QSGX 5IYDJ 1FBSA 2MDRA 2NNYA 2JPCA 2CV1A 1AHDP 4LU9A 2R7SA 2ZSIB 2OBPA 2M1SA 1V5FA 2DOFA 1G3WA 2EORA 4F54A 3EQ1A 3SFIA 2R7QA 3SZTA 2YS9A 3KP4A 1T95A 4DBQA 1XPXA 2DW4A 1Y1WJ 4EM2A 3QU3A 3GYHX 2X6WA 4HLYA 4S04A 2K9NA 2Y69H 2XF5A 2VLAA 1XCBA 4HEA2 2DLLA 5F6FA 4C2TA 1XGMA 3CJQB 2JT1A 2E5ZA 2HZDA 4Q47A 3S1MJ 1S72I 5TSEA 1YX5A 2ID6A 2LUPB 3CC4I 4NC8A 1K6YA 1WPKA 4BCAA 2L2OA 2GM4A 1A35A 1Z21A 4TV7A 3E5UA 3TP3A 3JREA 2H1LA 1W5SA 1XDUA 2L2NA 2GLOA 2QVOA 2WCC3 2IA1A 5FKOA 1DUXC 2EPZA 1D0YA 1WVRA 1ON1A 1YOVB 3WE3A 3GTMJ 1A6QA 1BW6A 2QUFA 1X4OA 5EJCA 4FE7A 4HLXA 2FGGA 2LJUA 1KYWA 2XPUA 3BPXA 3D5LA 3FKJA 2ME6A 4ZC3A 1MSFC 2EMGA 3KLNA 3TP0A 1VQ8I 2QENA 4H4KC 4P55A 4RAGA 4GDFA 3OYMA 2G7HA 3PNYA 2ZNZA 2XKPA 4FX4A 3LSKA 3PIPF 2MLGA 4UHTA 1E3HA 1FIAA 2HXOA 2Z33A 4KMUX 1KZHA 3KP3A 3BWGA 2FMLA 3WTWC 2BZTA 1YUIA 1Y0UA 1ETXA 4J00A 2RPCA 3DLAA 2VODA 3ABKH 1X6HA 4M9XA 2OA4A 1ZR9A 4LD5A 2L0KA 4S0HB 3JRGA 1RC9A 1NH3A 3S1QJ 1J26A 4DV6E 4RAYA 1OR7C 3GCMA 4HDUA 2JRTA 3A0HC 1PKPA 1Z6TA 4HRIA 2FUG2 4IQJA 5GPCA 3IWDA 2IP2A 2E5LE 2D5VA 4Y17A 4F3QA 1X3WB 4MLQA 1X47A 1G8XA 2EL6A 3HC7A 3ZGKA 4A6DA 1VI0A 2L7FP 3S3MA 3Q5FA 5E20A 5M3FJ 1FBQA 2LLKA 2XB5A 5DCMB 3C7JA 4I76A 5H6RA 3T1YE 3AL0C 2ZNYA 1L4SA 2Y9ZA 3GUDA 5F08A 5KL2A 1NG7A 3HJEA 2P7CB 1VQ6I 4DV2E 2YRHA 3G1OA 4UV8A 4M2ZA 2ZXHA 5HNHA 4EVIA 2LE2A 4KZSA 2V26A 5FJ8J 2GIVA 1ZQ3P 4BQAA 2ELYA 2DTRA 2HYFA 1ON2A 3CCSI 5F0FA 3K7AJ 3OL4A 2M45A 4XN3A 2R7OA 3BR5A 4B8XA 1CGPA 2EPLX 2L8TA 1I6XA 3IAM2 2O3FA 1OCTC 1JXSA 3L2CA 4RS8A 4N4RB 3W3CA 3K6GA 4WYQB 1QHGA 4N0BA 1K61A 2ECBA 2DT6A 3BTJA 4OMYA 2K7IA 2EV5A 4U88A 5DEQA 3MKYB 1TQMA 4L5NC 3K4LA 3HOTA 2FJ1A 2YUSA 5DD4A 1VQ9I 1FSEA 1NTCA 1USSA 2PJRA 3S32A 2ZJRF 1PDAA 3OSGA 2CPNA 2UU9E 2EM6A 3GFIA 3WGIA 1X1DA 2JPBA 4OX9E 3WTYC 3E0JB 2DODA 2B0LA 1S3JA 2STWA 4L9VA 3CMYA 4B3TE 5CVJA 5J8CA 1HW5A 2ACJA 4UV9A 4I99C 3ZMSA 2IS1A 1QZZA 3ZMDA 2R1FA 3K9TA 1CQTA 4Y15A 2DDBA 2NUFA 2JY9A 1SFXA 1BI3A 1FNNA 1D1AA 2GHFA 1C0WA 2Q2EB 2EQ0A 4IXAA 3A2KA 2LCEA 3MVPA 4KIFA 4QPQA 4CCJA 1HSJA 4HQEA 2V1NA 5FFXA 4ZZDA 3KFWX 2DOEA 2XAGA 1XMQE 2CYYA 2A5WA 2KDOA 4XRSG 1A1GA 1YE9A 2RSMA 5D8LB 3J80C 1F9NA 1NK3P 3DWLE 3N97A 1N32E 2LH9A 3VYUB 3LSRA 1DP3A 5DS9A 1SAUA 1SMTA 1ZLKA 3CZ6A 2DYSH 3WE2A 4CCMA 5GP9A 4Y7NJ 5HLTA 5J40A 4XLPF 2N8GA 4R1HA 4A5MA 2DYRH 3JAMZ 2M9HA 4MTDA 2MG4A 2EPCA 1FIPA 1WQ2A 2R76A 2P5KA 3RJPA 2X6OA 1FTTA 1XTAA 4BUPA 2ZXJA 4DYQA 2KJBA 4OOGC 2Y9YA 1MNDA 1ODDA 4KUMA 2DPUA 2N3HA 1X3ZB 1UILA 4LTYA 3IP4B 2STTA 3SQNA 1AH5A 4OWRB 1SD4A 4D1QA 1U8BA 2HHHE 5FLMJ 2LBFA 2E60A 4LIUA 5CVVA 4CYCB 1K4TA 3BC8A 4N9HA 3H9QA 3PIOF 2R92J 4BJ6C 2B3TB 2EOHA 1IBME 4B09A 3VEPA 2MC4A 2EMHA 5CQGA 3NRVA 3UKGA 5H20A 1XNRE 1ZBTA 1V55H 2CSOA 1M1EB 3M8FA 1QZYA 3V42A 5K7FA 1KGSA 2HU9A 1YJ9I 5D8KB 1A1LA 5E18F 1TP4A 4O43A 2X4HA 1TWGJ 2DQRA 2PFBA 2RS7A 1LEAA 5EZGA 4G7ZF 2F48A 3IH4A 3SYTA 4IHSA 1WCMJ 3V4GA 2QQ8A 5HDKA 4XRMA 4DV1E 2IAIA 2HQRA 4PCQA 2O03A 4QWQA 2FSWA 3BOQA 3E6CC 2CS3A 2EOQA 5AC5A 1VQ4I 1E2XA 2OZ6A 1FBUA 4X1EA 4BE0A 2JA2A 2RC4A 4LIVA 2D9HA 3H1CA 3F8NA 2RQQA 1J0RA 1LDDA 4OIQF 2WY7Q 2L9NA 1JI8A 4PJMA 3GTKJ 4LJZF 2ESHA 2EPRA 1O3TA 2F4VE 3GF2A 1F2IG 2Q8KA 3J7AG 4MO7A 1MW7A 2LY9A 2PX9A 3ZR8X 2PI0A 4LF7E 2EM5A 3CQZJ 4XKWA 2EMXA 3BR1A 1Z1BA 3FDYA 4ZYAA 3ZN1A 5H6QA 4OOIA 3EYYA 3BQYA 4I02A 3BT9A 3JRIA 1MMSA 1FTZA 4IHXA 4IHWA 4IRIA 3RTRA 3Q9SA 2XDVA 4DZJA 4R2QA 2P4WA 3DU6A 4QSHA 3DCFA 2QWWA 3J81Z 1VNDA 4BKXA 3J7ZI 3HGYA 2PG4A 2M7BA 3KP7A 3J7AY 1RIOH 3LA3A 2BBGA 1U6GA 1T6SA 5ERIA 5DCMA 5IP9J 2EOMA 5L3CA 4A3CJ 2YTQA 2ZJ2A 1BI2A 6PAXA 4MLOA 3PSFA 4ENNA 4HYEA 1B6AA 4HQMA 4M6YA 2L2KB 1R6RA 2BW3B 4X9JA 4TUGA 4XR6A 1JUPA 3LFUA 5K1YA 5FLXZ 2XAFA 3VHTB 3I53A 5GADJ 5C44J 1IC8A 2V8QB 3HPZA 3QOEA 3HEFA 1R5HA 2VJ4A 4P5OA 1UFMA 4PGGA 2KIQA 2ZSHB 2JYAA 2Z3YA 1FOWA 2KLOA 4XLHA 2D1HA 2OQGA 