3KZYA

Crystal structure of snap-tag
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
176
structure length
162
Chain Sequence
DCEMKRTTLDSPLGKLELSGCEQGLHEIIFLGAAVLGGPEPLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYSHLAALAGNPAATAAVKTALSGNPVPILIPCHRVVQGDLDVGGYEGGLAVKEWLLAHEGHRLGKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SNAP-tag
publication title SNAP-tag structure
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 47
structure length 162
sequence length 176
chains with identical sequence B
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2009-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3kzyA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 3kzyA01
1Z1DA 5JVTA 4EVIA 2G7HA 1Z05A 3MFKA 1VTNC 3DV8A 1TNSA 4MTEA 1XSVA 1OR7A 5HDKA 1LNWA 3IKVA 3CO6C 5CVIA 4MGRA 1CF7B 4RGRA 2O3FA 2Q2EA 2LKPA 1SMTA 4CDGA 2MLKA 4U7DA 3WGIA 4RB1A 2HTSA 5J6XA 2ETHA 2GA2A 2XIGA 2PBIA 4CICA 4EM0B 2YX4A 5DDGA 1XGOA 3K1MA 5DCFA 3HRUA 1IN5A 2XRNA 3FF5A 1FOKA 1FLIA 3SXYA 2K86A 3COAC 2B0LA 1IF1A 5L3EA 2Q0OA 3SFZA 4L9JA 2L54A 1JGSA 5CVUA 2A6EF 3RTRA 1R1TA 4RGUA 4OU0A 1X3UA 2BGCA 5BPDA 1RNLA 2QQ9A 2XKOA 3CUQA 5ILUA 4L9NA 4U0YA 2QM3A 2E1CA 4GYGA 3JAMZ 1IUYA 2QQAA 4UVAA 1B9MA 4I02A 4G7OF 2OQGA 1D5VA 2NYXA 1PP8F 1W5TA 2WTEA 4WF2A 1WKMA 2FMYA 2FMLA 1FYMA 5DUIA 1Z6TA 5F64A 1GXQA 3QPHA 1LDKB 4OIRF 3LA3A 1J0RA 1UCRA 3BJAA 4BQAA 2RDPA 2MD5A 4AVPA 2CO5A 1QZZA 1JHFA 3TO6A 5LRRA 5E18F 3V8KA 3KP7A 3L2CA 3R60A 3RYPA 2DO7A 3L9FA 4LB6B 1REPC 3ERED 1S7OA 2XAGA 3P9CA 1LVAA 3QRFF 2FU4A 4KIGA 1TQPA 1XN7A 1EV7A 5A2QZ 2OBPA 2ESNA 4O5VA 4G7ZF 4M71A 5ICEA 1G3SA 2DTRA 1FC3A 3ULQB 2DPUA 4G6QA 3I59B 1R00A 4UVBA 3NEUA 2IA1A 3ZMSA 2FNAA 5FD5A 4Q5SF 2L4AA 3GF2A 3ISPA 2NNNA 2A3SA 1UHMA 4LD5A 1D8KA 1IZ1A 1J59A 1R58A 4Q4ZF 1K78A 4F7ZA 3F6VA 2LF7A 5AIPA 2W24A 2ZMEA 2HZTA 3VFZA 4OIOF 2XHKA 1UHWA 3M8FA 2YX7A 1HW5A 4YIFA 3BJ6A 5L3BA 3J80Z 1Z91A 1FPQA 5DCMA 3E5QA 2IRFG 1S6LA 4KN4X 2IVMA 2KIUA 2OA4A 3DFGA 4ZH4F 4D0PA 3T8RA 3ELKA 2L02A 4PGGA 3I58A 4N9HA 2AXLA 5BPIA 2FBKA 2VN2A 3VEPA 4LK1F 4A12A 2EV6A 4EGYA 5CJ9A 1CGPA 1KU3A 1TQMA 2AS5F 5JFRA 1ODDA 1R1VA 2MBFA 3M1EA 5K1YA 2DAOA 5K5QA 2ELHA 3F23A 4PGHA 2J5PA 3ML6A 2WC2A 1WSUA 1HBXG 4ZZDA 1YYVA 3E6CC 3WTYC 3Q5FA 1KQ0A 3GYHX 5AONA 2LNBA 5KVRA 1E2XA 3CUOA 5LHGA 1K7AA 3CLOA 1J7KA 1YS7A 3W6KB 1YQAA 3KFWX 4EMSA 1W7PD 1R5HA 1FP1D 3G73A 3KETA 4O3MA 5BS6A 4EJTA 1ON1A 1YW9A 2ESHA 4ZYHA 3KE2A 3ZN0A 1XCVA 3G3ZA 5JR3A 1S7AA 3HRSA 3IRQA 4XLPF 2G7UA 4BNCA 4OINF 3LQQA 2ACJA 4U88A 4HF2A 3W6JB 2XAFA 4P9FA 4G8XA 1ZG3A 3V4GA 1R1UA 2CG4A 4M9XA 4ESJA 3ZMUA 3N4MA 3DQVC 1QPMA 2L3DA 2UZKA 1YW8A 4L0YB 5EEHA 3QPTA 2D1HA 2JPBA 1T2KA 2HDCA 2KKOA 4TV7A 1BJAA 1KGSA 2EFQA 2ZCWA 1I1GA 2GXBA 2A61A 3H3UA 4RB3C 2HR3A 4HX8A 1P4WA 1H9TA 4E70A 1J9IA 1HSJA 3R6SA 3JW4A 2HWVA 5ED4A 3O2PE 3PQKA 3H3ZA 1NHAA 4ZZLA 4P96A 2QZ8A 4YFNF 1HQCA 1YFHA 3BY6A 2VT3A 4KA4A 5BQTA 5D6FA 4A0ZA 4HYEA 3MZYA 2A68F 1R7JA 3PFIA 1ZAOA 3JSOA 2MH9A 4Q48A 3WTTC 2PFBA 1ZGJA 3NRVA 5LRSA 2R3SA 3IL2A 2O6GE 1XMKA 4B8XA 1IN4A 2DQLA 4P9UA 2JT1A 1HW1A 3E5XA 4LLGF 2QQBA 3VOEA 3WG9A 3IRRA 4CO8A 4HDUA 2HGCA 4K2EA 5ERIA 5H6QA 3FHZA 3B73A 1ULYA 2VC0A 3TGNA 2V1XA 4BH9A 1GXPA 3I4PA 3KLOA 2XAJA 3GZ5A 3J81Z 1JE8A 4L5JA 2L01A 2FBIA 3GO5A 1LJ9A 4KYWA 2BEOA 1ZARA 3HSEA 2A6HF 3K1PA 1F5TA 3FMRA 2P5KA 4KN7X 4U0WA 3DP7A 1HSTA 2EFOA 1F4KA 1G3TA 5D5WB 2F5EA 4GYIA 2STWA 2PMHA 4KIFA 2HYFA 1ZG1A 3OV8A 2Y0MA 4KICA 3F6OA 4A6DA 2CSOA 1TQIA 3N97A 1B4AA 5HS7A 2M5WA 1ZHFA 3J80K 1G3YA 2K27A 4IJAA 4G9YA 1E17A 1SFUA 1GHCA 3CTAA 3FMSA 2PEXA 1K6OA 3DF8A 2H6BA 3WTXC 5D4RA 3KEQA 4KFCA 3LA2A 1U78A 2K4BA 1MDMA 2HKXA 1LEBA 2O0YA 1KU2A 1FY7A 2MC3A 1YG2A 1DP7P 5CYVA 2V79A 1KU9A 1PDNC 2FSWA 2KJCA 1U6GA 2QYOA 5IT3A 4JBAA 2XV4S 2Q8KA 5L3FA 2GQQA 4MEYF 4ENJA 2DW4A 3TQNA 1MJAA 1V3FA 1J2XA 3TKYA 2CQKA 5D5VB 1J5YA 4U0VA 2XVCA 4DNCA 4HZFA 2Z3YA 1FSEA 3KP5A 2GWRA 4KT5C 3F8CA 2HQNA 3RKYA 4EGZA 4RB2C 2HS5A 5DD4A 2CFXA 3ZQ7A 2J5OA 1D8JA 3B02A 2IP2A 1O7FA 1YIOA 2COMA 1BC8C 3I54A 3FWEA 1H0MA 1T0FA 4HAMA 2Z99A 1QQIA 4WXCA 2BBYA 1JHHA 1DPRA 4CGZA 1TW2A 5CVRA 3C7JA 2V9VA 4AIKA 3GW2A 3I71A 4LJZF 3QOPA 1SMYF 2IW5A 5L3CA 2GAUA 1IAWA 4A0YA 3ABUA 2O61A 3R61A 1OYYA 4ZYDA 1KQ8A 4YG2F 2EA2A 4HV6A 2XKPA 2A5YB 2KIMA 3R0AA 4BAYA 3EYIA 5D8LB 2RC4A 2OZUA 4BHPA 3M7GA 1CF7A 5F6FA 1F9NA 2W85A 1RZ4A 3H92A 2ISYA 1Z6RA 1QBJA 4NHJA 5D5UB 2PN6A 1KYZA 2G9WA 2Z9OA 4NQWA 5FFXA 4IF4A 3S2WA 1IRGA 3ZMVA 3BOQA 3AAFA 2MA3A 3O3KA 2LF8A 4ZYGA 4KMUX 5LEJA 3CO7C 4A6EA 5LGNA 3E6MA 1S29A 1SD5A 3CUQC 5D8KB 2ZMEB 3FXUA 2P4WA 2VXZA 3I53A 3ZMDA 3Q9VA 3T0YA 3K9TA 1G3WA 4I98B 4M73A 4AWXB 4KIBA 5IT9K 2V1UA 4RB0A 2VE8A 4LLLA 5DCMB 2H6CA 2EA4A 5E1XA 2R7DA 3T8TA 1K79A 4A5MA 2JZYA 4P5OA 3TOAA 3K69A 2D2WA 1B59A 2P8TA 1ONVA 1LDJA 1OPCA 4M6XA 1W7PB 1D3YA 1BOAA 3J7AO 2K4JA 4LMYA 5ICFA 1RI7A 2PMUA 4KDPA 2Y48A 2KJBA 4JK1X 5KK1A 2DQRA 2JSCA 1T38A 2EFWA 3T5XA 2FF4A 5L3GA 3J81K 1B6AA 2DI3A 2HYGD 4EJWA 2VBXA 3GLXA 4BYYA 5JHUA 4O6JA 2HOEA 4HOBA 4UV9A 2QBYA 4ZYEA 1O57A 4MEXF 1S3JA 2P6SA 5FD6A 3JTHA 1YS6A 1OKRA 4XRFA 3ECHA 5D6EA 