3KZYA

Crystal structure of snap-tag
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
176
structure length
162
Chain Sequence
DCEMKRTTLDSPLGKLELSGCEQGLHEIIFLGAAVLGGPEPLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYSHLAALAGNPAATAAVKTALSGNPVPILIPCHRVVQGDLDVGGYEGGLAVKEWLLAHEGHRLGKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SNAP-tag
publication title SNAP-tag structure
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 47
structure length 162
sequence length 176
chains with identical sequence B
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2009-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3kzyA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 3kzyA01
5DUIA 1MJAA 4O6JA 5HOOA 5E20A 4CDGA 1LVAA 4EV0A 4AWXB 5FFXA 2JSCA 4YFXF 1LB2A 4S04A 4P55A 2ETHA 3QPTA 2M5WA 4MNUA 3FF5A 5E8IA 5CVJA 5D5WB 3HRUA 1Z7UA 3CUQC 2O6GE 5E8GA 2XGXA 2F5EA 3DFGA 3I4PA 5F6FA 3ELKA 4EM2A 2EV0A 3QU3A 3E6DA 3C3WA 5F64A 3R60A 3GFMA 3QAHA 2FA5A 3V7SA 4WF2A 1FX7A 3TDZC 4B8XA 4ZYDA 3I71A 1LDDA 1MKMA 3H92A 2Z3YA 5HLIA 2A61A 2KJBA 3KLOA 1R23A 5HDNA 1FYMA 2E1NA 3U9GA 4E70A 1LDKB 2TDXA 3ZPLA 5DCFA 1ZRDA 4ENKA 4OOIA 3NRVA 2ZBKA 1ZG3A 2ISYA 1RZ4A 1I27A 5BS6A 4KMFA 3J81Z 5AONA 4PCQA 2EJRA 5L3GA 3RIRA 3T5XA 4N9HA 4P9FA 2STWA 3BJ6A 1SFXA 1WQ2A 1XGOA 2IW5A 3HSEA 2M1BA 1K6OA 5EEGA 2FQ3A 5TRDA 3KZYA 4G9YA 2VC1A 5D8KB 2PI0A 3ML6A 4U7BA 2M45A 2A07F 3JAMZ 1T38A 2EFQA 1J5YA 4PZJA 1FLIA 3BWGA 2K86A 3OOPA 1ONVA 2BGCA 2NNNA 2PMUA 3KP6A 1OKRA 2MC3A 4ZYGA 3M1EA 5ILSA 4BYYA 3HTSB 3IWZA 1G3SA 4GYIA 2EA4A 4LB6B 3KETA 4WXDA 1FZPB 1U5TA 5HLHA 4ETSA 1TQPA 2Z99A 1V4RA 3GUDA 1LJ9A 3KEQA 4MHGA 1ZAOA 4HQEA 1OYIA 3WTXC 4M73A 4IRHA 2O03A 1R1VA 3R0JA 2Y48A 4HZFA 1U6GA 3GZ5A 2COMA 4WWCA 2DK8A 4NB5A 4A6EA 3J7AO 2FBIA 5LRSA 2JZYA 2K27A 3IKTA 4HW0A 3WTSC 3W6JB 1IW7F 2DBBA 3EYYA 3KCCA 4P9UA 4YIIA 4AIHA 2XKPA 5E1ZB 4A5NA 2ESHA 2BE5F 4ZYEA 