1JGGA 4IKFA 2KT0A 3GFLA 1QPMA 3K1NA 3RZOJ 5AIPA 1LDJA 1JUSA 2OTLI 5A6JA 1H9GA 2QKLB 3HXLA 1U5TB 4BEHB 3D5SC 4HA8A 4R79A 1YW9A 3LWFA 2Y31A 3KEOA 4KITB 1IZ1A 2HXIA 4DR3E 2VBXA 4KISA 4JI2E 1BOBA 4XNFA 1HOMA 2CJJA 3BG7A 3LA2A 1O3QA 4JK1X 4LF8E 3IC7A 4CCNA 2E1MC 2JPAA 1R00A 2FX0A 4BU2A 2YTOA 2H6BA 3J7Yp 2DTZA 1PP8F 1L3LA 3ECRA 2EQRA 1RUNA 5D5XB 3IWCA 2E7WA 2E1OA 1RRJA 4IVNA 2A68F 1W5CC 3VSKA 1H9TA 2HI3A 5KL4A 2DBBA 5FFZA 1E3OC 2ELZA 2JN6A 1T8IA 2DMYA 2UXDE 1IN4A 3F0CA 3KEQA 1VQNI 4FETA 3K4NA 3K0LA 3MQ0A 2VONA 1BBOA 3HRTA 2CRGA 4LB5A 3QQAA 2NA2A 4ZTJA 5FLXC 2VPRA 3QAHA 3V7RA 3ZOBA 1E3PA 2ELJA 3BZKA 1YIJI 1O4XA 2EM4A 2NXNB 5F0CA 2YT4A 3KPHA 4PFOA 4ESBA 1W7PA 2X9DA 2ZFUA 2KIMA 1RMDA 3A1YA 1WH5A 3CMAI 2Q8UA 1Z7UA 1PJTA 1X3CA 2F8BA 2L92A 1J75A 4AVPA 3DPUA 2UUZA 4DW6A 2PLYA 3F6OA 1A31A 5LEJA 3F23A 2I10A 2EN7A 4RGUA 2JVAA 2M2EA 4B3ME 2ZJQF 2EOOA 3O2PE 2L5QA 1Z67A 2V87A 3DLLF 1LPQA 3CD6I 2TCTA 3ZQCA 4A12A 2B9DA 3QPSA 1PDNC 4HG2A 3TO7A 2ESNA 3QODA 4KMFA 3FXUA 4Z2YA 4V19K 3RMPA 2VKEA 2L33A 5DM6F 1ZGJA 1UG2A 3Q3SA 2JA7J 2EMZA 3OOUA 2F5FA 1RESA 2OC6A 1UB9A 2PQ8A 2L2MA 1IN6A 2IW5A 1JKRC 5C4JJ 4B3AA 2EK5A 3ZQIA 1I1GA 2IT0A 3WTTC 1SVOA 2HFHA 3CCEI 4LB6B 2NS8A 4M3FA 2DI3A 1IXCA 3D1NI 2JZYA 1S29A 1W7PB 3DXJF 4EJTA 2XAHA 1K79A 4C2MJ 2FU4A 2UXCE 3KZYA 3GZNB 3MMYB 4YIFA 3F72A 3QP5A 4LOCA 4A3GJ 4JI1E 1HW2A 5JLXA 2W7NA 2VKHA 4PFPA 4RB2C 4B3SE 1X6FA 3HM5A 4M9SA 1R1VA 2OPTA 3TW6A 4LF5E 4E7JA 4I09A 2L54A 3TGNA 1I39A 1W4MA 2M7AA 2EMLA 4DV7E 2HWVA 2V89A 2ISYA 1XDSA 2W82A 4R03A 2CFOA 4IHYA 3BG3A 3MKWB 5LRRA 2YTFA 2FOKA 2HQAA 1B72B 3SEZA 3MZHA 3EPHA 1ULYA 2EINH 4LFUA 2UXBE 2LT7A 4HF2A 1OFCX 3FXMA 3PQJA 3FMRA 4HSRA 2KMUA 3WG7H 1UHWA 3CF5F 2DMQA 1FMVA 5C3EJ 2M4IA 1HDPA 2ODRC 2M1BA 2O8KA 2EV0A 4NQWA 4E4HA 2K4VA 2LF7A 1ENHA 1YG2A 5AE1A 1MJ9A 1TWHJ 1YIOA 1YW8A 4ABZA 4BH9A 1SANA 3FM3A 4HDVA 2NRAC 1O0WA 5J3LA 3G6EI 2CV2A 2LRSA 3IWBA 3I64A 2LP0A 1HDDC 4XQFA 1WJ5A 1ZTRA 2M9AA 3HPSA 1P7JA 2M0MA 4B43A 3DTKA 5A2QK 1R23A 4O24A 3JAMC 4F9BB 3V8KA 4BACA 2YU9J 2UUBE 3K1MA 1RI7A 1K78B 1MKMA 2QCOA 2IS2A 2WAFA 1HNWE 2LDUA 3L2UA 3OYEA 4AYBN 2WBUA 2HKXA 2OUMA 1SEUA 1LE8B 2VE8A 1J09A 5E3LA 5FO5A 3NEUA 5JI6A 2JK3A 4FTHA 2EOJA 4L18B 4M0VA 1JHHA 1OCPA 2BVMA 3GZ6A 2LV2A 4OIPF 3LMMA 5DYMA 1N3GA 3JRDA 1BBGA 4G6TB 4E7LA 4HV6A 3KYLA 2UWMA 4DR5E 4LG3A 4WXDA 1N77A 1SD6A 2LKPA 1USTA 4J19A 1QPIA 1EH7A 3T1HE 4O6JA 1FOYA 3VYSB 3E6DA 4AVZA 4BQOA 2E19A 4CDGA 3I4PA 2JRMA 1TL8A 4E7IA 1G3TA 2D2WA 4PJJA 3ZOQB 5GAEJ 1TC3C 2PMUA 4KT5C 3OYFA 3CCUI 2LYCA 2O0YA 2EH3A 1OYIA 5LMNE 1KU9A 1MBEA 3BZ6A 4HNVA 5ICCA 3S8PA 1S9HA 4LK0F 4AIDA 1WJDA 3NARA 1H0MA 1YJNI 5KL3A 1IUFA 1SD7A 4OAZA 4G9YA 1EA3A 3U1DA 1D0XA 3H36A 4IRHA 3EPJA 4EJOA 2EZLA 2KFDA 1HXDA 2LD5A 4DQ2A 4BBSJ 4LF9E 3DF6A 1DPUA 1MMAA 3H0DA 3OYIA 4E7ZA 1H8AC 2JXPA 2IRFG 4UY8I 1SC7A 1LVKA 2W25A 5E3NA 4E6KG 1S7AA 3CJNA 4Q5SF 2EPNA 5A6AA 4WXHA 3K4BA 2WBTA 5ILUA 1STZA 2HGCA 2JA8J 5E1WA 5HLIA 5K5OA 2CW8A 1APLC 2EM7A 5A6KA 4KHPE 1DPRA 5E8IA 3DEWA 3TOAA 2WV1A 3E97A 3OWTA 1I1SA 4EJWA 3AAFA 1P4WA 2OQRA 2E36A 1IN8A 4Y52J 2FNAA 4LMYA 3PNTA 2EZ6A 3KCCA 1V5EA 1T4OA 1OLTA 1YTYA 3QYEA 5HNFA 2Z9OA 3W6VA 1R1TA 4F6NA 5ADZA 5KVRA 1MDMA 1LJ9A 4M3GA 5ICFA 3RIRA 2B63J 4B3RE 3HTXA 4YRVA 3QRFF 2B9SA 1NEIA 2EPOA 5HOOA 3R6SA 3FXJA 3OYGA 3DTIA 1FKAE 5CKTA 4U7DA 2B7TA 1WHUA 4CYCA 1MBHA 3O3KA 5A6BD 2GWRA 2CW7A 1DGRM 1ZR4A 3M9AA 4GRIA 2MKDA 3C2HA 1YS7A 3TEDA 3KP6A 2P6SA 1Z91A 3ZMZA 2A6EF 4F91B 2MDGA 3ADIA 1SFUA 1Y8QB 2ELKA 3FMSA 5CQEA 4PK4A 3TL4X 4NDLA 1LEBA 1IUYA 3J7AO 3MHSC 2BVLA 2ID3A 2UUAE 3V7CA 4ZDOA 1TWAJ 1JTXA 1WJCA 4QPOA 5E17F 5KHDA 5FB2A 4Q28A 1X2MA 3N05A 4HF0A 4RA2A 3K10A 2A5YB 4ETSA 1FYKA 3CP8A 4L0ZB 3JTZA 2WC2A 4C3HJ 5CYVA 2DOAA 4JYAE 2F4MB 3VWBA 1TF6A 4HEIA 1BA5A 4G12A 1XCVA 2XC7A 1ZRDA 4XRFA 3UNGC 3L2QA 5KL7A 1V54H 