1HKSA 2VOPA 2EJRA 2ISZA 4OOIA 5CVVA 1B1BA 3K2ZA 3HOTA 3TOBA 4JQFA 2XGXA 3R4KA 3GFJA 3WTWC 3V7SA 3FX3A 2ZXJA 3LSTA 3KCCA 1SAXA 1XCBA 2BV6A 3GFMA 2M87A 5LHHA 5TJJA 1U5TB 3F8FA 2VBWA 3KP4A 1MGTA 4Y13A 4M74A 2IA2A 1WQ2A 5E8GA 2FA5A 4OIPF 2W84A 4R79A 1R36A 2P7CB 4A0XA 1G4DA 3E6BA 4KUMA 1RUNA 3U2RA 3SQNA 2EV0A 2M30A 3V8JA 5CLSA 1O3TA 3WODF 1KYWA 3TDUC 5HOOA 2VT2A 2FQ3A 2EK5A 3ZMZA 1OYIA 3D0SA 1XB4A 1SFEA 2EFNA 1BI3A 3HTUA 1USSA 1P4XA 3V7RA 2FE3A 3QU6A 2LDUA 4G94A 4I2OA 5FLXZ 1EH8A 4CZZA 1FYKA 3U1DA 3MAJA 4ESBA 4Y15A 1UFMA 3ROUA 3IHUA 1QO0D 5HLHA 3V7CA 4AIJA 3KEOA 3SZPA 3WGGA 4ASNA 2VC1A 1TNTA 1O3SA 2VODA 4CHUA 4MHGA 4BHBA 5HVQC 4EJUA 1LEAA 2HTJA 1SFXA 2H27A 3Q9SA 4IRGA 3HUGA 1XDSA 3L7WA 1ZRCA 2NAZA 4HLYA 4YIIA 3DPLC 3JTGA 2A07F 3FXRA 1DPUA 4L9TA 2FNPA 4ENKA 3IKTA 2ZNYA 2DLLA 2RKHA 2DPDA 5LLQA 3D5LA 4OIQF 4G6DA 4WXHA 5BOXA 2EB7A 1U8RA 5IT9Z 2DK8A 4GO1A 1I5ZA 2XASA 2M1BA 3ZMTA 4N0BA 2F5CA 4R8HA 4BHCA 2JTVA 2FXAA 5J8CA 4FT8A 2ZJ2A 4I0AA 4EQQA 3HRTA 5E1WA 4M72A 1QZYA 4HQMA 3KP3A 4LGWA 1WI9A 1XSXA 1OYWA 3IC7A 2ZO4A 2A69F 5DUKA 1P2FA 4HW0A 3HHHA 4UHTA 3QU3A 1Q1HA 1KQ9A 1MJBA 3HRMA 5ILVA 2H09A 1MZBA 4RGSA 4WX9A 4IHTA 3DXJF 1MDMB 2E7WA 1TW3A 2CW0F 2RQPA 1G6NA 3MQ0A 1I6XA 3GVAA 2Z33A 4M9ZA 2GXGA 1AOYA 1FP2A 2BYVE 3QAHA 3IWZA 4I09A 2CWEA 2E7XA 3ZP5A 3K0LA 4QWQA 4RGXA 1O3RA 3KZYA 5FB2A 2P6TA 4HF1A 3O6BB 1ZREA 4CYDA 3F21A 2F5FA 2UWMA 1BM9A 3EETA 1U3EM 4IPAA 2W25A 5E8IA 2IT0A 3GEZA 1FBSA 1JXSA 1STZA 3PQJA 1FYLA 1R5GA 2MH2A 2KRFA 1HKQA 5FO5A 4LG0A 1T39A 4UNOA 1FSHA 4ESFA 2O8XA 3WE3A 2OU2A 4MQVA 1WRJA 1LDDA 4LFUA 3R0JA 2PQ8A 4KMFA 4XSXF 4MQ9F 2JPCA 5LBQA 3FMQA 2ZFWA 1UB9A 1U2WA 2H94A 2K7LA 2K02A 3ABTA 1OMIA 3TO9A 2OAZA 1WWXA 3WU1B 3CUQB 4AIHA 4WWCA 5LGUA 2Y75A 4IHSA 3NQOA 5D4SA 2X0LA 1FWZA 4RS8A 3MEXA 2DK5A 3BWGA 1RIOH 4PCQA 1Y0UA 2JRTA 1T6SA 3GFLA 1MJ9A 2NS0A 4U7BA 3VODA 4L0ZB 1USTA 3SHFA 3GUDA 3E5UA 4MTDA 1J75A 3BPXA 3FM5A 4OMYA 2XUBA 2Z5UA 2OD5A 3QP5A 4G7HF 1TBXA 4EJOA 3CJNA 1QNTA 4HDVA 3RPUA 3E97A 2PG4A 2YR2A 1XGMA 1HW2A 4L5IA 3L09A 4WXDA 3HHGA 2X4HA 4RAYA 5FLXK 5ILSA 2RV8A 2FBHA 1BIAA 1O3QA 3RI4A 4IRHA 2IPQX 3BJOA 3C1DA 4FX0A 1PP7U 4B09A 1PUEE 1FNNA 3WTVC 3I5UA 2NNYA 3V8LA 2RGVA 2IJLA 2VBYA 4DQ2A 4GCVA 3BDDA 3REOA 1TLHB 2V1DA 2UXNA 3RDIA 1H9GA 5CVJA 2D1VA 3HTSB 1YW7A 1XMAA 2ADUA 1K78B 2BE5F 2DU9A 1C0WA 5ICGA 3DKWA 3M9AA 3BZ6A 4LLNA 1A04A 5HLGA 5D5XB 1I27A 2DT5A 3GFIA 1MD0A 1ZLJA 4N9IA 3WGHA 3DEUA 1ZG5A 5DEQA 4EM2A 5L3DA 2R7FA 2YSRA 3RKWA 2F5DA 2HKOA 3OOPA 1TTYA 4FHTA 2QBYB 2XAQA 1SD6A 3C18A 2STTA 3LA7A 4RAZA 2PLYA 2ZKZA 1F1ZA 2FEZA 2QENA 1EH6A 3F8NA 2M45A 5DV5A 1P6RA 4YFXF 2QLZA 1W5SA 3FM3A 4ETSA 2DBBA 3ZPLA 3F8BA 4IXAA 4WCGA 1IN8A 2OQRA 3LAJA 2NRAC 2GZWA 3KZZA 3BP8A 3LQRA 2HEOA 3I59A 4L9VA 1EH7A 5E20A 3HYIA 4MNUA 3F22A 2E1NA 5E17F 4XSZF 3GWZA 3P7NA 1ZLKA 4UUVA 3VB2A 1BN5A 2XAHA 5DD8A 3WE2A 1W7PA 1IN6A 4HV5A 2WWYA 3WU0A 4Q47A 3HIFA 4IRIA 3LFKA 4ON0A 2MLGA 4GGGA 1IXRC 5J8FA 5HDNA 1KA8A 3HSRA 2RN7A 3WTUC 3M8EA 5LEKA 4S04A 1RUOA 4HF0A 3LAPA 3TO7A 1SD7A 4IVNA 2QVOA 2TDXA 1KU7A 4HA8A 3MZHA 2HQRA 1W4MA 2EV5A 2QUFA 2F2EA 2WV0A 3SZTA 3K1NA 3HOSA 4I01A 4ENNA 2RNJA 1IN7A 2VOOA 1HKTA 1R23A 4I7HA 5H20A 4UV8A 1ZGAA 1IXCA 1BI0A 1P4AA 4BXUA 3LWFA 2GIVA 3F3XA 2XROA 2UXXA 3RPQA 2VE9A 4QLCU 2PI0A 5K5OA 1FT9A 2FOKA 2YPRA 3ZN1A 3P9KA 3JSPA 2OZ6A 1DUXC 2P5VA 2O03A 3WTZA 1DDNA 1ZH5A 4GXOA 5K5RA 3EUHA 2P7VB 1BI2A 2EWNA 5LHIA 1ZRDA 2DFIA 1P92A 2W57A 4P55A 1BI1A 3CDHA 2CYYA 4M9SA 1U5TA 5EEGA 1BIBA 1GVJA 1Z7UA 4KNYA 1B9NA 1S8NA 1XGSA 3GX4X 5E1ZB 1HXDA 5TRDA 1XGNA 5LGTA 4A2UA 4EV0A 2IA0A 3RIRA 4L18B 2VBZA 1FZPB 6PAXA 4HBLA 2EFPA 3MWMA 4Y17A 1IW7F 3FZVA 4LK0F 1ZYRF 3JAMK 3F8MA 2VONA 3QP6A 3MCZA 4PZJA 5FGMA 4EJVA 1ZRFA 2D45A 3BROA 2ZNZA 1BC7C 5ICCA 4YFKF 1Z9CA 2ZBKA 1O7LA 3L00A 2FRHA 2PJPA 1V4RA 1ZN2A 3EDPA 3P9IA 3EQLF 1XSDA 4S05A 1U5TC 4XLNF 4NB5A 4Z2YA 2HFHA 4LB5A 2YU3A 1IXSB 3T1BA 3U9GA 4FX4A 2QWWA 1LB2A 1L3LA 3KP2A 3BPVA 3DPTA 3FXQA 4WK8F 3KP6A 1L0OC 2LSOA 3GXOA 3KLNA 1I1SA 4AD9A 3E3VA 1ON2A 2CGPA 3RKXA 3EYYA 5A2QK 4R1HA 4EM1A 4XBFA 4HLXA 4LG0B 3WTSC 4PDKA 4UXNA 1FBUA 2L4MA 3HSFA 4OMZA 3IWFA 2RVCA 5HLIA 1SD4A 1LQ1A 5FFZA 3TDZC 1YO5C 1YLFA 5H6RA 2C6YA 1MKMA 1FX7A 5HS8A 3GZ6A 1IRFA 1XD7A 1T98A 5DYMA 4CXFA 4H0EA 2GA1A 1R22A 3I0TA 1FBQA 1XDUA 5BMZA 4HX4A 4HX7A 3RYRA 2KIFA 4UVCA 4HQEA 2V6CA 5HS9A 1AWCA 2P5LC 3I64A 1BBYA 3ECOA 5JI6A 3E6DA 5F1RA 5AIQA 1YTYA 1QGPA 5HDGA 4A5NA 3F72A 4ENMA 2M8EA 4I0BA 3RJPA 3C3WA 4M6YA
chains in the Genus database with same CATH superfamily