4FHTA 4LMYA 4BAYA 5DEQA 4EMSA 3HOSA 3LA7A 5LHIA 4ZH4F 2XAQA 1FP2A 3SXYA 5HLGA 4LK0F 3RKXA 1XDSA 5FD6A 2VOOA 1HKTA 2HZTA 4Y13A 1FYLA 1Q1HA 4LK1F 2MH2A 1KQ0A 1FPQA 2XAJA 4XLNF 4YIFA 1K78A 4EGZA 5DUKA 1RI7A 2A69F 3WODF 4U0YA 2P7VB 3I59B 2DU9A 2EV5A 4WK8F 1ZREA 5LEKA 1DDNA 2HDCA 1G3WA 2HWVA 1OR7A 4KN4X 5AIQA 1LEBA 2RDPA 3U1DA 4MTDA 4G8XA 1NHAA 1CF7B 2KRFA 3JTGA 4KFCA 1XGMA 3T8TA 3E6CC 3GZ6A 4RAZA 3B02A 3ZQ7A 2H6BA 5JHUA 3V8LA 3KP5A 2P6TA 1QO0D 1QZZA 1GHCA 5ERIA 1G6NA 4OMZA 5A2QK 1OYYA 3E5XA 1R5GA 2Y0MA 2OZ6A 3GW2A 4G7ZF 3ZMZA 2EWNA 2OBPA 2XAHA 2EV6A 2FMYA 1HKQA 1FBQA 4KT5C 3K1MA 3RYRA 4RGXA 4EJTA 1IRFA 3F8CA 3FXRA 3R6SA 3R61A 2Q0OA 4IVNA 1W7PD 3HHGA 3E3VA 1IN4A 1O7LA 3BPXA 4L9JA 4ESBA 4I01A 1QPMA 1ZARA 2FBHA 1KQ8A 3F8FA 2YPRA 5LEJA 1XGSA 3RPQA 1XD7A 4YFNF 5LHGA 1SAXA 2D1VA 4LB5A 1JE8A 3VOEA 1HSTA 1I6XA 2O61A 1R1UA 2KIFA 2VBWA 1TNSA 1EH8A 3F72A 2YU3A 4HX4A 2PEXA 1BC8C 1W5SA 3R4KA 1SFEA 3DXJF 3RDIA 3TKYA 5BPDA 2NNYA 2WWYA 1IXRC 4FX4A 2RKHA 1BN5A 3C7JA 1XSXA 2E1CA 4L9VA 4ESFA 2RVCA 4OIQF 2GXBA 5H20A 1Y0UA 1QZYA 4Q4ZF 3TQNA 5K5QA 1ZG5A 1HXDA 1XN7A 3HHHA 3ZN1A 2IRFG 3DPLC 5J6XA 4BHBA 1SMYF 2ACJA 1PDNC 5D5UB 2WV0A 1ZYRF 1ON1A 1USSA 4AVPA 4ON0A 4EJOA 1MJBA 4CYDA 2EK5A 1KU2A 4A12A 5E18F 2A6HF 5IT3A 1Z9CA 4P5OA 1IAWA 4WXCA 3J81K 1C0WA 5CVIA 4IF4A 3FMRA 5DD8A 4KN7X 2VBXA 4HLYA 2CSOA 3L09A 2QUFA 1O3QA 4GYGA 3K0LA 3HSFA 1UFMA 1X3UA 3MZHA 5D5VB 2L02A 4EVIA 1B9MA 2EFPA 6PAXA 5A2QZ 2V6CA 4L5IA 3JAMK 3E5QA 5F1RA 3F6OA 1ZH5A 2PQ8A 1S6LA 2E7XA 3V8KA 4M9ZA 3FHZA 2PLYA 3IL2A 2XAGA 4NHJA 4M74A 3JTHA 2JT1A 1FOKA 2OAZA 3EDPA 2FBKA 4UNOA 1XSDA 3KP3A 2QBYB 2QVOA 3T8RA 2KJCA 3CUQA 2HYGD 2L01A 1JGSA 4O5VA 3KLNA 1IXSB 2F5CA 1YIOA 1J75A 2GQQA 1IZ1A 4UVBA 4CO8A 2MLKA 1FSEA 4HBLA 2VBZA 2P5KA 3EYIA 1UHMA 2MLGA 1J9IA 1KYWA 3HOTA 5E1XA 3BOQA 2CGPA 5H6QA 1P6RA 2LKPA 2UXNA 2B0LA 3EQLF 2ELHA 2RGVA 2G7HA 3CLOA 1DUXC 1MZBA 4KUMA 4EGYA 3BROA 2ZMEB 