3QPHA 2QQAA 2HDDA 3LOCA 4AQYE 2KRHA 2YPRA 2H8WA 3FXLA 4UB6C 1JJ6C 1FLIA 3HDDA 3VB2A 2XF6A 2EPXA 4RGXA 2W4SA 3FBNB 5JVTA 2LMZA 2UZKA 2XF7A 1G6NA 1IXSB 4MNUA 1FY7A 2VBWA 4UVAA 2EILH 2NABA 3GLXA 2E5NA 5DTDA 1WFXA 2K85A 3DF8A 2WY8Q 1BIBA 4MLVA 4BE1A 1IN5A 2ADUA 3CLQA 3S1RJ 1TT0A 3M1EA 4AIKA 1Y39A 1KJKA 2M7QA 1U5TC 4BHPA 1IXRC 4EJUA 4GO1A 2ZMEB 1I50J 2UXXA 4FASD 2LR8A 3FK7A 1TNTA 3NAUA 3RPUA 1DDNA 3NWSA 2NS0A 3AG1H 3SDGA 4RDUA 2QBYA 2Z2SB 3GTQJ 2EM8A 4IEJA 1WJAA 2DA6A 5M5YJ 4DR7E 4XONA 2MW8A 3ZMUA 3LQQA 4AUXA 1LE8A 5BPDA 3H3UA 3ABMH 3IH3A 4IOAF 3E1SA 1ACIA 3JSPA 2DK8A 4L8NA 1ZLJA 2L7MP 4JX6A 2YU8A 2O5RA 2R4GA 1DQUA 1YJWI 2M8GX 3WHBA 4M9VC 1AKHA 3V8JA 2MFZA 4F55A 3HOXJ 3PM1A 4HAMA 3RKXA 2HS5A 2XRNA 3QG5C 5ED4A 4BGDA 4KJZA 2NNNA 3H3ZA 1Y1VJ 3IH2A 2DAOA 4GKJE 4M9ZA 1OR7A 2G0EA 3J80K 4EMSA 1VFCA 3EPKA 3WTUC 3L2RA 1X6EA 3T5XA 1N78A 3F6HA 4C30A 2HDWA 1QVTA 2LY2A 1D8KA 4HX8A 3JAMK 3S17J 5A2QC 1STUA 2LBFB 1UZCA 3JW4A 4I8OA 4W97A 3HHHA 5T6JA 1FOXA 2R7UA 1UHSA 4L5IA 4CZZA 5D6FA 2BHYA 4A0XA 4BE2A 3DTEA 3H3VK 1EKEA 1JKPC 2K9SA 3LMLA 1XB4A 2DU9A 3ZQGA 3LAJA 4O5VA 3C2BA 1R36A 5F64A 1P6RA 4A0YA 3OV8A 1I27A 1LVAA 2BXZA 3HKZA 2ZB9A 4IZZA 5FLVA 2LG4A 5FLXK 2FOWA 2D1VA 3FWEA 2DA3A 3S1NJ 3LSJA 4PSXA 3KZZA 2F5VA 3V7SA 5FKKA 3B73A 2DO7A 3H09A 4YG2F 1VQKI 1D8JA 1ZKGA 1A1JA 4D0PA 4NUBA 4DR6E 3S2WA 2X48A 3LAPA 1A5JA 4GGGA 3RQ4A 1CF7A 4D5FA 2NUGA 2AQEA 1B1BA 2UV1A 3CCRI 4XKCA 4B44A 4XLEA 3FM5A 2HNHA 1Z6RA 4BQNA 1BI0A 4A3EJ 2HOEA 2LF8A 2EMYA 2EN1A 4Q48A 3BR6A 4BC7A 3P5JA 2Q0OA 2VC0A 3I3LA 4CGZA 4ZYGA 1HKTA 3OIQA 4XOTA 5LGUA 2CFXA 2DJNA 2EWNA 3MSWA 3EUHC 1U2WA 2L9VA 5IT3A 4KNYA 5FRNA 3BGHA 3JCUC 2EOEA 2BXYA 2EL4A 3OY9A 3MKZA 4LK1F 1WZ2A 2GQQA 1RC7A 2QLZA 1POGA 2VBYA 4YY3E 4A69C 2EZKA 2ENHA 2ZXWH 3LNQA 2LK2A 1LFUP 2R5YB 2HJJA 4NXNE 1N34E 3FXOA 2EZIA 2WAEA 2G7UA 3ML6A 4BJ5C 3LQRA 2MH2A 4FX0A 3RKWA 2XKOA 2P5LC 1JTYA 2OCEA 4FQGA 4XOPA 1I5ZA 4UB8C 3Q0WA 1WI9A 5AONA 5FKMA 3KP2A 4HV5A 2RNGA 1O3SA 2KJCA 2BB8A 3BJAA 4P9UA 1DU6A 2LVHA 1X5WA 2LFBA 1ZELA 2EZHA 3KETA 1FP2A 4YFXF 3HPGA 1X48A 2YPNA 3GWZA 2YX4A 3PL8A 3CESA 2R0QC 3N4MA 3T0YA 1JUMA 4A2UA 4TUIA 1IV6A 5K7HA 4DR2E 3CCQI 2Q2EA 1WRJA 3O8HA 2AXTC 4AIJA 2VOOA 2R7XA 2IGNA 4PUSA 4R2RA 3R0AA 1S5LC 3IWZA 1F1ZA 2F4OB 1Z7LA 2RQPA 1RR8C 1IJWC 5EF6A 3DPTA 5E1XA 2FXAA 3QU6A 3H9JA 4JX4A 2IGMA 5EG0B 1BL0A 4WSPA 2EPAA 4LLLA 2RGVA 3CMEI 2M0CA 5LRSA 2HVQA 2EM2A 3WTVC 2JVHA 3VSLA 3BTIA 2LY1A 1W0UA 2NUEA 4MEYF 2R7FA 1X3UA 3GX4X 3B6CA 4BBRJ 1RR7A 1DI2A 4G7OF 5EGOA 4ZDPA 3VYYA 1XMKA 3VDXA 3CTAA 2ZM6E 2ZMEA 3LSHA 3DBRB 4U0WA 1SAXA 1Z1DA 2D45A 2RTXA 2BYVE 4D5CA 2EMKA 2WTEA 2QBYB 2X1CA 3GFJA 1SFOJ 1MIJA 4KIBA 1Y0NA 4CH7A 1YQAA 4XSXF 4QLCU 3WGHA 1GTKA 3IRRA 4A3JJ 1K78A 5EEGA 4BJTA 1UN6B 1NG6A 3GW2A 3KYDB 5D5WB 5LEKA 1JT6A 2M87A 3LSTA 4BMJA 2VPLA 2PMHA 4A0ZA 4X0GA 3HBLA 3DP7A 3E3VA 3F6VA 1Z3YA 4Q4ZF 4NNJA 4DJAA 5IYBJ 2WWYA 4F92B 3W6KB 1D5VA 4KYWA 3KX2A 3LSIA 2EPPA 4A3FJ 3HYIA 3WGGA 3E5QA 3PQKA 3I0TA 3HQ1A 3PSIA 2HOTA 4DV4E 1OCOH 1ORKA 2CG4A 3ADGA 2RDPA 3G71I 3TDUC 1R4NB 4Y3OA 1G2HA 3C4BA 3IKTA 2W57A 1S7OA 4BC9A 4R8HA 3CCMI 5LD2C 5IWAE 5EYRA 5DM7F 4BY7J 4ITVA 4IHVA 2IBDA 1GZ6A 3GTJJ 2GA1A 4CO8A 3RYPA 3PUBA 4HX4A 3C4TA 4KICA 1G4DA 1ETOA 1OKRA 1HCRA 2EMBA 1U9OA 3HHGA 2GXGA 2A61A 2V7FA 1ZYRF 3RPQA 1ZH5A 2EOSA 1JE8A 2VE7C 3TMOA 2R7DA 2JA6J 3OYJA 3ADLA 2YU3A 3IUOA 4GYIA 5KCMA 3S93A 4EGZA 2PMZN 1W1WE 3U21A 2RAEA 1YI2I 3P7NA 4L5JA 1AA7A 3R0JA 4FCYA 2YU5A 1ZU1A 4EATA 3ERMA 2EN4A 2DMTA 2VJIA 2CSHA 1XMXA 5ILSA 3VFZA 4BXUA 1FSHA 4N4NB 5A2QZ 1TLHB 3K2AA 1ZAOA 1MBGA 1G2FC 3MKLA 4JI4E 2L7KA 1HR0E 1XC5A 2BGCA 4PJNA 5JFRA 4OMZA 2R7RA 4WX9A 1TN9A 4P96A 2DA5A 4A3DJ 2FV4B 1N36E 2HVRA 1QNTA 2A05A 2HYJA 1HA8A 2VJJA 2WAQA 2B7VA 4KN4X 3MCZA 4HW0A 2EOZA 5HVQC 2A69F 3A02A 1RPWA 5JVGF 1BIAA 2RKHA 4UUSB 2PN6A 