4N4OB 1E3PA 1OQYA 1Z1DA 5JVTA 3LSRA 2E2JJ 4EVIA 2YRHA 3FIGA 2G7HA 3PO2J 1IO2A 1Z05A 3MFKA 4FCYA 1VTNC 3AV0A 5IP7J 1OLTA 3DV8A 3DWLE 1TNSA 2OPTA 4GDFA 2UUBE 4MTEA 1XSVA 5EDNA 1OR7A 5HDKA 4CCJA 1STUA 1D0XA 2DJNA 1LNWA 1MBHA 3IKVA 4FE7A 3ZCOA 3A2KA 3CO6C 3GZNB 5CVIA 2BXZA 1IC8A 2YTEA 4MGRA 2NS8A 4X9JA 1M1EB 2AO9A 4XR6A 1CF7B 4RGRA 2MDGA 2O3FA 2Q2EA 3QWLA 2LKPA 4NDLA 5DTDA 2DN0A 1PJQA 2M8GX 1SMTA 4CDGA 2MLKA 2YUSA 1JGGA 1TP4A 1WJAA 4U7DA 3WGIA 5TSEA 1OJLA 4RB1A 2HTSA 5J6XA 2EL4A 2ETHA 2GA2A 2XIGA 2KLOA 3VHTB 2WY8Q 4C3IJ 1ETQA 2PBIA 1U9OA 4G6TB 4CICA 4YIRX 4DR3E 3OYBA 1VQKI 3GTKJ 1W36C 1WH5A 4EM0B 2YX4A 1W36D 4NQWB 2HXIA 5B66C 5DDGA 2VI6A 3UNGC 3FXKA 4BBYA 1ETKA 1RC7A 2DDAA 2QGUA 2LJUA 1XGOA 3K1MA 5B1AH 2V7FA 1JKRC 5DCFA 1Z77A 2EN3A 5M5XJ 4ZTJA 3HRUA 2YTFA 1IN5A 4FETA 4CCLA 2B3TB 1V54H 2XPVA 2L3CA 2XRNA 3FF5A 1FOKA 5KL7A 1FLIA 2YU8A 1A6QA 2L7MP 3SXYA 5K7HA 2K86A 1PYVA 1VQ6I 4AC0A 3COAC 2B0LA 2OF7A 1IF1A 5L3EA 4LTYA 3LSGA 3OR2C 2R7UA 2Q0OA 1FJGE 4E6KG 2B9DA 3KYLA 2W82A 1OR7C 2R5ZA 1HR0E 3SFZA 1Y1VJ 4XLHA 3CC4I 2EPFA 2L54A 4L9JA 1JGSA 5CVUA 2A6EF 5LMNE 3RTRA 1R1TA 3OIQA 4RGUA 1QA6A 4OU0A 1X3UA 4AYBN 2BGCA 4LG3A 4II2A 2LBSB 1RESA 1X19A 1OCTC 5BPDA 1RNLA 2L7FP 1ZBTA 3CF2A 2DMPA 1IRZA 2QQ9A 2XKOA 3JRDA 3CUQA 5ILUA 3K6QA 4L9NA 2OCCH 3MN2A 1YX5A 4C30A 1DGRM 2QM3A 4U0YA 4NZVA 3VDXA 2E1CA 4GYGA 3JAMZ 1IUYA 2EMIA 2QQAA 1FKAE 1ZR9A 2KQRA 1MMDA 1T95A 1B9MA 2W48A 4UVAA 4I02A 1MBKA 4Y7NJ 4Y3OA 4G7OF 2OQGA 2ID6A 1D5VA 2X1EA 3RQ4A 2NYXA 4BE2A 3J7AG 1PP8F 1W5TA 2WTEA 4WF2A 3DU5A 2NS7A 1WKMA 2FMYA 1IQSA 3AFHA 4F91B 2EMBA 3L2QA 2ZJPF 4OX9E 2N8XA 3TMOA 2JR1A 1BBOA 1Z3XA 2FMLA 1AHDP 1FYMA 4X66E 5DUIA 1Z6TA 5F64A 5JHFA 1BR2A 5CKTA 1GXQA 3QPHA 2H36X 1LDKB 1LVKA 4OIRF 2I8DA 4DOZA 1ZBQA 3LA3A 2X1CA 1J0RA 1UCRA 3BJAA 4BQAA 1NEIA 2EPZA 1RKTA 4XRMA 4YRVA 1ZAAC 3IH4A 1L4SA 3EQ1A 2RDPA 3CJRB 2MD5A 4AVPA 2CO5A 1QZZA 1JHFA 3TO6A 5LRRA 5E18F 3V8KA 3KP7A 3AL0C 4F9BB 3L2CA 3R60A 3RYPA 4B3SE 1R4MB 2DO7A 2V9PA 4R2QA 3L9FA 4LB6B 1REPC 3ERED 2R7SA 3ASNH 3AG3H 1ETWA 5J3LA 1S7OA 1SANA 2XAGA 1IQOA 3LSIA 4IQ4A 1JKQC 2NABA 2WY7Q 1LVAA 3P9CA 3QRFF 2FU4A 2D5VA 2L2MA 4K0KE 4KIGA 4X1EA 4A3LJ 4LF6E 1TQPA 1Y56A 1XN7A 1EV7A 2JUGA 4JX4A 5A2QZ 3KYDB 4DBQA 2K85A 4P1WA 2OBPA 4IEJA 2R4GA 2ESNA 4CA0A 4O5VA 3W2WA 4G7ZF 4M71A 1R49A 5ICEA 1G3SA 3ADIA 2DTRA 1FC3A 3ULQB 2DPUA 3KWRA 4G6QA 5KL6A 3I59B 2NUFA 3ERMA 1ZGWA 2ZXHA 1R00A 3H5AA 1Z21A 4UVBA 3NEUA 1WVRA 2VUMJ 2HQ5A 1U8BA 3K7AJ 3RZOJ 1TF3A 2EILH 1X1AA 2IA1A 3ZMSA 1FMVA 3BR0A 2N8GA 2M2EA 1WJPA 2FNAA 4IZZA 1VQ9I 5FD5A 2FTXB 2BY2A 4HEA2 1ETVA 3BIDA 1XG1A 4Q5SF 5BR8E 2UV1A 2L4AA 4PJMA 3PNVA 4GFBA 3GF2A 1VQ7I 3ISPA 3S3MA 2NNNA 2A3SA 1UHMA 4LD5A 4D7NA 1K83J 1D8KA 1IZ1A 3CMYA 2QCOA 1J59A 2MD0A 2QA4I 1R58A 4Q4ZF 2Y0SN 1K78A 4C3JJ 3D5SC 4F7ZA 3F6VA 2LF7A 5AIPA 2W24A 2ZMEA 2HZTA 3VFZA 4OIOF 2VL8A 2E60A 2XHKA 2EM0A 2RQQA 1UHWA 4OAYA 3M8FA 3JRCA 2K5CA 2XGCA 1B8IB 2L0KA 2YX7A 2MFZA 3HKZA 3F9KA 1HW5A 4YIFA 3BJ6A 5L3BA 4M6VA 4ZJZA 3MKLA 3J80Z 2H8RA 1IV6A 1Z91A 2JA2A 1OCCH 1KJKA 1AKHA 1IUFA 2H1KA 4GKJE 1FPQA 5DCMA 3SYTA 2YU9J 2RS7A 2TCTA 2YSOA 2PMZA 3E5QA 2FD5A 2Z1DA 2VQLA 3FBIB 2IRFG 4OWRB 1S6LA 4KN4X 3CCVI 3C6MA 3DLLF 2IVMA 2KIUA 1JKOC 2OA4A 3DFGA 4ZH4F 3P1XA 2VLAA 4AUXA 2LR8A 1N25A 4PJNA 2QKMB 2L9NA 4M3EA 4D0PA 2LE2A 2P0WA 3T8RA 1I3AA 1TT0A 2L02A 3C2HA 3ELKA 3H0GJ 4PGGA 2EOEA 3I58A 1YX3A 3H9GA 4N9HA 2AXLA 5BPIA 2FBKA 2VN2A 5HLTA 3VEPA 3O8GA 4LK1F 2BW3B 2I13A 4A12A 4BXFA 2EV6A 4E7SA 4EGYA 5CJ9A 1CGPA 3BTIA 1KU3A 1TQMA 2AS5F 1A1HA 5JFRA 1Z3YA 2YTDA 1ODDA 1R1VA 2V88A 3QQAA 5AC5A 2MBFA 3M1EA 4DYCA 3WHBA 2K9QA 3CDLA 2Y9YA 2YTJA 1B69A 3BCBA 2DAOA 2FOWA 2XB5A 2ZMEC 5K1YA 4DV4E 3PJRA 5K5QA 2EZKA 3EUKL 3OYJA 1T33A 2ZFUA 2EOMA 4W97A 1N34E 2ELHA 2ZSHB 3CJQB 1NH3A 4LOCA 3F23A 4PGHA 3HOXJ 2EMCA 3M99B 4BMJA 1A1JA 2J5PA 3ML6A 4BQQA 2WC2A 1WSUA 5F3WA 1HBXG 5M3FJ 4ZZDA 2KISA 1YYVA 2FUG2 3W6VA 3MVPA 2OCEA 2R5YB 1WZ2A 3E6CC 3WTYC 4R2PA 5AASA 2F4MB 3S8PA 1KQ0A 3GYHX 4CYCB 5AONA 3Q5FA 1RR7A 5IV8B 5KL5A 1R5ID 2LNBA 5KVRA 2JA7J 1E2XA 1X1DA 3BZKA 3CUOA 5LHGA 1K7AA 3CLOA 1J7KA 2ZJRF 4B48A 5EGOA 1YS7A 3W6KB 1YQAA 4II3A 3H3VK 4O4KA 4AIDA 3G1OA 3KFWX 2NOGA 3HXLA 4EMSA 1W7PD 2VASA 3VSLA 4A3FJ 3TW7A 4I6ZA 4C3HJ 3HUGB 1R5HA 5A6BD 1P7IA 1FP1D 3LL7A 3JRFA 3A03A 3G73A 3KETA 2EPXA 4O3MA 5BS6A 2N3HA 4L5EA 4F3QA 4EJTA 1ON1A 3I4NJ 4BE0A 1YW9A 2ESHA 4ZYHA 3KE2A 4B43A 4HSTA 3ZN0A 3O8HA 2M7QA 3K6GA 1T8IA 1XCVA 1I6HJ 2F8BA 3G3ZA 3GCMA 4DGWB 5JR3A 2R7QA 3OIPA 1S7AA 2EM9A 3HRSA 2DDBA 1ZR4A 3IRQA 2XB0X 4XLPF 1U0JA 1W5CC 1HNXE 2G7UA 4BNCA 2MABA 4OINF 3LQQA 5FRMA 1CQTA 1MBGA 2ACJA 4U88A 4HF2A 2F4OB 3W6JB 3AUZA 4B3ME 1XNQE 1P9QC 2XAFA 4P9FA 4G8XA 4V19K 3PUBA 2DFEA 1ZG3A 3K4CA 3LSMA 5LFAA 5B1BH 1EA3A 3V4GA 1R1UA 2CG4A 4M9XA 5IPAA 1YRNA 1B72B 2NA2A 4ESJA 4F54A 4X65E 3ZMUA 3N4MA 4BY7J 4M2ZA 1Y8QB 3DQVC 1QPMA 2L3DA 2UZKA 1YW8A 4L0YB 2EPLX 5EEHA 3QPTA 3BCAA 3S17J 3UK3C 2RNGA 3BGHA 5EJCA 3PNYA 5DS9A 2D1HA 2VQFE 4A3BJ 2JPBA 1T2KA 1XX5A 2CV1A 3A0HC 3K4KA 2HDCA 1MNMC 2PJRB 1RKWA 3T1YE 2VRDA 4XLAA 1MMSA 2V26A 2Q8UA 2IAIA 2R0QC 2KKOA 4TV7A 2IXSA 1MEYC 1BJAA 1KGSA 2EFQA 2ZCWA 1I1GA 4CUGA 2A61A 3UKGA 2VQCA 2GXBA 1A1IA 4XKWA 3H3UA 4RB3C 2HR3A 2EOXA 5M5WJ 4HX8A 2EN6A 4W1UA 1P4WA 1H9TA 4E70A 2Z2SB 2WV1A 1J9IA 2E1OA 1HSJA 5GPAA 2YRKA 3K10A 2L9SA 3R6SA 2QKLB 3JW4A 2HWVA 1FIAA 2HDWA 5ED4A 2LTRA 3O2PE 3PUFA 2JYAA 3PQKA 3Q0VA 4CSWA 1N33E 3G6EI 1T4LB 3H3ZA 2VJ5A 1NHAA 1QZEA 2K40A 2LFBA 1YITI 1OCZH 1F43A 4DZJA 2M3AA 1H8AC 4ZZLA 4P96A 2QZ8A 2VPLA 3CD6I 1UJ8A 4F9CB 1XMOE 4YFNF 2R7ZJ 4A3KJ 2LD5A 4LF7E 1HQCA 4WFTA 3S1QJ 3OL4A 1YFHA 3FXJA 1DGWY 3BY6A 2LBFB 1R71A 1BOBA 2VT3A 3IH2A 