1ETYA 4I2OA 2OJED 4AIHA 2ZBKA 3T8TA 5F0HA 1QA6A 3FISA 2FMYA 4JP0A 1A1KA 1UHZA 1UG0A 2KKOA 2MC3A 3VK6A 3BG6A 2DRPA 2JMWA 2QZ8A 3S2HJ 2QQBA 1Z9CA 3JRHA 2EB7A 1S6LA 2AHQA 4QTRA 1XMOE 2KIFA 2DMUA 3ZN0A 2ZFWA 3JRCA 1U3EM 1P7IA 3GTOJ 4WSGA 4R2AA 1D1BA 3THNA 3SXYA 1FPQA 2VXDA 1ZG1A 3WODF 3TBIA 1T38A 3M8EA 2XSDC 3GEZA 1WJBA 1UHMA 1H88C 2W1OA 2YSRA 1FJLA 3VYRB 2X6YA 2L01A 3F22A 4HF1A 2WBMA 3DKYA 2N8XA 2LREA 5FD6A 2YTNA 1B9NA 1WXRA 3IWFA 2CQQA 5CPRB 1WH7A 4XBFA 4RB1A 1TWCJ 3I58A 4RGRA 4CA0A 2KOUA 1Z05A 4AYBA 5IYCJ 2BOLA 5LHHA 3M07A 3ZP5A 1BW5A 1EKZA 3RKYA 2EOXA 3MFKA 2EMAA 4GKKE 2ME0A 2E2JJ 1GUUA 3IHUA 5J4VA 1I6HJ 4G7HF 1QBJA 4ZYHA 1N33E 3ZRGA 1W36C 3PJRA 3GLLA 1VQOI 1HNZE 1HF0A 2VF1A 2BV6A 1BR4A 3WTZA 5L3FA 3OYDA 3THOB 2V88A 4IS1C 2CV0A 1TW3A 4FISA 4DNCA 3C6KA 2JUGA 3CDHA 2DDAA 1RUOA 3BG5A 4W1UA 4OIOF 2EA4A 3S14J 2QM3A 4EM0B 2UXNA 5ICEA 3QP6A 1ZK8A 3HOUJ 2L9SA 3K2ZA 5K5RA 1TQPA 4X6AJ 3BY6A 5CLSA 2EM0A 2X1EA 1V5GA 1IQOA 2DT5A 3ADJA 3ULQB 4F7ZA 4D7NA 2YTDA 1WHNA 2CUZA 1DP7P 5M5WJ 3JTHA 1EV7A 1IMUA 2XAQA 3C2GA 1DGWY 4NZVA 1IQSA 4K2EA 2Z5UA 3K1PA 1XSXA 1OCCH 4N9IA 2CMPA 1IO2A 1FX7A 2V1DA 1SFKA 3PNVA 3TW7A 2VRDA 1HKSA 3GVAA 1TT5B 4IX7A 3OYBA 5C4XJ 4RB3C 3DU5A 3FHNA 3CMMA 1J2XA 2TRTA 3DFGA 1AOYA 2DIXA 3KLOA 4X62E 3DBLB 4XM3A 2O8XA 3HGGA 5DCFA 1D3YA 3U9GA 1RKTA 3OS1A 2EPUA 1ZRFA 1TZLA 3CC2I 3BCBA 5AE2A 3KEYA 1BR2A 2XV4S 3CO7C 2M30A 4I0AA 4BQQA 3WTSC 2W24A 2BEOA 1HSTA 5B3SH 4HPQA 1G3SA 4LG0B 4L9TA 2EJ4A 4MEXF 5EEHA 1SR9A 3J7YJ 3D5RC 2VQGA 2LO3A 3CF2A 4XL9A 5EGOB 1HW1A 1JKOC 2COBA 3CUQA 4B3XA 3MAJA 2CH0A 2FQ4A 3L9FA 1TWFJ 2RV8A 4UXNA 1QQIA 3GMEA 3WG9A 3HTSB 3GTPJ 4IL6C 4A93J 4XLNF 3JRAA 1T4NA 1MBFA 1WJEA 2R7ZJ 5DNYA 3HL2A 2E71A 2ZMEC 2QQ9A 3RCOA 2E2HJ 1D5YA 2BY0A 2DJIA 2Y48A 3HRSA 1XGOA 2VC1A 4ENKA 4FE4A 3C6MA 1MMNA 2MC5A 1YO5C 3HIFA 3WU1B 2E2IJ 4UNOA 2Y0SA 1B72A 3BP8A 2NVTJ 2V83A 5BMZA 1JJ8C 4O5GA 5D4SA 2KL4A 4BL0B 3BTLA 2VKVA 2V9VA 1T2KA 2R7VA 3HUGA 3T8RA 2RS6A 3FXQA 3J81K 2Q1ZB 4XLAA 4O3MA 3S2DJ 4NXME 3H5RA 1TNSA 1IBKE 2K3PA 1Y56A 3LFKA 5L3BA 3SEQA 1PUFB 1XNQE 3CP2A 4BXXJ 3HSFA 1EF4A 2DA4A 1A6IA 3AFHA 5TISC 2E35A 3NWTA 2EJRA 3HOVJ 3ESWB 5F27A 3BR3A 2HR3A 4ZYEA 3M3YJ 2N3GA 5AASA 1ETQA 2L02A 1IV8A 2LOOA 4ENMA 5LHIA 2K02A 3Q9VA 1E17A 2EA2A 4U0VA 3DKXA 2HDCA 3L7WA 2WV0A 4O4KA 4RB0A 1KU2A 1MJBA 5H2FC 2O7OA 4HSTA 5E79C 2DMPA 2ZKZA 4FT8A 5DD8A 3W2AA 5HLHA 1QU6A 2UUCE 2XPWA 4AD9A 4BS9A 1VTNC 4DMIA 3CUQC 2AS5F 4P9FA 5FD5A 1UJ8A 5J1YA 1GHCA 3F8FA 2P5VA 2LVSA 4DV0E 4YIIA 1GXPA 5HS8A 4B47A 1YYOA 5FROA 3OYCA 2FA5A 4RAFA 2CUJA 1SVMA 3HUGB 1FOKA 3P1XA 1ZR2A 4ENJA 2DLQA 5AE3A 1ZBQA 1OMIA 5J47A 2K4JA 3I56I 4KA4A 2IJLA 3LSMA 4PGHA 3DV8A 1MMDA 3R4KA 5BNGA 1GDTA 2HOSA 4M3BA 3GTLJ 3I59B 3SDBA 3BLYA 3IV5A 3FKIJ 3ZMVA 1QHHD 2VL8A 1VQ7I 4C9YA 4GYGA 1K6OA 2IHR1 5GAGJ 4AC0A 4M30A 2JP9A 3NQOA 1JK1A 4ANJA 4M74A 4CCOA 4HNTA 5LLQA 4A3MJ 3RDIA 4XSZF 3MEXA 2GPIA 4LFBE 1P4XA 2FBIA 1IGNA 1J7KA 3FX3A 3PFIA 3CDIA 5HDGA 4X66E 5DUIA 1X1PA 3K70D 2CUEA 5FGMA 3P9CA 3K6QA 1ONVA 3OR2C 4XORA 4EM1A 3R61A 1MNMC 2P7VB 2XVCA 2XHKA 4FK5C 1OPCA 2CU7A 4WPYA 2WB1A 3TQNA 4OINF 4MFDA 3ZMTA 2VBZA 1U8RA 2XGXA 3VOEA 3IKVA 2MBFA 1RKWA 3LSPA 3F6GA 1IDZA 2B7EA 2L3JA 3F21A 5B5EC 2I9IA 3HSRA 5LGNA 3ZQQA 2OTJI 2HTJA 2R3SA 5D4RA 2E7XA 3IRQA 1T0FA 3HOYJ 1LFBA 2ENCA 2EP3A 3B6AA 5CVUA 4LF4E 1WWXA 3ELKA 1YPNA 2ZC2A 1SVLA 4II3A 4AWXB 1YFHA 4DR4E 4JX5A 2HEOA 2A25A 3FHZA 2YZTA 1I3QJ 1MD0A 5D5VB 3CUOA 5A6BA 1GV5A 1GVJA 3H5NA 1XS9A 4XRSA 3IAS2 1YX3A 2BHZA 3QPLA 2VUMJ 4JI8E 1AU7A 4L9JA 4N4OB 4GEQB 4F6MA 2CO5A 1YUJA 1X1AA 1X4PA 4NC6A 5CFFE 3L2VA 3EUKL 3OYAA 1R71A 4JI6E 2BY2A 3K4JA 2YTGA 4AM3A 3CDLA 3S16J 3H92A 2ZCWA 1NHAA 2HOAA 3FXKA 5F04A 4EEFG 2XSJC 1NCSA 1EH8A 4QIWN 3I71A 1MGTA 3JR9A 2JUCA 1IRFA 4X64E 4C2UA 2OV7A 2AXLA 1LDKB 2DXIA 4I98B 1O7FA 2DA7A 1PVEA 5LMUE 3SZGA 1DGCA 5CJ9A 2F5DA 5EZHA 3I54A 2GA2A 4ASNA 1BJAA 4JYKA 2FD5A 2R5ZB 4IHTA 3V8LA 3OS2A 4M72A 4DBRA 1WSUA 2J5OA 1KU7A 4HOBA 2DFHA 5GAHJ 1Y6IA 4FHTA 3BDDA 1IN7A 2R7TA 1TBXA 2K27A 3S15J 3LSGA 4B4CA 1IF1A 4NBQA 1TF3A 1MH4A 2JTVA 4RBOA 3Q0UA 2V86A 2XRLA 1Q1HA 4XMYA 4B1RA 2DT7B 4BXFA 2O6GE 2EN2A 3A01B 4LF6E 2HQNA 2P81A 1XGSA 1R22A 3DQVC 1X49A 1JT0A 2V85A 3AG2H 3H9GA 4HNUA 2Y0SN 4MQ9F 2WA0A 3PFYA 2WAQN 5ILVA 5BS6A 4DV5E 5JR3A 1X1CA 2I5UA 2LMDA 4YEJA 2ELHA 2GOXB 3BTCA 3LLHA 2OAZA 2YTJA 2YTPA 2WADA 2W84A 4DUYE 2DCEA 2LKSA 2E1CA 1A1HA 2DMIA 2MKNA 3U2RA 3FK6A 3ABUA 4V2GA 4R2CA 1T56A 1RNLA 3ABTA 1F5TA 3GFMA 2GOMA 3O8GA 4LGWA 1B8IA 1ZRCA 1TQIA 1UMQA 4UUSA 3D0SA 2FNPA 2XASA 3RSNA 2DQLA 2KZGA 1YRNA 2F4IA 1T4LB 3BJ6A 4S05A 2P6TA 2YX7A 1J5YA 1DU0A 2HKOA 2EIJH 4I6ZA 4YELA 4E70A 1HBXG 4F9AB 5KNLA 1ITYA 3M8JA 3HSEA 2JOXA 2E34A 2PBIA 3O6BB 5IPAA 2R7WA 3FIWA 2JR1A 2WZOA 4IJDA 2WB1N 3L00A 2F5CA 2LKXA 2YTEA 3ABLH 3AL0B 3W6JB 1FYMA 2IEKA 1P47A 2P8TA 5IT9C 2PRTA 3LA7A 3WHCA 1Y8RB 3FMQA 1MNEA 2KHXA 1RQ0A 2EOIA 5M5XJ 4I01A 4RAZA 1O7LA 2ZJPF 2EPKX 2EIMH 4F93B 2R5ZA 3SJMA 2ZO4A 4UVCA 3EDPA 1PJSA 5TJJA 1VQ5I 4Q35B 1ZGAA 1MJAA 3Q0VA 5IP7J 2GXAA 1WJPA 1PP7U 3UK3C 1S7EA 4ZTFA 4I7HA 5KL6A 5ICGA 3PO2J 1FWZA 1R49A 1J5EE 4F2JC 5KK1A 2JSPA 3AG4H 3A01A 4WK8F 3BBGA 3MZYA 2BW3A 5B66C 1XSVA 3K70C 2EQ3A 5KAIC 3E6BA 1BI1A 1FZPB 3P9IA 2EN3A 3F8BA 2CUFA 4A5NA 2BY1A 1B4AA 1QO0D 2V6EA 1IG7A 1YW7A 2OD5A 5LL6R 3OYKA 4LLNA 5K7ZA 1Z77A 3QWLA 4EV0A 2MSYA 2RSIA 3CJTB 2RN7A 2QKMB 3FF5A 2Y75A 4XK4A 5B1BH 3S3OA 3MHHC 3UR3C 2W00A 3IL2A 5L3GA 2CW0F 2YR2A 3BG9A 1W36D 2M4KA 3WTXC 4R2PA 1F36A 3OYLA 2K86A 2IGKA 2V79A 2EN6A 3CJRB 2ODRD 1KA8A 1R5GA 1X19A 1R1UA 5L3EA 2MD0A 3JTGA 3HTUA 4RGSA 2EE8A 4CICA 2VT3A 1ZHFA 3K4CA 2EFPA 2ENAA 1BC7C 2NAZA 2ZXIA 2A07F 2QEXI 4AU7A 1OCZH 1Q1VA 2MYSA 3BZCA 4CCKA 3AKZA 2LJHA 1V3FA 3J81C 5A69A 1JK2A 2NOGA 3A4CA 5EEAA 4K0KE 1KQ8A 4DZPA 3EPZA 1OQYA 4OU0A 1LNWA 1BJZA 3OIPA 4L9NA 5DDGA 4E7HA 1A1FA 2EMIA 3AV0A 2DFIA 2VQHA 2HZTA 2MABA 3F3XA 2IA0A 3KE2A 1T33A 2CGPA 4U87A 1LQ1A 1P4AA 4DKKA 2E1NA 3COAC 5BOXA 4P78A 3BR2A 3T1BA 5HS9A 2KISA 5GPAA 5E3OA 1V4RA 3GXOA 3L09A 2K5CA 4YFNF 3BQZA 3ZQ7A 1T0FC 4RM3A 1YLFA 1RETA 2VASA 1IDYA 3CUQB 1AAYA 3KZIC 5B1AH 2VJ5A 3PO3J 1LFPA 1AWCA 1YSAC 3CCVI 1YYVA 2IS4A 3B02A 2X1DA 1I94E 1HNXE 3VODA 1GV2A 5TGTA 2V1UA 5KL5A 4M73A 1MZBA 2GLIA 4JV5E 4EGYA 1BC8C 1OYWA 2H8RA 3H5AA 2XAJA 2RVCA 2XPVA 2CQKA 2XROA 2XAUA 3P9KA 2YWQA 3OTOE 3TO9A 3EQLF 1ZAAC 1XG1A 4G8XA 2KP6A 2CWEA 2AO9A 3EUHA 4JBAA 1VQMI 2J7JA 1BB8A 4U7BA 5BPIA 5D6EA 3KYCB 2NS7A 3OIOA 2KPMA 1QVUA 2EMWA 4MFEA 4OIRF 1N75A 2VQLA 4JI0E 4RM2A 2BY3A 4DOZA 1LUJB 3SHFA 4KIGA 2VI6A 2VT2A 1H89C 2YRKA 3BR0A 4XIDA 2L3DA 3OMYA 4P1WA 4PZJA 2PJPA 3EETA 4PJLA 4MTEA 5HDNA 3HB9A 2LNBA 4UUVA 2K40A 2KRCA 3OYHA 1YS6A 1I3AA 4C3JJ 3ZQHA 4CUGA 2OF7A 4ON0A 3HOWJ 2YTIA 4RH8A 2MC6A 4HTGA 5BQTA 3LL7A 3ONQA 1PJQA 3W2VA 5LFAA 2TDXA 1D0ZA 1B8IB 2JVGA 4GFBA 3QYFA 3TQMA 1ZG3A 4P7DA 1MDMB 1IRXA 3ASOH 3FZVA 1OISA 4II2A 2FBKA 4MQVA 5J8FA 4DR1E 1D1CA 2Z99A 1VZ0A 3ZPLA 3HOSA 4OAYA 3E6MA 2JJ7A 3C3WA 1FP1D 1B59A 1B9MA 4RLFA 5IP6A 2OU2A 4I0BA 3F9KA 1R9TJ 1YYKA 2PMZA 3HRMA 4E7KA 4J8ZA 1A36A 1X58A 3OOPA 3E5XA 1A04A 2YSPA 2EOYA 2F5EA 3RZDJ 2EN8A 3QPTA 2H36X 1BBYA 3ZQLA 2M3AA 2Z1DA 4KT6A 2J5PA 5LBQA 3DEEA 2M4GA 5IXMB 2EIKH 2MH9A 2QSHX 3OSFA 4EJVA 4ZDLA 1ETKA 4GZNC 1A1IA 2IXSA 1BR1A 5TRDA 4A3BJ 1YITI 1MH3A 5M3MJ 1UCRA 1JHFA 1W5TA 2E72A 1Z3XA 5E1ZB 3HG9A 3OS0A 4CCLA 4IOCF 4IF4A 4A3KJ 5IT9K 1WGXA 2W85A 4LLGF 1N25A 5HS7A 5IOYA 2ADRA 2QGUA 2JA5J 3OYNA 1ETVA 5J4YA 1SMYF 3L2WA 1WJFA 1HC8A 5CVRA 1B69A 2NOJB 1U0JA 3DEUA 5IV8B 1YRNB 4XKBA 2JQ7A 1R4MB 2EMFA 2KONA 3A03A 3TKYA 4Y33A 2K7LA 2DK5A 2K9MA 2A6TA 3FBIB 4LG0A 3FIGA 2ETHA 3RYRA 3DBHB 2HVSA 2MLKA 2XGCA 2MGQA 1KONA 2HGHA 3E7LA 