4KA4A 4IKFA 3JRIA 2EMWA 5FKOA 2EMGA 2M4KA 3OSGA 2RSIA 2MSYA 3HBLA 4HSRA 2EMXA 2VXDA 1VZ0A 2UU9E 3DTEA 2K3FA 5BQTA 1RPWA 5D6FA 1VI0A 2EOOA 4C9YA 1WHUA 2ENCA 1WGXA 3BR3A 4A0ZA 2HVSA 4XRSG 5M3MJ 2HOAA 4HYEA 3VYSB 2NVQJ 3OYHA 3MZYA 3FK7A 2A68F 2XRLA 1R7JA 2DMQA 2ECBA 3PFIA 4RAFA 1ZAOA 3JSOA 3K4NA 1GV5A 2MH9A 3AG4H 2V87A 4DR7E 2JWOA 1WHQA 4Q48A 1FTTA 3WTTC 2PFBA 1ZGJA 3ABMH 1BW6A 3GBGA 3S15J 2CRGA 3NRVA 5EYRA 4X64E 3A4CA 4MLVA 5LRSA 2R3SA 2EN1A 3FISA 3IL2A 2DXIA 3VYRB 1RC9A 2O6GE 1XMKA 4B8XA 1IN4A 2DQLA 1A6IA 4P9UA 1BA5A 5EZGA 1I39A 2JT1A 1K6YA 1HW1A 3E5XA 4LLGF 5GAGJ 3S16J 1K4SA 1A35A 2QQBA 3VOEA 3WG9A 2CUJA 3JR9A 3IRRA 1BR4A 4F52A 4M0VA 4CO8A 4BBSJ 4HDUA 2CQXA 2DOEA 1WPKA 2HGCA 3QYEA 4K2EA 5ERIA 5H6QA 5J1RA 4F6MA 2HDDA 3FHZA 4DR1E 3B73A 1ULYA 3FK6A 2VC0A 3TGNA 2V1XA 4BH9A 1TT5B 2DYSH 5GTIC 3ADJA 2WB1A 1GXPA 2KFDA 3I4PA 3KLOA 2EORA 5E3NA 2OC6A 2XAJA 5FKNA 3BT9A 1Z67A 3GZ5A 2E5ZA 3J81Z 1TC3C 1GT0C 3BG3A 1JE8A 4L5JA 1TWFJ 2DJIA 2L01A 2UXBE 5EF6A 2FBIA 1W1WE 4B3AA 3GO5A 1X48A 2JK3A 1LJ9A 4RMNA 4KYWA 3MHSC 2BEOA 3HTXA 1ZARA 3HSEA 4C2MJ 2R7WA 3JRBA 1PUFA 4JI7E 2A6HF 3JAMC 2W4SA 3K1PA 5ADZA 1DP3A 1F5TA 4V2FA 4WYQB 3FMRA 2P5KA 4JI3E 3A02A 4KN7X 5FLVA 4U0WA 3DP7A 1HSTA 2EFOA 4U87A 1F4KA 2E19A 1G3TA 1IV8A 4A3CJ 5D5WB 2F5EA 4GYIA 2STWA 2PMHA 3DEEA 4IHXA 4KIFA 2HYFA 2R7RA 1ZG1A 4BKXA 2K3PA 5JVGF 4IO9F 3OV8A 1LPQA 2HZDA 2L7KA 3ZQQA 3VWBA 2Y0MA 4DIQA 4HNTA 4KICA 2DOFA 3BTLA 3F6OA 4B3RE 4A6DA 2JN6A 2CSOA 1TQIA 3N97A 2OTLI 1B4AA 5HS7A 2M5WA 1SVOA 1ZHFA 1X6FA 3J80K 3ABLH 1G3YA 2K27A 2GOMA 3FKIJ 4IJAA 4G9YA 1E17A 1SFUA 1GHCA 3CTAA 3FMSA 2PEXA 2L7ZA 1K6OA 5IOYA 3DF8A 2LG4A 1LFPA 2H6BA 3QODA 2ME0A 1NK3P 2KZGA 3C6KA 3WTXC 4DV1E 5D4RA 3KEQA 4KFCA 3LA2A 2LH9A 5DM7F 1U78A 2K4BA 1MDMA 2HKXA 1LEBA 2O0YA 2EOJA 3C4TA 1KU2A 2QQ8A 1FY7A 2MC3A 1YG2A 5J4VA 1DP7P 1HF0A 5GP9A 2JRMA 5CYVA 2V79A 1LE8B 1GTKA 1KU9A 1PDNC 2XF6A 2FSWA 1DQ3A 2CPNA 2KJCA 1VQPI 1U6GA 2IEKA 1Z7LA 4ZDLA 2QYOA 3JRGA 4LF9E 5IT3A 1YHQI 4JBAA 2XV4S 2Q8KA 5L3FA 2JA5J 4PK4A 2XAUA 4F93B 4IHVA 2GQQA 4JOMA 4X0GA 4MEYF 3H9QA 2EM3A 2M4GA 3PSIA 4ENJA 2DW4A 2ENAA 3TQNA 1MJAA 5GAHJ 3VYXA 1GZ6A 3FBNB 1V3FA 5EG0A 2EWLA 1GVDA 2R7OA 5A2QC 1UELB 1J2XA 3TKYA 2CQKA 5D5VB 3HJEA 2R5ZB 3HOVJ 1J5YA 4BUPA 2K9SA 1N36E 4U0VA 2E1MA 2NXNB 2XGEA 1YUIA 2XVCA 1YIJI 4DNCA 4HZFA 2Z3YA 2ZJQF 3EPKA 3T1HE 4JI4E 4XRSA 2BXYA 1FSEA 5H2FC 3KP5A 4NUBA 2GWRA 4KT5C 3F8CA 3HGGA 4OOGC 2HQNA 3RKYA 2YT4A 2EM6A 4EGZA 4RB2C 4IHWA 2ELYA 1IBME 4WSPA 2HS5A 3TQMA 5DD4A 3OR1C 1FIPA 4Z6YA 4DZPA 5GAEJ 2EM7A 3P5JA 3ADGA 1QU6A 2CFXA 3ZQ7A 2J5OA 1D8JA 3NWSA 3B02A 2IP2A 1A1LA 1JK1A 2HVQA 1HLVA 1O7FA 3KIOA 3CC2I 5IOZA 2JVGA 3DBLB 3LNQA 1YIOA 2COMA 1BC8C 3I54A 2FGGA 3FWEA 2JY9A 3VYTB 1H0MA 1T0FA 4HAMA 1OCPA 2GOXB 2Z99A 3ZRGA 4BL0B 3H0DA 2ODRC 1QQIA 2MKNA 2ODRD 2W1OA 4WXCA 2KL4A 2LK2A 2BBYA 3JRAA 1ZTRA 3S3OA 3OYEA 1JHHA 1DPRA 2QSHX 1TW2A 2V1NA 5CVRA 4CGZA 2IS1A 1V55H 3C7JA 2V9VA 1AH5A 4DR4E 3CMAI 4AIKA 3W2VA 3GW2A 3I71A 4LJZF 3QOPA 1PJRA 1SMYF 4KJZA 3J80C 2IW5A 5L3CA 2GAUA 2EOIA 4XONA 1IAWA 4A0YA 3VSKA 3CCLI 1X6HA 4HG2A 2E1MC 3ABUA 2O61A 1X6EA 3R61A 1OYYA 3HC7A 5E3MA 5K7ZA 1IBKE 4ZYDA 3BR2A 1KQ8A 2EOFA 5DM6F 2L5QA 4Y52J 3CQZJ 4YG2F 4XQFA 2YWQA 2EA2A 4HV6A 2XKPA 2A5YB 1K61A 2KIMA 1D1CA 4IOCF 4NXME 2F48A 3R0AA 5KAFC 4BAYA 3EYIA 2LRSA 2MKDA 5D8LB 2LY9A 4BGDA 2RC4A 2JQ7A 1UHSA 2OZUA 2W00A 3IH3A 4BHPA 4BE1A 1X3ZB 4A3MJ 4LFAE 2EPKX 3QPSA 3M7GA 1CF7A 3CCRI 4R03A 3MD2A 2DMTA 3LMMA 1NK2P 5F6FA 5GTHC 1F9NA 2W85A 1RZ4A 4XMYA 3ESWB 3H92A 4XKCA 2X6YA 4XORA 2EBIA 2ISYA 2GXAA 1T4NA 4BEHA 1Z6RA 1QBJA 1Z0XA 2WAFA 2JWTA 3E7LA 4KT6A 4NHJA 2UXCE 2EOYA 3PSFA 2X6WA 4RM2A 4NNJA 1FMWA 5D5UB 2NVXJ 2H8WA 2CH0A 2PN6A 1KYZA 2VKDA 4MIMA 2G9WA 5LMUE 2Z9OA 4NQWA 4D1QA 3BTJA 5FFXA 4IF4A 3S2WA 2L6MA 2KRHA 3ZXSA 1IRGA 3NAUA 3ZMVA 1IDYA 3BOQA 3H1CA 1LFBA 3AAFA 2L9VA 2MA3A 4WSGA 4AVZA 1MMAA 5A6AA 2E35A 5TGTA 4YHHE 3J7AY 2JSPA 3O3KA 2LF8A 4ZYGA 2E34A 4KMUX 5LEJA 3OYNA 1JJ8C 3I56I 4KZSA 1F2IG 4JI1E 2O9LA 3CO7C 1VFCA 2VQEE 4A6EA 5LGNA 3E6MA 1S29A 3OYGA 2HC5A 2TRTA 3HOZJ 3VYYA 2K9MA 1G2FC 1SD5A 2X51A 3CUQC 1G59A 2BOLA 5D8KB 2ZMEB 3KEYA 3FXUA 2EMKA 2P4WA 2VXZA 2B9SA 1A1KA 3I53A 3ZMDA 1ETXA 3Q9VA 1UILA 4O5GA 2DB2A 1IJWC 3T0YA 3K9TA 2JVAA 1AAYA 1WHNA 3CZ6A 1G3WA 4I98B 4M73A 4AWXB 4KIBA 2WB1N 5IT9K 2EM8A 4DUYE 2X85A 2V1UA 4RB0A 3HQ1A 2QF7A 4DV5E 2VE8A 2DODA 4LLLA 1LKXA 3QG5C 4PJJA 2DA3A 1AKHB 1JI8A 2H1LA 5DCMB 2H6CA 2EA4A 2UUZA 5E1XA 2R7DA 3T8TA 5FKKA 2LOOA 1K79A 4A5MA 3H09A 1YYOA 2JZYA 4P5OA 4JYKA 3TOAA 4FE4A 2YTQA 3MMYB 4Q28A 5E3LA 3K69A 2QEXI 2YTNA 5TISC 2D2WA 1B59A 2P8TA 4M3FA 4I8OA 1TN9A 1ONVA 4IL6C 2LT7A 4XLFA 1LDJA 1NG7A 2IBDA 4UY8I 1OPCA 1PKPA 1DI2A 1N75A 1UMQA 4M6XA 2HPMA 1W7PB 3GTMJ 2BB8A 4FK5C 1D3YA 1BOAA 1WJCA 3J7AO 1X47A 2EM2A 2K4JA 2V85A 1GLNA 1JT6A 4LMYA 5ICFA 4LFCE 5F08A 1RI7A 4JX6A 2PMUA 1E3OC 2M9AA 2DCEA 2EMFA 2EZIA 4RLQA 1HCRA 4KDPA 2Y48A 2CSHA 2CUFA 2KJBA 4XOPA 3EPHA 4JK1X 5KK1A 4BBRJ 2DQRA 3BLYA 2JSCA 4ANJA 1SR9A 3KX2A 2GHFA 1T38A 2DRPA 3CF5F 2GPIA 3RCOA 2L9RA 4DYRA 2EFWA 1N32E 3LSPA 2M7AA 5EZHA 2HVRA 3OOUA 