2Y2ZA 3F8CA 4XLFA 2VQCA 4R2EA 1XMAA 1WHQA 3MWMA 5IY5H 3GBGA 2KHMA 4Y13A 3AG3H 3HPHA 1T39A 5FRMA 3HOZJ 4JI7E 2W48A 2L7ZA 3MN2A 1K4SA 3VPRA 2RREA 2GBYA 2VN2A 1U5TA 4BEHA 5E3MA 1LB2A 2EQ1A 2VXZA 5FKLA 3EYIA 4G6QA 3BF2A 1LLMC 1JKQC 2M34A 4HBLA 4DIQA 2YSOA 4UVBA 1P2FA 2FTXB 2L6MA 2EL5A 3SFZA 2ECCA 5JLWA 3ERED 2E1MA 1JGSA 4BHCA 4CHUA 1F43A 1K83J 2HPMA 4GCVA 3ECOA 2EBIA 4IPAA 4A6EA 2P0WA 2F6CA 1KU3A 4MGRA 1IBLE 4B48A 4CYDA 1XD7A 2LRDA 3ZCOA 1MSEC 4WWCA 1FYLA 2XUBA 2H09A 1R7JA 1G59A 1U9NA 1ZN2A 4BDZA 3EUAA 4MHGA 2L4MA 1X2NA 3WU2C 1IRGA 4RHBB 3ROUA 2QF7A 2BE5F 2CQXA 3CCYA 4R2SA 3ASNH 4RMNA 4IQ4A 1IRZA 3BIDA 2EFWA 2EM3A 3K4KA 3BPVA 2GAUA 1HQCA 4A3IJ 2KIUA 1XSDA 4BNCA 5L3DA 2V4JC 1F4KA 5GTIC 5LGTA 2GXBA 4YHHE 1BM9A 2JWOA 1MBJA 1T08B 3ISPA 4YFKF 2CTDA 5J6XA 3BROA 5F1JA 3A0BC 5HODA 2NVYJ 1GT0C 3TDZC 1YYWA 3G73A 2DFEA 4KN7X 1QU3A 5IT9Z 4LFAE 4E7SA 2AQFA 2FE3A 2EMCA 1LKXA 2KZVA 2G9WA 2X6XA 2LBSB 5E8GA 3HZJA 2IPQX 4NHRA 2L3CA 1ZREA 2FQ3A 2VOPA 2K4BA 4ESFA 1ZG5A 5LHGA 4HZFA 1REPC 2F2EA 4C3IJ 2PEXA 4L5EA 4JI5E 1FJGE 4ESJA 5F3WA 3I4MJ 2EM9A 3JSOA 1ZGWA 4M3DA 1O57A 2K9QA 3OL3A 2L9RA 3I59A 4ZYDA 3DJWA 2DB2A 1L0OC 4BAYA 2H94A 2DLKA 2VQFE 3KP5A 4XLCA 5JHUA 4YIRX 1VQPI 4NB5A 1EJ9A 2NVUB 4ZJZA 1CF7B 2WBSA 2QSFX 2QA4I 5DUKA 1PJRA 3ECHA 4V2FA 2IVMA 2H1KA 4DGWB 1WKMA 2R5YA 2JWTA 2IS6A 2Z16A 3TOBA 2LTSA 4Z6YA 3VYXA 4WF2A 5D5UB 4IO9F 3OR1C 1OJLA 4XN0A 4G6DA 2IA2A 3ZQFA 2VIXA 4M3EA 5IOZA 2ISZA 3BJOA 1MEYC 4H0EA 2OZUA 3M1CA 3G1LA 4CXFA 2IGOA 4F52A 3MZ8A 2HYGD 4GXOA 1K7AA 3I9V2 2EPFA 4WXCA 1DQ3A 2V9KA 2LTRA 4BHBA 2CQ7A 1SD5A 1PUFA 4L0YB 1GLNA 3K4MA 2NVQJ 2LC2A 3I5UA 5CVIA 4X65E 2DGCA 2DFFA 3I4NJ 5BR8E 1R5ID 2LTPA 3AUZA 1YHQI 1FT9A 3FXRA 4XKVA 1OCRH 4DUZE 3BCAA 3DKWA 3JU0A 3CO6C 4PJ0C 1E0EA 1UELB 2HTSA 3JRBA 2M5WA 2VE9A 3CLOA 1GVDA 2V9PA 1ETWA 3S3NA 1U78A 3RPUD 9ANTA 1S8NA 1Z0XA 1ZARA 1KYQA 1G3YA 3CC7I 1WI3A 1J59A 2FEZA 3L1PA 1HKQA 1XX5A 3HKZN 2DMNA 4IJAA 3W2WA 1HLVA 3M4OJ 2DA1A 5F1RA 1GXQA 4M6VA 4MIMA 5KAFC 4U0YA 3G2BA 2LUQA 3GTGJ 3QYBA 3DPLC 2GIZA 4ZH4F 1KQ0A 3KWRA 5J1UA 5EDNA 2ICWG 4WCGA 3CCJI 1SFEA 1G2DC 1NK2P 1VQLI 4DYCA 3G4SI 1RZ4A 2EFOA 3SZPA 3QOPA 3RQIA 4G94A 3G3ZA 3C1DA 3X2QH 2XGDA 2VQEE 4PSWA 3MD2A 4M6XA 1IAWA 2VKDA 1AKHB 4JQFA 4DYRA 4J01A 1FEXA 2X85A 4LFCE 2DN0A 2RNJA 3GZ5A 2HPIA 3GO5A 2EPMX 4DV3E 2HQ5A 4NHJA 2X51A 4XICA 4X8WA 5J1RA 3I55I 2JSCA 3K69A 3WU0A 2EFQA 2KDZA 4BY1J 1FC3A 1TW2A 2OCCH 4R2DA 3CCLI 2C6YA 1J9IA 4JI3E 1TTYA 2L4AA 3J80Z 2O9LA 5AC4A 4KDPA 2K3FA 4A3LJ 3TO6A 1PYVA 3G1MA 2E1MB 1P9QC 1UBDC 5K5QA 4Y4RA 2XB0X 2DA2A 2KRFA 4CSWA 2RQLA 1ERDA 3HRUA 5EG0A 4KFCA 3F8MA 2NYXA 4UUTA 1QGPA 3C18A 4JOMA 4BYYA 2A3SA 2EOFA 4EQQA 1OYYA 1PUEE 1QZEA 2XIGA 2CQNA 2EFNA 3KIOA 4KWYA 2MA3A 2PJRB 4RLQA 3EPLA 4LITA 2FRHA 4NQWB 4R8OA 2V6CA 4NC7A 2DPDA 1KQ9A 1UAAA 4BDYA 1IW7F
chains in the Genus database with same CATH topology
2BBYA 2H27A 2A6HF 1BN5A 3RI4A 2EV6A 2H6CA 2FF4A 2Y0MA 2V1XA 4HX7A 1XGNA 2QYOA 1KYZA 3REOA 4PDKA 1W7PD 1T98A 2M8EA 1P92A 2LSOA 1R58A 2MD5A 2O61A 4ZZLA 1EH6A 1XN7A 1BOAA 4M71A 5AIQA 3R60A 1O3RA 2COMA 5HLGA 2X0LA 5DV5A 4IRGA 2FBHA 2GZWA 3M7GA 1FBSA 2NNYA 2JPCA 2OBPA 1G3WA 3SZTA 3KP4A 2DW4A 4EM2A 3QU3A 3GYHX 4HLYA 4S04A 1XCBA 2DLLA 5F6FA 1XGMA 2JT1A 4Q47A 4TV7A 3E5UA 1W5SA 1XDUA 2QVOA 2IA1A 1DUXC 1ON1A 3WE3A 2QUFA 4HLXA 1KYWA 3BPXA 3D5LA 3KLNA 2QENA 4P55A 2G7HA 2ZNZA 2XKPA 4FX4A 2MLGA 4UHTA 2Z33A 4KMUX 3KP3A 3BWGA 2FMLA 3WTWC 1Y0UA 2VODA 4M9XA 2OA4A 4LD5A 4RAYA 4HDUA 2JRTA 1Z6TA 2IP2A 4Y17A 4A6DA 3Q5FA 5E20A 1FBQA 5DCMB 3C7JA 5H6RA 2ZNYA 3GUDA 2P7CB 4UV8A 4EVIA 2GIVA 4BQAA 2DTRA 2HYFA 1ON2A 2M45A 4B8XA 1CGPA 1I6XA 2O3FA 1JXSA 3L2CA 4RS8A 4N0BA 4OMYA 2EV5A 4U88A 5DEQA 1TQMA 3HOTA 5DD4A 1FSEA 1USSA 3GFIA 3WGIA 2JPBA 3WTYC 2B0LA 1S3JA 2STWA 4L9VA 5CVJA 5J8CA 1HW5A 2ACJA 4UV9A 3ZMSA 1QZZA 3ZMDA 