1YSAC 3T5XA 5F0HA 4OAZA 2EIKH 1KZHA 4LF8E 2FF4A 5L3GA 2NVTJ 1WJFA 1BJZA 1FEXA 4BDZA 1PDAA 3J81K 4Y4RA 3LMLA 4R2RA 2V9KA 5FKMA 3OYIA 1B6AA 2DI3A 3DBHB 1RQ0A 2HYGD 2P81A 3IAM2 1YJ9I 2F4VE 4P7DA 2XC7A 9ANTA 2Y69H 3BTCA 4EJWA 3BR5A 2LY1A 2VBXA 3GLXA 4RA2A 4BYYA 3L2WA 2EN8A 1X1BA 1S5LC 1X1PA 3OTOE 3LLHA 5JHUA 5EGOB 4O6JA 1VQOI 2HOEA 3GTQJ 4HOBA 4UV9A 2MC4A 2QBYA 4BCAA 2VJ4A 4ZYEA 1O57A 1BB8A 4MEXF 4E7IA 3G4SI 2L33A 5J47A 1S3JA 2P6SA 5J40A 1WXRA 5FD6A 1RR8C 4DV3E 3FKJA 3JTHA 3LSKA 1YS6A 1AA7A 1OKRA 3GLLA 2FQ4A 2VJJA 3CP2A 2DA6A 2Y31A 4XRFA 4LU9A 5J4YA 2VQHA 2GLOA 3ECHA 5D6EA 1HKSA 2RS6A 4C2UA 2VOPA 2EJRA 1IGNA 3CMMA 4CCOA 2ISZA 4OOIA 1JTXA 3KPHA 5CVVA 1B1BA 4Y33A 3K2ZA 3HOTA 1XMQE 3ADLA 3C2GA 3TOBA 1IRXA 3IAS2 3C2BA 4JQFA 3HOUJ 1ACIA 4RH8A 2XGXA 2YTOA 3R4KA 1S9HA 3JTZA 5M5YJ 3GFJA 1X1CA 3WTWC 1OFCX 3V7SA 3FX3A 2ZXJA 3LSTA 5B3SH 3DKYA 2CU7A 2O8KA 3KCCA 1SAXA 1XCBA 1JT0A 2BV6A 3GFMA 1G2HA 2DOAA 2EZLA 2MC6A 1SVLA 2HYJA 1YRNB 2V6EA 4RM3A 2BVLA 2M87A 5LHHA 4QTRA 5TJJA 1U5TB 3F8FA 3TL4X 2QSGX 5CQEA 2DA5A 3GMEA 3K4BA 1EF4A 3IWDA 2VBWA 2DLQA 1POGA 4R2DA 3KP4A 1MGTA 3EPJA 2XGDA 4M74A 4Y13A 2IA2A 2N3GA 2BY1A 1WQ2A 5E8GA 2FA5A 4OIPF 2ENHA 4R2AA 2W84A 4R79A 1X5WA 2HGHA 1R36A 4BDYA 2P7CB 4A0XA 3W2AA 2MDRA 1S72I 3G71I 1G4DA 2PRTA 3E6BA 4KUMA 1ORKA 4A3IJ 1RUNA 3U2RA 3BG5A 3OY9A 3SQNA 3ONQA 1ERDA 4NBQA 2KIQA 3J81C 2EV0A 2M30A 1MNDA 3V8JA 5KNLA 5CLSA 4A3GJ 2VIXA 4JV5E 1O3TA 3WODF 1KYWA 3TDUC 5HOOA 2BW3A 3BR1A 3S3NA 4DJAA 1QU3A 2VT2A 4XK4A 4LIUA 2FQ3A 1J09A 2EK5A 3ZMZA 1OYIA 1R4NB 2CFOA 3D0SA 1XB4A 3CCMI 5HODA 3J7ZI 2DGCA 1SFEA 2R92J 1YE9A 4DR5E 1Q1VA 3ZR8X 2EFNA 4DV6E 1A5JA 4F9AB 1BI3A 2LKXA 3HTUA 1USSA 1P4XA 3V7RA 2FE3A 2CQ7A 3CLQA 1AU7A 3DLAA 2DA2A 3QU6A 3H5NA 3JCUC 2LDUA 4G94A 4XNFA 3J7YJ 4I2OA 3PNTA 5FLXZ 1EH8A 4CZZA 1A31A 1FYKA 2K9NA 3HPHA 3U1DA 3EPZA 3MAJA 1LLMC 4ESBA 2R5YA 4Y15A 1UFMA 2IGMA 1A1FA 3ROUA 3IHUA 1QO0D 1A1GA 5HLHA 2HXOA 2V4JC 3V7CA 4AIJA 1XS9A 4X6AJ 3KEOA 3SZPA 4RDUA 2K9LA 4PSWA 3GTJJ 3WGGA 4ASNA 1VQ5I 1YUJA 3I4MJ 2VC1A 2OTJI 1TNTA 4XLEA 3TP3A 2IS2A 2JJ7A 1O3SA 3IV5A 4CHUA 2VODA 3PO3J 5JLWA 2LMDA 2EMLA 2HPIA 4MHGA 4BHBA 5HVQC 1H88C 4LF5E 2WA0A 4FISA 4E7KA 4EJUA 1LEAA 2EIJH 2HTJA 3LOCA 1SFXA 1LUJB 4DR2E 2H27A 3Q9SA 4BACA 4IRGA 4L5NC 3HUGA 1YJWI 1XDSA 2AXTC 4UB8C 3L7WA 1ZRCA 2NAZA 2O7OA 4HLYA 1O0WA 1DU0A 4A93J 4V2GA 1X4OA 4YIIA 3DPLC 3JTGA 2A07F 1ZKGA 2XDVA 3FXRA 1X3WB 1DPUA 5F27A 4L9TA 4RBOA 2LLKA 3Q3SA 1ETOA 2FNPA 4ENKA 2DMIA 3IKTA 2ZNYA 2DLLA 2RKHA 2DPDA 4XKBA 2IS6A 5LLQA 1MH3A 3D5LA 3TP0A 4A3JJ 4G6DA 3VPRA 4OIQF 4WXHA 5BOXA 4I76A 2EB7A 1U8RA 1TWAJ 5AE2A 5IT9Z 3SDGA 4XKVA 5BNGA 1IMUA 2HNHA 2RSMA 1UZCA 2DK8A 4GO1A 1I5ZA 2F5VA 2AQFA 4HTGA 3ZQGA 2XASA 2YPNA 1WFXA 2LV2A 2M1BA 1GQEA 3ZMTA 4N0BA 2EZ6A 2LVHA 2F5CA 4R8HA 2E2HJ 4BHCA 2EIMH 2JTVA 4JYAE 1B72A 2FXAA 2KRCA 4NC8A 5J8CA 1PUFB 4FT8A 2ZJ2A 4I0AA 4TUIA 4NXNE 4EQQA 3DKXA 3HRTA 5E1WA 4M72A 1QZYA 3JRHA 5CFFE 2PJRA 2CUZA 4XN0A 1P7JA 4HQMA 5AE1A 4QSHA 3KP3A 2DFFA 1X58A 2IGKA 4LGWA 1R6RA 4DR6E 2LJHA 1WI9A 5AC4A 2KP6A 4GEQB 1XSXA 5DNYA 1OYWA 3IC7A 2ZO4A 2FX0A 2KHMA 2A69F 5DUKA 2NVYJ 2DSYA 1YYWA 1NTCA 1P2FA 2EQ0A 3SDBA 2KONA 1JTYA 1X2MA 4HW0A 1GV2A 3RZDJ 3HHHA 4R2SA 4UHTA 3QU3A 1Y39A 4R2EA 2E2IJ 3FXOA 1Q1HA 2EM4A 3LSHA 1KQ9A 2KDZA 4IHYA 1MJBA 2CV2A 3HRMA 2WADA 4F55A 4B44A 5ILVA 3JREA 1H89C 5E79C 2WBMA 2ECCA 2WBSA 2JOXA 3LSJA 1WJ5A 4EEFG 2ZSIB 3KZIC 2H09A 1MZBA 5IY5H 4RGSA 2X1DA 2G0EA 4WX9A 4IHTA 2ZM6E 1FJLA 2A25A 3B6AA 3PIPF 3DXJF 2Z16A 3CJTB 1MDMB 4JP0A 5KAIC 1QVUA 2E7WA 1TW3A 2CW0F 2RQPA 4A3EJ 2DA1A 1G6NA 4XL9A 1HDPA 3MQ0A 2WCC3 1I6XA 3GVAA 2LBFA 3BC8A 2Z33A 4M9ZA 3MSWA 2GXGA 1AOYA 1FP2A 2BYVE 1ETYA 3QAHA 3THOB 3IWZA 4I09A 4LITA 2CWEA 1TL8A 2BY0A 2E7XA 5IWAE 3ZP5A 3BR6A 2RTXA 3K0LA 4QWQA 4RGXA 3A01A 1O3RA 2LVSA 3D5RC 1I3QJ 5EG0B 3G1MA 2A5WA 3VYUB 2DT7B 5GPCA 3KZYA 5FB2A 3OS1A 1EJ9A 4R2CA 2P6TA 1FOXA 1YYKA 4E7ZA 4HF1A 2E1MB 2DYRH 3O6BB 1ZREA 4CYDA 3HGYA 5KCMA 3F21A 2F5FA 3HL2A 2UWMA 4D9JA 1PVEA 1BM9A 3EETA 4ABZA 2VE7C 2YU5A 1UG2A 1U3EM 2Q2EB 4IPAA 2W25A 5E8IA 2WAQA 3CMEI 2IT0A 1MMGA 3GEZA 2WZOA 3DTKA 1FBSA 1JXSA 1STZA 2DT6A 2KT0A 2X48A 1GDTA 3PQJA 4QPOA 4XLCA 1FYLA 1R5GA 2MH2A 1MSFC 2BBGA 4UB6C 2CMPA 2KRFA 3FIWA 3M8JA 1MBFA 1A36A 5GADJ 1JKPC 4AM3A 4FQGA 1VQNI 2W7NA 4DUZE 3SZGA 3M4OJ 1HKQA 3HPZA 5FO5A 4LG0A 3Q0WA 5F04A 1T39A 2IGNA 4UNOA 3JU0A 1YI2I 1FSHA 2GBYA 4ESFA 2O8XA 3WE3A 2EZHA 4PSXA 2OU2A 4MQVA 1WRJA 4PUSA 3NARA 2EN7A 5KL3A 2JPAA 1LDDA 4LFUA 3K70C 3R0JA 2PQ8A 3K70D 3QYFA 4KMFA 4ITVA 3U1KA 3CC7I 4XSXF 4MQ9F 2JPCA 2KMUA 5LBQA 4KISA 3FMQA 1OISA 2ZFWA 2E5LE 1UB9A 2R76A 3AL0B 4YELA 1U2WA 4B1RA 2H94A 2K7LA 3CCJI 4XIDA 2K02A 3ABTA 1OMIA 3G1LA 1MW7A 2DMYA 3BG9A 2V83A 4E7HA 4PJ0C 3TO9A 5J1UA 2OAZA 1WWXA 4BQOA 2EM5A 3WU1B 3CUQB 4WPYA 4AIHA 4WWCA 3MKWB 1SFKA 1ZR2A 1BBGA 2WBUA 3M3YJ 5LGUA 2LTPA 2Y75A 2NVUB 1XNRE 4IHSA 3HEFA 4CCKA 3NQOA 3CDIA 2ME6A 1JJ6C 2EN2A 2NOJB 3K4LA 3S2HJ 5D4SA 4FTHA 2CQQA 1YPNA 2X0LA 1V5GA 4UUSA 4HRIA 4IQJA 1SC7A 5IP6A 1FWZA 2OV7A 2DA7A 3CCQI 2HI3A 2XF7A 4BEHB 2UUAE 3OSFA 1FOYA 3DTIA 2CUEA 4RS8A 3MEXA 4FASD 1WCMJ 3IWBA 2DK5A 3BWGA 1KYQA 1RIOH 4DKKA 1P47A 4PCQA 1Y0UA 2YRMA 2IS4A 1S7EA 2KHXA 2JRTA 1T6SA 3GFLA 4HEIA 1MJ9A 4GRIA 2NS0A 5F0FA 2MC5A 4U7BA 4M9VC 1LE8A 2IHR1 4B47A 3B6CA 1Y6IA 4RHBB 1TZLA 3VODA 5IYDJ 4L0ZB 1USTA 2B7EA 3SHFA 3GUDA 3E5UA 5CPRB 4MTDA 1J75A 3MHHC 5KL4A 3CCYA 4F2JC 3BPXA 3FM5A 4NC7A 4XN3A 2YS9A 4OMYA 2XUBA 2Z5UA 2OD5A 2YTGA 3GTGJ 4B3TE 1SAUA 3QP5A 2A6TA 2VB6A 4P78A 1YOVB 5C3EJ 4G7HF 1TBXA 4JI5E 2YTIA 4E4HA 4EJOA 3CJNA 2LTSA 1QNTA 3ASOH 4HDVA 3RPUA 3OYFA 4MLQA 3DJWA 2L2OA 3E97A 3OWTA 2M9HA 3ZGKA 4S0HB 1X2NA 2NUEA 3HB9A 3OMLA 2PG4A 2YR2A 1XGMA 2M0MA 4XM3A 3OIOA 5AE3A 1HW2A 2M7BA 4L5IA 2R7TA 3L09A 2ADRA 4WXDA 2D9HA 2QSFX 2LMZA 3V42A 3HHGA 2X4HA 4RAYA 5FLXK 5ILSA 2RV8A 4IX7A 2FBHA 2HOSA 1T4OA 1BIAA 1O3QA 3RI4A 3OYLA 2CW7A 1ZELA 2AHQA 4IRHA 1DU6A 2IPQX 2R1FA 4CZCA 3BJOA 3C1DA 4FX0A 1PP7U 4B09A 1PUEE 4Q35B 1T0FC 1FNNA 2YZTA 3WTVC 1OCOH 3LFUA 3I5UA 2NNYA 4A69C 5FJ8J 3V8LA 2RGVA 2IJLA 2VBYA 2DMNA 1W0UA 3PIOF 4DQ2A 4GCVA 3C4BA 3F6HA 2B7VA 3BDDA 3FDYA 2GM4A 3REOA 3ZQIA 4M30A 4N4NB 1TLHB 2AQEA 2V1DA 2GLIA 1JUPA 2UXNA 4N4RB 2BHZA 3MKZA 3RDIA 2ZB9A 1H9GA 1QHHD 2VJIA 5CVJA 5IYBJ 3PFYA 2D1VA 3HTSB 1YW7A 4X8WA 1XMAA 4MFDA 2ZXIA 2ADUA 5IYCJ 3SFIA 2JA6J 2LP0A 1K78B 2JA8J 1WJDA 2EPAA 2JVHA 4TUGA 1HNZE 2M4IA 5A6JA 3WHCA 1MIJA 4ZDOA 1O4XA 3QOEA 3HPGA 1GUUA 2BE5F 1SVMA 2DU9A 4MO7A 2I9IA 2EPCA 1C0WA 3RPUD 5ICGA 3DKWA 4H4KC 3M9AA 3BZ6A 4LLNA 2E36A 1D0ZA 1A04A 2BZTA 4M3DA 5HLGA 5D5XB 1I27A 2DT5A 4F6NA 5FLMJ 2EOZA 3G2BA 3MZ8A 3GFIA 1WH7A 1MD0A 1ZLJA 4JI2E 1X3CA 4C2TA 4N9IA 3OYMA 3WGHA 3DEUA 1ZG5A 2EQ3A 5DEQA 3U21A 4EM2A 3MKYB 4PJLA 1HDDC 5L3DA 2LRDA 2R7FA 2YSRA 2ZC2A 4B3XA 3RKWA 3OS2A 1PJSA 2F5DA 5FRNA 2HKOA 3OOPA 3M1CA 1J26A 5A69A 4KHPE 2LCEA 1TTYA 4FHTA 1T08B 1N77A 1K4TA 1MH4A 2XAQA 1SD6A 2QBYB 3VK6A 3C18A 3SEQA 2STTA 3LA7A 4RAZA 2DA4A 4JI6E 4EATA 2PLYA 1TF6A 2ZKZA 3M07A 1F1ZA 2GIZA 1FOWA 4DW6A 2FEZA 2HHHE 1SEUA 2QENA 3H9JA 1EH6A 3S93A 1QHGA 3AG1H 3HOYJ 2EQ1A 2EP3A 5C4XJ 3F8NA 2M45A 3F6GA 5DV5A 4DV7E 2K7IA 1XTAA 5FLXC 1P6RA 3ZQFA 4YFXF 2QLZA 3PL8A 1W5SA 2YTPA 2WAQN 3GTPJ 2EMZA 3FM3A 1HC8A 1UG0A 4ETSA 1KONA 1OCRH 2DBBA 4BS9A 2DFHA 3BQYA 5HNHA 1VQ8I 3BBGA 3ZPLA 3TW6A 4DBRA 3F8BA 2NUGA 4IXAA 4WCGA 1IN8A 3N05A 2OQRA 3DEWA 3DU6A 3LAJA 1RRJA 2NRAC 2GZWA 3KZZA 3ECRA 1I94E 3BP8A 5C44J 1FTZA 1D5YA 1NCSA 3GTOJ 3OYCA 2DLKA 3LQRA 3UR3C 2EMHA 5LL6R 4MLOA 2HEOA 4CH7A 3F0CA 3I59A 4L9VA 1EH7A 2WAEA 2EPUA 2CS3A 3A1YA 5E20A 3HYIA 2VF1A 1Y0NA 2HQAA 4MNUA 3OYKA 3F22A 2HOTA 1I50J 2E1NA 5E17F 4XSZF 3GWZA 2ELKA 1UN6B 1Z1BA 2L3JA 3P7NA 2V86A 1VF9A 2R7VA 1ZLKA 2FJ1A 2ZXWH 3VB2A 4UUVA 1BN5A 4DMIA 2XAHA 2VKEA 1IG7A 2RREA 3ZQCA 5DD8A 5IT9C 3FHNA 3WE2A 1W7PA 2R7XA 4E7JA 1IN6A 5A6BA 4HV5A 5E3OA 3RSNA 2XSDC 1MBJA 2WWYA 2JXPA 3WU0A 4DV2E 1T56A 3E1SA 4Q47A 3HIFA 3DPUA 4IRIA 3LFKA 4ON0A 1BL0A 4BY1J 2MLGA 4GGGA 1QPIA 1ZK8A 1IXRC 2R93J 4L8NA 3SEZA 5J8FA 2M0CA 3X2QH 4GZNC 1YZ9A 2LC2A 3S32A 5HDNA 2EMYA 1TWHJ 1KA8A 3HSRA 2RN7A 3WTUC 3M8EA 1X4PA 1B8IA 5LEKA 2Y2ZA 4S04A 1RUOA 1XC5A 4HF0A 2MGQA 2COBA 2EMAA 3W3CA 3LAPA 3TO7A 1SD7A 2KDOA 2F4IA 4IVNA 4RLFA 2Y9ZA 1E0EA 2EH3A 1WI3A 2QVOA 2TDXA 3OS0A 1Y1WJ 1KU7A 3HDDA 4HA8A 1X49A 4ZYAA 1BR1A 5EEAA 3MZHA 2MYSA 4D7MA 2HQRA 1G8XA 1W4MA 2EV5A 2QUFA 1JUMA 2F2EA 2Q1ZB 2WV0A 3SZTA 3K1NA 3TBIA 2K4VA 3HOSA 4JI0E 1JK2A 1SFOJ 4I01A 4ENNA 3L1PA 4BC7A 2RNJA 4HNVA 1IN7A 3S1MJ 2VOOA 1MMNA 2CJJA 4X62E 1HKTA 1R23A 3IP4B 4I7HA 5H20A 5FKLA 4UV8A 1ZGAA 4J19A 1IXCA 1MSEC 4LF4E 1R9TJ 1BI0A 1P4AA 4BXUA 3LWFA 2EJ4A 2GIVA 3F3XA 2EOQA 4BJ5C 3HG9A 2EPMX 2XROA 2LKSA 2YSPA 2LUPB 3WG7H 3KYCB 2UXXA 3OYAA 3RPQA 1V5EA 1ITYA 1VNDA 2VE9A 2CV0A 2EPOA 4QLCU 2PI0A 3CCSI 3L2RA 3D1NI 3ZOBA 4MFEA 2HU9A 4I99C 5K5OA 1D0YA 4IOAF 1FT9A 2FOKA 2VKVA 1RMDA 2XPUA 3AG2H 3BG7A 2V8QB 2YPRA 3ZN1A 2EE8A 3P9KA 3JSPA 2OZ6A 1DUXC 4AU7A 2Y30A 3CP8A 2P5VA 2O03A 3WTZA 1DDNA 3K2AA 1ZH5A 4GXOA 5K5RA 3EUHA 2P7VB 2MW8A 1BI2A 3S1NJ 1V5FA 2BHYA 2JMWA 5F0CA 5JLXA 5T6JA 2EWNA 3E0JB 5LHIA 1ZRDA 2DFIA 1P92A 3CESA 1E3HA 2W57A 4CYCA 2RAEA 4P55A 5B5EC 1BI1A 3OMYA 2DTZA 5J1YA 3CDHA 2CYYA 4M9SA 3HOWJ 2EPNA 4GKKE 1HNWE 2CTDA 3TEDA 2M34A 4D5CA 1U5TA 5EEGA 5CQGA 1BIBA 1GVJA 4QIWN 4LFBE 3RKQA 1Z7UA 4KNYA 1B9NA 1S8NA 1XGSA 3GX4X 1WJEA 5E1ZB 2B7TA 1HXDA 5TRDA 4ZDPA 1XGNA 5LGTA 4A2UA 3IUOA 4EV0A 1EKEA 2IA0A 3RIRA 1EKZA 4L18B 2VBZA 2RPCA 3NWTA 1FZPB 6PAXA 5LD2C 1WJBA 3QYBA 1PJTA 4HBLA 3RQIA 4BJTA 2EFPA 3MWMA 3THNA 4M3BA 3AKZA 4AYBA 4Y17A 1IW7F 3FZVA 4LK0F 2FV4B 1ZYRF 3JAMK 3F8MA 4B4CA 2VONA 1D1BA 3QP6A 2UUCE 3MCZA 4PZJA 5FGMA 2E71A 4BJ6C 2BY3A 3DBRB 1D1AA 4EJVA 1U9NA 1HOMA 1ZRFA 2LO3A 3EUHC 2D45A 4HNUA 3BROA 1UBDC 2ZNZA 1BC7C 3OYDA 4R8OA 5ICCA 4YFKF 1Z9CA 2ZBKA 1APLC 1UHZA 1O7LA 2EN4A 5KL2A 2X9DA 4IJDA 3L00A 2FRHA 2HJJA 1QVTA 4NHRA 1JUSA 2PJPA 1V4RA 1ZN2A 2A05A 3EDPA 3P9IA 1TWGJ 3EQLF 1W0TA 1XSDA 4CCNA 4S05A 2X6XA 3A0BC 1U5TC 4XLNF 3CCEI 1Y8RB 4M3GA 2X6OA 4NB5A 1VQ4I 3A01B 2EL6A 2DIXA 4Z2YA 3S14J 2HFHA 3BZCA 3CCUI 4LB5A 2EQRA 2YU3A 1IXSB 3T1BA 4XICA 2ELJA 5IP9J 3U9GA 4FX4A 4AQYE 4NC6A 4D5FA 4A3DJ 2QWWA 1LFUP 1LB2A 4RAGA 1L3LA 3S1RJ 