3K9TA 4Y15A 1SFXA 1BI3A 1FNNA 1C0WA 4IXAA 4KIFA 1HSJA 4HQEA 5FFXA 4ZZDA 3KFWX 2XAGA 2CYYA 5D8LB 1F9NA 3N97A 1SMTA 1ZLKA 3WE2A 4XLPF 4R1HA 4A5MA 3JAMZ 4MTDA 1WQ2A 2P5KA 3RJPA 2ZXJA 2KJBA 1ODDA 4KUMA 2DPUA 2STTA 3SQNA 1SD4A 5CVVA 4N9HA 4B09A 3VEPA 3NRVA 5H20A 2CSOA 3M8FA 1QZYA 1KGSA 5D8KB 5E18F 2X4HA 2PFBA 2DQRA 1LEAA 4G7ZF 4IHSA 3V4GA 5HDKA 2HQRA 4PCQA 2O03A 4QWQA 2FSWA 3BOQA 3E6CC 1E2XA 2OZ6A 1FBUA 2RC4A 3F8NA 4OIQF 1J0RA 1LDDA 4LJZF 2ESHA 1O3TA 3GF2A 2Q8KA 2PI0A 3ZN1A 5H6QA 4OOIA 3EYYA 4I02A 4IRIA 3RTRA 3Q9SA 2P4WA 3J81Z 2QWWA 2PG4A 3KP7A 1RIOH 3LA3A 1U6GA 1T6SA 5ERIA 5DCMA 5L3CA 2ZJ2A 1BI2A 6PAXA 4ENNA 4HYEA 1B6AA 4HQMA 4M6YA 5K1YA 5FLXZ 2XAFA 3I53A 1R5HA 4P5OA 1UFMA 4PGGA 2Z3YA 2D1HA 2OQGA 3GFLA 1QPMA 3K1NA 5AIPA 1LDJA 1H9GA 1U5TB 4R79A 4HA8A 1YW9A 3LWFA 3KEOA 1IZ1A 2VBXA 1O3QA 3LA2A 4JK1X 3IC7A 1R00A 2H6BA 1PP8F 1L3LA 1RUNA 5D5XB 2E7WA 4IVNA 2A68F 1H9TA 2DBBA 5FFZA 1IN4A 3KEQA 3MQ0A 3K0LA 2VONA 3HRTA 4LB5A 3QAHA 3V7RA 4ESBA 1W7PA 2KIMA 1Z7UA 1J75A 4AVPA 2PLYA 3F6OA 5LEJA 3F23A 4RGUA 3O2PE 4A12A 1PDNC 3TO7A 2ESNA 4KMFA 3FXUA 4Z2YA 1ZGJA 2F5FA 1UB9A 2PQ8A 1IN6A 2IW5A 2EK5A 1I1GA 2IT0A 3WTTC 2HFHA 4LB6B 2DI3A 1IXCA 2JZYA 1S29A 1W7PB 3DXJF 4EJTA 2XAHA 1K79A 2FU4A 3KZYA 4YIFA 3F72A 3QP5A 1HW2A 4RB2C 4M9SA 1R1VA 4I09A 2L54A 3TGNA 1W4MA 2HWVA 2ISYA 1XDSA 5LRRA 2FOKA 3MZHA 1ULYA 4LFUA 4HF2A 3PQJA 3FMRA 1UHWA 2M1BA 2EV0A 4NQWA 2LF7A 1YG2A 1MJ9A 1YIOA 1YW8A 4BH9A 3FM3A 4HDVA 2NRAC 3I64A 5A2QK 1R23A 3V8KA 3K1MA 1RI7A 1K78B 1MKMA 2LDUA 2HKXA 2VE8A 5FO5A 3NEUA 5JI6A 4L18B 1JHHA 3GZ6A 4OIPF 5DYMA 4HV6A 2UWMA 4WXDA 1SD6A 2LKPA 1USTA 1EH7A 4O6JA 4CDGA 3E6DA 3I4PA 1G3TA 2D2WA 2PMUA 4KT5C 2O0YA 1OYIA 1KU9A 3BZ6A 5ICCA 4LK0F 1H0MA 1SD7A 4G9YA 3U1DA 4IRHA 4EJOA 1HXDA 4DQ2A 1DPUA 2IRFG 2W25A 4Q5SF 1S7AA 3CJNA 4WXHA 5ILUA 1STZA 2HGCA 5E1WA 5HLIA 5K5OA 1DPRA 5E8IA 3TOAA 3E97A 1I1SA 4EJWA 3AAFA 1P4WA 2OQRA 1IN8A 2FNAA 4LMYA 3KCCA 1YTYA 2Z9OA 1R1TA 5KVRA 1MDMA 1LJ9A 5ICFA 3RIRA 3QRFF 5HOOA 3R6SA 4U7DA 3O3KA 2GWRA 3M9AA 1YS7A 3KP6A 2P6SA 1Z91A 3ZMZA 2A6EF 1SFUA 3FMSA 1LEBA 1IUYA 3J7AO 3V7CA 5E17F 5FB2A 4HF0A 2A5YB 4ETSA 1FYKA 4L0ZB 2WC2A 5CYVA 1XCVA 1ZRDA 4XRFA 3QPHA 2QQAA 2YPRA 1FLIA 3VB2A 4RGXA 5JVTA 2UZKA 1G6NA 1IXSB 4MNUA 1FY7A 2VBWA 4UVAA 3GLXA 3DF8A 1BIBA 1IN5A 2ADUA 3M1EA 4AIKA 1U5TC 4BHPA 1IXRC 4EJUA 4GO1A 2ZMEB 2UXXA 1TNTA 3RPUA 1DDNA 2QBYA 2NS0A 3ZMUA 3LQQA 5BPDA 3H3UA 3JSPA 2DK8A 1ZLJA 3V8JA 4HAMA 3RKXA 2HS5A 2XRNA 5ED4A 2NNNA 3H3ZA 2DAOA 4M9ZA 1OR7A 3J80K 4EMSA 3WTUC 3T5XA 3JAMK 1D8KA 4HX8A 3JW4A 3HHHA 4L5IA 4CZZA 5D6FA 4A0XA 1XB4A 2DU9A 3LAJA 4O5VA 1R36A 5F64A 1P6RA 4A0YA 3OV8A 1I27A 1LVAA 5FLXK 2D1VA 3FWEA 3KZZA 3V7SA 3B73A 2DO7A 4YG2F 1D8JA 4D0PA 3S2WA 3LAPA 4GGGA 1CF7A 1B1BA 3FM5A 1Z6RA 1BI0A 2HOEA 2LF8A 4Q48A 2Q0OA 2VC0A 4CGZA 4ZYGA 1HKTA 5LGUA 2CFXA 2EWNA 1U2WA 5IT3A 4KNYA 4LK1F 2GQQA 2QLZA 2VBYA 2G7UA 3ML6A 3LQRA 2MH2A 4FX0A 3RKWA 2XKOA 2P5LC 2A07F 1I5ZA 1O3SA 1WI9A 5AONA 3KP2A 4HV5A 2KJCA 3BJAA 4P9UA 3KETA 1FP2A 4YFXF 3GWZA 2YX4A 3N4MA 3T0YA 4A2UA 4AIJA 2Q2EA 1WRJA 2VOOA 3R0AA 3IWZA 1F1ZA 2RQPA 3DPTA 5E1XA 2FXAA 3QU6A 4LLLA 2RGVA 5LRSA 3WTVC 4MEYF 2R7FA 1X3UA 3GX4X 4G7OF 1XMKA 3CTAA 2ZMEA 4U0WA 1SAXA 1Z1DA 2D45A 2BYVE 2WTEA 2QBYB 3GFJA 4KIBA 1YQAA 4XSXF 4QLCU 3WGHA 3IRRA 1K78A 5EEGA 3GW2A 5D5WB 5LEKA 3LSTA 2M87A 2PMHA 4A0ZA 3DP7A 3E3VA 3F6VA 4Q4ZF 2WWYA 3W6KB 1D5VA 4KYWA 3HYIA 3WGGA 3E5QA 3PQKA 3I0TA 2CG4A 2RDPA 3TDUC 3IKTA 2W57A 1S7OA 4R8HA 2GA1A 4CO8A 3RYPA 4HX4A 4KICA 1G4DA 1OKRA 3HHGA 2GXGA 2A61A 1ZYRF 3RPQA 1ZH5A 1JE8A 2R7DA 2YU3A 4GYIA 4EGZA 3P7NA 4L5JA 3R0JA 5ILSA 3VFZA 4BXUA 1FSHA 5A2QZ 1TLHB 1ZAOA 2BGCA 5JFRA 4OMZA 4WX9A 4P96A 1QNTA 4KN4X 3MCZA 4HW0A 5HVQC 2A69F 1BIAA 2RKHA 2PN6A 4I2OA 4AIHA 2ZBKA 3T8TA 2FMYA 2KKOA 2MC3A 2QZ8A 2QQBA 1Z9CA 2EB7A 1S6LA 2KIFA 3ZN0A 