2XF5A 3BPVA 3KP2A 3DPTA 3FXQA 3RMPA 4WK8F 4G12A 3HM5A 3KP6A 3K4MA 1L0OC 3ZQLA 3IWCA 2JUCA 2ICWG 2LSOA 3GXOA 4ZTFA 4CCMA 2PX9A 2LUQA 3S2DJ 3KLNA 2L8TA 1I1SA 3QPLA 4JX5A 4AD9A 3E3VA 4KITB 2JOBA 4O24A 3K4JA 1ON2A 1VQMI 2CGPA 1QRYA 4BC9A 1F36A 3RKXA 2L92A 3EYYA 5A2QK 2O5RA 4R1HA 5C4JJ 4J8ZA 2LREA 2KOUA 3BQZA 2L2NA 3HKZN 4EM1A 4YEJA 4XBFA 2I10A 4HLXA 4LG0B 4O43A 1DGCA 1N78A 3WTSC 2F6CA 4HPQA 2L2KB 1J5EE 1XPXA 3H35A 2XSJC 3BG6A 3PM1A 4PDKA 4UXNA 2DMUA 2RQLA 2CT1A 1FBUA 2L4MA 3HSFA 2PMZN 4BXXJ 4YY3E 2JP9A 4OMZA 1RETA 3IWFA 2RVCA 5HLIA 2J7JA 5K7FA 2E72A 2KPMA 4DV0E 1BW5A 1SD4A 1LQ1A 5FFZA 3TDZC 1YO5C 1YLFA 5H6RA 2C6YA 3EPLA 2CW8A 4BQNA 2VPRA 1MKMA 2LYCA 3OL3A 4PFPA 2M1SA 5IXMB 3I9V2 3H5RA 1YJNI 2IGOA 1FX7A 5HS8A 4DYQA 1IRFA 1XD7A 3GZ6A 2WBTA 1MBEA 2I5UA 1T98A 5DYMA 2OUMA 5HNFA 1ZU1A 4CXFA 1MNEA 4H0EA 2GA1A 1R22A 3I0TA 3ABKH 2BVMA 2EL5A 1FBQA 1XDUA 3HZJA 2EPPA 4IS1C 1IBLE 4J01A 5BMZA 3FXLA 4HX4A 4F92B 4HX7A 2CQNA 3RYRA 2EINH 2ID3A 3DCFA 2KIFA 4UVCA 4HQEA 2V6CA 2Y0SA 3L2UA 1IDZA 5HS9A 1ENHA 2EOHA 2OJED 1AWCA 2P5LC 3Q0UA 2LY2A 2EOSA 2XPWA 2V89A 3I64A 1G2DC 5F1JA 1TWCJ 2MG4A 1BBYA 1XMXA 1NG6A 3ZOQB 4UUSB 3ECOA 4LIVA 1VQLI 1ZQ3P 2EPRA 5JI6A 4XOTA 3E6DA 3GTLJ 5A6KA 3EUAA 5KHDA 3I3LA 3SJMA 1DQUA 1UAAA 4J00A 2ELZA 4KWYA 2VKHA 3HPSA 4PFOA 3H36A 5AIQA 5F1RA 1YTYA 2UXDE 1QGPA 4QPQA 5HDGA 2VQGA 3WU2C 4BU2A 2B63J 4A5NA 3L2VA 3FXMA 4UUTA 2KZVA 4JI8E 3BF2A 3ZQHA 3F72A 4E7LA 4ENMA 5FROA 2E5NA 2M8EA 3I55I 4I0BA 3RJPA 3C3WA 4M6YA 4ZC3A 3DF6A 3J7Yp 1HA8A 1N3GA
chains in the Genus database with same CATH topology
1Z1DA 5JVTA 4EVIA 2G7HA 1Z05A 3MFKA 1VTNC 3DV8A 1TNSA 4MTEA 1XSVA 1OR7A 5HDKA 1LNWA 3IKVA 3CO6C 5CVIA 4MGRA 1CF7B 4RGRA 2O3FA 2Q2EA 2LKPA 1SMTA 4CDGA 2MLKA 4U7DA 3WGIA 4RB1A 2HTSA 5J6XA 2ETHA 2GA2A 2XIGA 2PBIA 4CICA 4EM0B 2YX4A 5DDGA 1XGOA 3K1MA 5DCFA 3HRUA 1IN5A 2XRNA 3FF5A 1FOKA 1FLIA 3SXYA 2K86A 3COAC 2B0LA 1IF1A 5L3EA 2Q0OA 3SFZA 4L9JA 2L54A 1JGSA 5CVUA 2A6EF 3RTRA 1R1TA 4RGUA 4OU0A 1X3UA 2BGCA 5BPDA 1RNLA 2QQ9A 2XKOA 3CUQA 5ILUA 4L9NA 4U0YA 2QM3A 2E1CA 4GYGA 3JAMZ 1IUYA 2QQAA 4UVAA 1B9MA 4I02A 4G7OF 2OQGA 1D5VA 2NYXA 1PP8F 1W5TA 2WTEA 4WF2A 1WKMA 2FMYA 2FMLA 1FYMA 5DUIA 1Z6TA 5F64A 1GXQA 3QPHA 1LDKB 4OIRF 3LA3A 1J0RA 1UCRA 3BJAA 4BQAA 2RDPA 2MD5A 4AVPA 2CO5A 1QZZA 1JHFA 3TO6A 5LRRA 5E18F 3V8KA 3KP7A 3L2CA 3R60A 3RYPA 2DO7A 3L9FA 4LB6B 1REPC 3ERED 1S7OA 2XAGA 3P9CA 1LVAA 3QRFF 2FU4A 4KIGA 1TQPA 1XN7A 1EV7A 5A2QZ 2OBPA 2ESNA 4O5VA 4G7ZF 4M71A 5ICEA 1G3SA 2DTRA 1FC3A 3ULQB 2DPUA 4G6QA 3I59B 1R00A 4UVBA 3NEUA 2IA1A 3ZMSA 2FNAA 5FD5A 4Q5SF 2L4AA 3GF2A 3ISPA 2NNNA 2A3SA 1UHMA 4LD5A 1D8KA 1IZ1A 1J59A 1R58A 4Q4ZF 1K78A 4F7ZA 3F6VA 2LF7A 5AIPA 2W24A 2ZMEA 2HZTA 3VFZA 4OIOF 2XHKA 1UHWA 3M8FA 2YX7A 1HW5A 4YIFA 3BJ6A 5L3BA 3J80Z 1Z91A 1FPQA 5DCMA 3E5QA 2IRFG 1S6LA 4KN4X 2IVMA 2KIUA 2OA4A 3DFGA 4ZH4F 4D0PA 3T8RA 3ELKA 2L02A 4PGGA 3I58A 4N9HA 2AXLA 5BPIA 2FBKA 2VN2A 3VEPA 4LK1F 4A12A 2EV6A 4EGYA 5CJ9A 1CGPA 1KU3A 1TQMA 2AS5F 5JFRA 1ODDA 1R1VA 2MBFA 3M1EA 5K1YA 2DAOA 5K5QA 2ELHA 3F23A 4PGHA 2J5PA 3ML6A 2WC2A 1WSUA 1HBXG 4ZZDA 1YYVA 3E6CC 3WTYC 3Q5FA 1KQ0A 3GYHX 5AONA 2LNBA 5KVRA 1E2XA 3CUOA 5LHGA 1K7AA 3CLOA 1J7KA 1YS7A 3W6KB 1YQAA 3KFWX 4EMSA 1W7PD 1R5HA 1FP1D 3G73A 3KETA 4O3MA 5BS6A 4EJTA 1ON1A 1YW9A 2ESHA 4ZYHA 3KE2A 3ZN0A 1XCVA 3G3ZA 5JR3A 1S7AA 3HRSA 3IRQA 4XLPF 2G7UA 4BNCA 4OINF 3LQQA 2ACJA 4U88A 4HF2A 3W6JB 2XAFA 4P9FA 4G8XA 1ZG3A 3V4GA 1R1UA 2CG4A 4M9XA 4ESJA 3ZMUA 3N4MA 3DQVC 1QPMA 2L3DA 2UZKA 1YW8A 4L0YB 5EEHA 3QPTA 2D1HA 2JPBA 1T2KA 2HDCA 2KKOA 4TV7A 1BJAA 1KGSA 2EFQA 2ZCWA 1I1GA 2GXBA 2A61A 3H3UA 4RB3C 2HR3A 4HX8A 1P4WA 1H9TA 4E70A 1J9IA 1HSJA 3R6SA 3JW4A 2HWVA 5ED4A 3O2PE 3PQKA 3H3ZA 1NHAA 4ZZLA 4P96A 2QZ8A 4YFNF 1HQCA 1YFHA 3BY6A 2VT3A 4KA4A 5BQTA 5D6FA 4A0ZA 4HYEA 3MZYA 2A68F 1R7JA 3PFIA 1ZAOA 3JSOA 2MH9A 4Q48A 3WTTC 2PFBA 1ZGJA 3NRVA 5LRSA 2R3SA 3IL2A 2O6GE 1XMKA 4B8XA 1IN4A 2DQLA 4P9UA 2JT1A 1HW1A 3E5XA 4LLGF 2QQBA 3VOEA 3WG9A 3IRRA 4CO8A 4HDUA 2HGCA 4K2EA 5ERIA 5H6QA 3FHZA 3B73A 1ULYA 2VC0A 3TGNA 2V1XA 4BH9A 1GXPA 3I4PA 3KLOA 2XAJA 3GZ5A 3J81Z 1JE8A 4L5JA 2L01A 2FBIA 3GO5A 1LJ9A 4KYWA 2BEOA 1ZARA 3HSEA 2A6HF 3K1PA 1F5TA 3FMRA 2P5KA 4KN7X 4U0WA 3DP7A 1HSTA 2EFOA 1F4KA 1G3TA 5D5WB 2F5EA 4GYIA 2STWA 2PMHA 4KIFA 2HYFA 1ZG1A 3OV8A 2Y0MA 4KICA 3F6OA 4A6DA 2CSOA 1TQIA 3N97A 1B4AA 5HS7A 2M5WA 1ZHFA 3J80K 1G3YA 2K27A 4IJAA 4G9YA 1E17A 1SFUA 1GHCA 3CTAA 3FMSA 2PEXA 1K6OA 3DF8A 2H6BA 3WTXC 5D4RA 3KEQA 4KFCA 3LA2A 1U78A 2K4BA 1MDMA 2HKXA 1LEBA 2O0YA 1KU2A 1FY7A 2MC3A 1YG2A 1DP7P 5CYVA 2V79A 1KU9A 1PDNC 2FSWA 2KJCA 1U6GA 2QYOA 5IT3A 4JBAA 2XV4S 2Q8KA 5L3FA 2GQQA 4MEYF 4ENJA 2DW4A 3TQNA 1MJAA 1V3FA 1J2XA 3TKYA 2CQKA 5D5VB 1J5YA 4U0VA 2XVCA 4DNCA 4HZFA 2Z3YA 1FSEA 3KP5A 2GWRA 4KT5C 3F8CA 2HQNA 3RKYA 4EGZA 4RB2C 2HS5A 5DD4A 2CFXA 3ZQ7A 2J5OA 1D8JA 3B02A 2IP2A 1O7FA 1YIOA 2COMA 1BC8C 3I54A 3FWEA 1H0MA 1T0FA 4HAMA 2Z99A 1QQIA 4WXCA 2BBYA 1JHHA 1DPRA 4CGZA 1TW2A 5CVRA 3C7JA 2V9VA 4AIKA 3GW2A 3I71A 4LJZF 3QOPA 1SMYF 2IW5A 5L3CA 2GAUA 1IAWA 4A0YA 3ABUA 2O61A 3R61A 1OYYA 4ZYDA 1KQ8A 4YG2F 2EA2A 4HV6A 2XKPA 2A5YB 2KIMA 3R0AA 4BAYA 3EYIA 5D8LB 2RC4A 2OZUA 4BHPA 3M7GA 1CF7A 5F6FA 1F9NA 2W85A 1RZ4A 3H92A 2ISYA 1Z6RA 1QBJA 4NHJA 5D5UB 2PN6A 1KYZA 2G9WA 2Z9OA 4NQWA 5FFXA 4IF4A 3S2WA 1IRGA 3ZMVA 3BOQA 3AAFA 2MA3A 3O3KA 2LF8A 4ZYGA 4KMUX 5LEJA 3CO7C 4A6EA 5LGNA 3E6MA 1S29A 1SD5A 3CUQC 5D8KB 2ZMEB 3FXUA 2P4WA 2VXZA 3I53A 3ZMDA 3Q9VA 3T0YA 3K9TA 1G3WA 4I98B 4M73A 4AWXB 4KIBA 5IT9K 2V1UA 4RB0A 2VE8A 4LLLA 5DCMB 2H6CA 2EA4A 5E1XA 2R7DA 3T8TA 1K79A 4A5MA 2JZYA 4P5OA 3TOAA 3K69A 2D2WA 1B59A 2P8TA 1ONVA 1LDJA 1OPCA 4M6XA 1W7PB 1D3YA 1BOAA 3J7AO 2K4JA 4LMYA 5ICFA 1RI7A 2PMUA 4KDPA 2Y48A 2KJBA 4JK1X 5KK1A 2DQRA 2JSCA 1T38A 2EFWA 3T5XA 2FF4A 5L3GA 3J81K 1B6AA 2DI3A 2HYGD 4EJWA 2VBXA 3GLXA 4BYYA 5JHUA 4O6JA 2HOEA 4HOBA 4UV9A 2QBYA 4ZYEA 1O57A 4MEXF 1S3JA 2P6SA 5FD6A 3JTHA 1YS6A 1OKRA 4XRFA 3ECHA 5D6EA 1HKSA 2VOPA 2EJRA 2ISZA 4OOIA 5CVVA 1B1BA 3K2ZA 3HOTA 3TOBA 4JQFA 2XGXA 3R4KA 3GFJA 3WTWC 3V7SA 3FX3A 2ZXJA 3LSTA 3KCCA 1SAXA 1XCBA 2BV6A 3GFMA 2M87A 5LHHA 5TJJA 1U5TB 3F8FA 2VBWA 3KP4A 1MGTA 4Y13A 4M74A 2IA2A 1WQ2A 5E8GA 2FA5A 4OIPF 2W84A 4R79A 1R36A 2P7CB 4A0XA 1G4DA 3E6BA 4KUMA 1RUNA 3U2RA 3SQNA 2EV0A 2M30A 3V8JA 5CLSA 1O3TA 3WODF 1KYWA 3TDUC 5HOOA 2VT2A 2FQ3A 2EK5A 3ZMZA 1OYIA 3D0SA 1XB4A 1SFEA 2EFNA 1BI3A 3HTUA 1USSA 1P4XA 3V7RA 2FE3A 3QU6A 2LDUA 4G94A 4I2OA 5FLXZ 1EH8A 4CZZA 1FYKA 3U1DA 3MAJA 4ESBA 4Y15A 1UFMA 3ROUA 3IHUA 1QO0D 5HLHA 3V7CA 4AIJA 3KEOA 3SZPA 3WGGA 4ASNA 2VC1A 1TNTA 1O3SA 2VODA 4CHUA 4MHGA 4BHBA 5HVQC 4EJUA 1LEAA 2HTJA 1SFXA 2H27A 3Q9SA 4IRGA 3HUGA 1XDSA 3L7WA 1ZRCA 2NAZA 4HLYA 4YIIA 3DPLC 3JTGA 2A07F 3FXRA 1DPUA 4L9TA 2FNPA 4ENKA 3IKTA 2ZNYA 2DLLA 2RKHA 2DPDA 5LLQA 3D5LA 4OIQF 4G6DA 4WXHA 5BOXA 2EB7A 1U8RA 5IT9Z 2DK8A 4GO1A 1I5ZA 2XASA 2M1BA 3ZMTA 4N0BA 2F5CA 4R8HA 4BHCA 2JTVA 2FXAA 5J8CA 4FT8A 2ZJ2A 4I0AA 4EQQA 3HRTA 5E1WA 4M72A 1QZYA 4HQMA 3KP3A 4LGWA 1WI9A 1XSXA 1OYWA 3IC7A 2ZO4A 2A69F 5DUKA 1P2FA 4HW0A 3HHHA 4UHTA 3QU3A 1Q1HA 1KQ9A 1MJBA 3HRMA 5ILVA 2H09A 1MZBA 4RGSA 4WX9A 4IHTA 3DXJF 1MDMB 2E7WA 1TW3A 2CW0F 2RQPA 1G6NA 3MQ0A 1I6XA 3GVAA 2Z33A 4M9ZA 2GXGA 1AOYA 1FP2A 2BYVE 3QAHA 3IWZA 4I09A 2CWEA 2E7XA 3ZP5A 3K0LA 4QWQA 4RGXA 1O3RA 3KZYA 5FB2A 2P6TA 4HF1A 3O6BB 1ZREA 4CYDA 3F21A 2F5FA 2UWMA 1BM9A 3EETA 1U3EM 4IPAA 2W25A 5E8IA 2IT0A 3GEZA 1FBSA 1JXSA 1STZA 3PQJA 1FYLA 1R5GA 2MH2A 2KRFA 1HKQA 5FO5A 4LG0A 1T39A 4UNOA 1FSHA 4ESFA 2O8XA 3WE3A 2OU2A 4MQVA 1WRJA 1LDDA 4LFUA 3R0JA 2PQ8A 4KMFA 4XSXF 4MQ9F 2JPCA 5LBQA 3FMQA 2ZFWA 1UB9A 1U2WA 2H94A 2K7LA 2K02A 3ABTA 1OMIA 3TO9A 2OAZA 1WWXA 3WU1B 3CUQB 4AIHA 4WWCA 5LGUA 2Y75A 4IHSA 3NQOA 5D4SA 2X0LA 1FWZA 4RS8A 3MEXA 2DK5A 3BWGA 1RIOH 4PCQA 1Y0UA 2JRTA 1T6SA 3GFLA 1MJ9A 2NS0A 4U7BA 3VODA 4L0ZB 1USTA 3SHFA 3GUDA 3E5UA 4MTDA 1J75A 3BPXA 3FM5A 4OMYA 2XUBA 2Z5UA 2OD5A 3QP5A 4G7HF 1TBXA 4EJOA 3CJNA 1QNTA 4HDVA 3RPUA 3E97A 2PG4A 2YR2A 1XGMA 1HW2A 4L5IA 3L09A 4WXDA 3HHGA 2X4HA 4RAYA 5FLXK 5ILSA 2RV8A 2FBHA 1BIAA 1O3QA 3RI4A 4IRHA 2IPQX 3BJOA 3C1DA 4FX0A 1PP7U 4B09A 1PUEE 1FNNA 3WTVC 3I5UA 2NNYA 3V8LA 2RGVA 2IJLA 2VBYA 4DQ2A 4GCVA 3BDDA 3REOA 1TLHB 2V1DA 2UXNA 3RDIA 1H9GA 5CVJA 2D1VA 3HTSB 1YW7A 1XMAA 2ADUA 1K78B 2BE5F 2DU9A 1C0WA 5ICGA 3DKWA 3M9AA 3BZ6A 4LLNA 1A04A 5HLGA 5D5XB 1I27A 2DT5A 3GFIA 1MD0A 1ZLJA 4N9IA 3WGHA 3DEUA 1ZG5A 5DEQA 4EM2A 5L3DA 2R7FA 2YSRA 3RKWA 2F5DA 2HKOA 3OOPA 1TTYA 4FHTA 2QBYB 2XAQA 1SD6A 3C18A 2STTA 3LA7A 4RAZA 2PLYA 2ZKZA 1F1ZA 2FEZA 2QENA 1EH6A 3F8NA 2M45A 5DV5A 1P6RA 4YFXF 2QLZA 1W5SA 3FM3A 4ETSA 2DBBA 3ZPLA 3F8BA 4IXAA 4WCGA 1IN8A 2OQRA 3LAJA 2NRAC 2GZWA 3KZZA 3BP8A 3LQRA 2HEOA 3I59A 4L9VA 1EH7A 5E20A 3HYIA 4MNUA 3F22A 2E1NA 5E17F 4XSZF 3GWZA 3P7NA 1ZLKA 4UUVA 3VB2A 1BN5A 2XAHA 5DD8A 3WE2A 1W7PA 1IN6A 4HV5A 2WWYA 3WU0A 4Q47A 3HIFA 4IRIA 3LFKA 4ON0A 2MLGA 4GGGA 1IXRC 5J8FA 5HDNA 1KA8A 3HSRA 2RN7A 3WTUC 3M8EA 5LEKA 4S04A 1RUOA 4HF0A 3LAPA 3TO7A 1SD7A 4IVNA 2QVOA 2TDXA 1KU7A 4HA8A 3MZHA 2HQRA 1W4MA 2EV5A 2QUFA 2F2EA 2WV0A 3SZTA 3K1NA 3HOSA 4I01A 4ENNA 2RNJA 1IN7A 2VOOA 1HKTA 1R23A 4I7HA 5H20A 4UV8A 1ZGAA 1IXCA 1BI0A 1P4AA 4BXUA 3LWFA 2GIVA 3F3XA 2XROA 2UXXA 3RPQA 2VE9A 4QLCU 2PI0A 5K5OA 1FT9A 2FOKA 2YPRA 3ZN1A 3P9KA 3JSPA 2OZ6A 1DUXC 2P5VA 2O03A 3WTZA 1DDNA 1ZH5A 4GXOA 5K5RA 3EUHA 2P7VB 1BI2A 2EWNA 5LHIA 1ZRDA 2DFIA 1P92A 2W57A 4P55A 1BI1A 3CDHA 2CYYA 4M9SA 1U5TA 5EEGA 1BIBA 1GVJA 1Z7UA 4KNYA 1B9NA 1S8NA 1XGSA 3GX4X 5E1ZB 1HXDA 5TRDA 1XGNA 5LGTA 4A2UA 4EV0A 2IA0A 3RIRA 4L18B 2VBZA 1FZPB 6PAXA 4HBLA 2EFPA 3MWMA 4Y17A 1IW7F 3FZVA 4LK0F 1ZYRF 3JAMK 3F8MA 2VONA 3QP6A 3MCZA 4PZJA 5FGMA 4EJVA 1ZRFA 2D45A 3BROA 2ZNZA 1BC7C 5ICCA 4YFKF 1Z9CA 2ZBKA 1O7LA 3L00A 2FRHA 2PJPA 1V4RA 1ZN2A 3EDPA 3P9IA 3EQLF 1XSDA 4S05A 1U5TC 4XLNF 4NB5A 4Z2YA 2HFHA 4LB5A 2YU3A 1IXSB 3T1BA 3U9GA 4FX4A 2QWWA 1LB2A 1L3LA 3KP2A 3BPVA 3DPTA 3FXQA 4WK8F 3KP6A 1L0OC 2LSOA 3GXOA 3KLNA 1I1SA 4AD9A 3E3VA 1ON2A 2CGPA 3RKXA 3EYYA 5A2QK 4R1HA 4EM1A 4XBFA 4HLXA 4LG0B 3WTSC 4PDKA 4UXNA 1FBUA 2L4MA 3HSFA 4OMZA 3IWFA 2RVCA 5HLIA 1SD4A 1LQ1A 5FFZA 3TDZC 1YO5C 1YLFA 5H6RA 2C6YA 1MKMA 1FX7A 5HS8A 3GZ6A 1IRFA 1XD7A 1T98A 5DYMA