2ZFWA 1U3EM 3SXYA 1FPQA 1ZG1A 3WODF 1T38A 3M8EA 3GEZA 1UHMA 2YSRA 4HF1A 2L01A 3F22A 5FD6A 1B9NA 3IWFA 4XBFA 4RB1A 3I58A 4RGRA 1Z05A 5LHHA 3ZP5A 3RKYA 3MFKA 3IHUA 4G7HF 1QBJA 4ZYHA 2BV6A 5L3FA 3WTZA 1TW3A 4DNCA 3CDHA 1RUOA 4OIOF 2EA4A 2QM3A 4EM0B 2UXNA 5ICEA 3QP6A 3K2ZA 5K5RA 1TQPA 3BY6A 5CLSA 2DT5A 3ULQB 4F7ZA 1DP7P 3JTHA 1EV7A 2XAQA 4K2EA 2Z5UA 3K1PA 1XSXA 4N9IA 1FX7A 2V1DA 1HKSA 3GVAA 4RB3C 1J2XA 3DFGA 1AOYA 3KLOA 2O8XA 5DCFA 1D3YA 3U9GA 1ZRFA 2XV4S 3CO7C 2M30A 4I0AA 3WTSC 2W24A 2BEOA 1HSTA 4LG0B 1G3SA 4L9TA 4MEXF 5EEHA 1HW1A 3CUQA 3MAJA 3L9FA 2RV8A 4UXNA 1QQIA 3WG9A 3HTSB 4XLNF 2QQ9A 3HRSA 2Y48A 1XGOA 2VC1A 4ENKA 1YO5C 3HIFA 3WU1B 4UNOA 3BP8A 5BMZA 5D4SA 2V9VA 1T2KA 3HUGA 3T8RA 3FXQA 3J81K 4O3MA 1TNSA 3LFKA 5L3BA 3HSFA 2EJRA 2HR3A 4ZYEA 2L02A 4ENMA 5LHIA 2K02A 3Q9VA 1E17A 2EA2A 4U0VA 2HDCA 3L7WA 2WV0A 4RB0A 1KU2A 1MJBA 2ZKZA 4FT8A 5DD8A 5HLHA 4AD9A 1VTNC 3CUQC 2AS5F 4P9FA 5FD5A 1GHCA 3F8FA 2P5VA 4YIIA 1GXPA 5HS8A 2FA5A 1FOKA 4ENJA 1OMIA 4KA4A 2K4JA 2IJLA 4PGHA 3DV8A 3R4KA 3I59B 3ZMVA 4GYGA 1K6OA 3NQOA 4M74A 5LLQA 3RDIA 4XSZF 3MEXA 1P4XA 2FBIA 1J7KA 3FX3A 3PFIA 5HDGA 5DUIA 5FGMA 3P9CA 1ONVA 4EM1A 3R61A 2P7VB 2XVCA 2XHKA 1OPCA 3TQNA 4OINF 3ZMTA 2VBZA 1U8RA 2XGXA 3VOEA 3IKVA 2MBFA 3F21A 3HSRA 5LGNA 2HTJA 2R3SA 5D4RA 2E7XA 3IRQA 1T0FA 5CVUA 1WWXA 3ELKA 4AWXB 1YFHA 2HEOA 3FHZA 1MD0A 5D5VB 3CUOA 1GVJA 4L9JA 2CO5A 3H92A 2ZCWA 1NHAA 1EH8A 3I71A 1MGTA 1IRFA 2AXLA 1LDKB 4I98B 1O7FA 5CJ9A 2F5DA 3I54A 2GA2A 4ASNA 1BJAA 4IHTA 3V8LA 4M72A 1WSUA 1KU7A 2J5OA 4HOBA 4FHTA 3BDDA 1IN7A 1TBXA 2K27A 1IF1A 2JTVA 1Q1HA 2O6GE 2HQNA 1XGSA 1R22A 3DQVC 4MQ9F 5ILVA 5BS6A 5JR3A 2ELHA 2OAZA 2W84A 2E1CA 3U2RA 3ABUA 1RNLA 3ABTA 1F5TA 3GFMA 1ZRCA 4LGWA 1TQIA 3D0SA 2FNPA 2XASA 2DQLA 3BJ6A 4S05A 2P6TA 2YX7A 1J5YA 2HKOA 4E70A 1HBXG 3HSEA 2PBIA 3O6BB 3L00A 2F5CA 3W6JB 1FYMA 2P8TA 3LA7A 3FMQA 4I01A 4RAZA 1O7LA 2ZO4A 4UVCA 3EDPA 5TJJA 1ZGAA 1MJAA 1PP7U 4I7HA 5ICGA 1FWZA 5KK1A 4WK8F 3MZYA 1XSVA 3E6BA 1BI1A 1FZPB 3P9IA 3F8BA 4A5NA 1B4AA 1QO0D 1YW7A 2OD5A 4LLNA 4EV0A 2RN7A 3FF5A 2Y75A 3IL2A 5L3GA 2CW0F 2YR2A 3WTXC 2K86A 2V79A 1KA8A 1R5GA 1R1UA 5L3EA 3JTGA 3HTUA 4RGSA 4CICA 2VT3A 1ZHFA 2EFPA 1BC7C 2NAZA 1V3FA 1KQ8A 4OU0A 1LNWA 5DDGA 4L9NA 2DFIA 2HZTA 3F3XA 2IA0A 3KE2A 2CGPA 1LQ1A 1P4AA 2E1NA 3COAC 5BOXA 3T1BA 5HS9A 1V4RA 3GXOA 3L09A 4YFNF 3ZQ7A 1YLFA 3CUQB 1AWCA 1YYVA 3B02A 3VODA 2V1UA 4M73A 1MZBA 4EGYA 1BC8C 1OYWA 2XAJA 2RVCA 2CQKA 2XROA 3P9KA 3TO9A 3EQLF 4G8XA 2CWEA 3EUHA 4JBAA 4U7BA 5BPIA 5D6EA 4OIRF 3SHFA 4KIGA 2VT2A 2L3DA 4PZJA 2PJPA 3EETA 4MTEA 5HDNA 2LNBA 4UUVA 1YS6A 4ON0A 5BQTA 2TDXA 1ZG3A 1MDMB 3FZVA 4MQVA 2FBKA 5J8FA 2Z99A 3ZPLA 3HOSA 3E6MA 3C3WA 1FP1D 1B59A 1B9MA 2OU2A 4I0BA 3HRMA 3OOPA 3E5XA 1A04A 2F5EA 3QPTA 1BBYA 2J5PA 5LBQA 2MH9A 4EJVA 5TRDA 1UCRA 1JHFA 1W5TA 5E1ZB 4IF4A 5IT9K 2W85A 4LLGF 5HS7A 1SMYF 5CVRA 3DEUA 3TKYA 2K7LA 2DK5A 4LG0A 2ETHA 3RYRA 2MLKA 3F8CA 1XMAA 3MWMA 4Y13A 1T39A 2VN2A 1U5TA 1LB2A 2VXZA 3EYIA 4G6QA 4HBLA 4UVBA 1P2FA 3SFZA 3ERED 1JGSA 4BHCA 4CHUA 4GCVA 3ECOA 4IPAA 4A6EA 1KU3A 4MGRA 4CYDA 1XD7A 4WWCA 1FYLA 2XUBA 2H09A 1R7JA 1ZN2A 4MHGA 2L4MA 1IRGA 3ROUA 2BE5F 2EFWA 3BPVA 2GAUA 1HQCA 2KIUA 1XSDA 4BNCA 5L3DA 1F4KA 5LGTA 2GXBA 1BM9A 3ISPA 4YFKF 5J6XA 3BROA 3TDZC 3G73A 4KN7X 5IT9Z 2FE3A 2G9WA 5E8GA 2IPQX 1ZREA 2FQ3A 2VOPA 2K4BA 4ESFA 1ZG5A 1REPC 5LHGA 4HZFA 2F2EA 2PEXA 4ESJA 3JSOA 1O57A 3I59A 4ZYDA 1L0OC 4BAYA 2H94A 3KP5A 5JHUA 4NB5A 1CF7B 5DUKA 3ECHA 2IVMA 1WKMA 3TOBA 4WF2A 5D5UB 4G6DA 2IA2A 2ISZA 3BJOA 4H0EA 2OZUA 4CXFA 2HYGD 4GXOA 1K7AA 4WXCA 4BHBA 1SD5A 4L0YB 3I5UA 5CVIA 1FT9A 3FXRA 3DKWA 3CO6C 2HTSA 2M5WA 2VE9A 3CLOA 1U78A 1S8NA 1ZARA 1G3YA 1J59A 2FEZA 1HKQA 4IJAA 5F1RA 1GXQA 4U0YA 3DPLC 4ZH4F 1KQ0A 4WCGA 1SFEA 1RZ4A 2EFOA 3SZPA 3QOPA 4G94A 3G3ZA 3C1DA 1IAWA 4M6XA 4JQFA 2RNJA 3GZ5A