4KNYA 2EFWA 1PUEE 1WI9A 1SD7A 2M8EA 1D8KA 3GX4X 3WTZA 3C18A 4M6YA 2PN6A 1MD0A 3KEOA 1KQ9A 4A0ZA 4EJWA 1HW5A 1S7OA 3LWFA 4Y17A 1HW1A 2QYOA 4RGRA 2PJPA 1ZGAA 4I02A 3G3ZA 1P4AA 2GIVA 4XLPF 2HKXA 4LGWA 4HOBA 4RB0A 1TNTA 1KYZA 3RTRA 2QQAA 5ICCA 5DCMB 3GFJA 4PGGA 3ABTA 5ICGA 3PQKA 1BOAA 2ZFWA 1P4XA 2VXZA 1PP8F 3CDHA 5CVRA 3IHUA 2HYFA 2UXXA 3I54A 2IP2A 4A0XA 1FC3A 3WTUC 4OIRF 2LSOA 1AWCA 1LEAA 3BP8A 2KIUA 2D2WA 3FM3A 2QM3A 4IJAA 2YSRA 2FOKA 1YLFA 1U3EM 4HDVA 4OIOF 3F6VA 3O6BB 3MEXA 5JVTA 4BNCA 5E1WA 4M6XA 5ICEA 3F3XA 4M9XA 1ZLJA 1ZN2A 1O3SA 1KA8A 1BBYA 5LGUA 3ZMUA 2D1HA 1H9TA 3K1PA 3V7RA 4U7DA 2FMLA 3DEUA 2DQLA 2IT0A 3ABUA 2FXAA 2O0YA 2BEOA 2XROA 3IRQA 1XDUA 3K9TA 4HDUA 1SD6A 4OINF 4A0YA 3ROUA 5L3FA 2A5YB 5K5OA 3L2CA 3CUOA 4G6QA 2V79A 2YX4A 1W4MA 4BHCA 5K5RA 2VT2A 2V1DA 3NQOA 3B73A 3I64A 4ZYHA 4BQAA 1RNLA 2FNAA 1TQIA 2HFHA 4ESJA 1ZG1A 3KE2A 2LNBA 1S7AA 3SZTA 1MGTA 4A2UA 1MDMB 4L18B 3Q5FA 4ZZDA 2OD5A 5ILVA 2ZJ2A 4LG0B 1XB4A 4KIGA 2UZKA 4UV9A 1K79A 1BIBA 2P8TA 3ULQB 2PMHA 3P7NA 3QPHA 2J5OA 2P5LC 5CJ9A 1G3TA 3WU1B 2HEOA 4CGZA 3QRFF 1W7PB 4GXOA 5FFZA 1SD4A 2CWEA 4MQVA 2MBFA 2QQ9A 3CTAA 4N0BA 4UVCA 1U5TC 1O3RA 2R7DA 5HDKA 1GXQA 1DPUA 4KMUX 2A68F 1EV7A 4CXFA 2IA2A 3GYHX 4OIPF 5L3EA 4HF2A 3U2RA 1HQCA 4UVAA 3CO6C 1EH7A 3MZYA 1UHWA 3VFZA 2DFIA 1HW2A 1DPRA 4RS8A 1FWZA 4Q48A 2VE9A 1BJAA 4LLGF 1O57A 4U0WA 2XKOA 5CVUA 2AS5F 3JSPA 3H3UA 5BMZA 2VT3A 2L3DA 4XBFA 4G6DA 3D0SA 2A3SA 5FLXZ 1LNWA 3KFWX 3N4MA 1Z05A 4A6DA 3GFLA 3I53A 1KU3A 3BPVA 3LA3A 2BYVE 1TW3A 3WTVC 1QBJA 1HKSA 2OQGA 5FO5A 3K1NA 3REOA 2HGCA 2FF4A 1H9GA 1F9NA 1ODDA 2YR2A 2MA3A 2HS5A 3OV8A 2EA2A 2KIMA 3O2PE 3E5UA 1T98A 2HOEA 4IRGA 1J0RA 4UHTA 3F8BA 4GO1A 2QENA 1UB9A 3RJPA 3DPTA 2HR3A 3TO7A 5ILUA 3ECOA 3EUHA 1S8NA 2NAZA 4YG2F 3Q9SA 3L00A 3M8FA 1QQIA 3KP4A 2CFXA 3M9AA 1R00A 1YFHA 3E6MA 1RUNA 1ZHFA 5BOXA 4R1HA 3V4GA 2OU2A 3C1DA 4CZZA 2STTA 1HBXG 2H09A 4I0BA 1WSUA 3LAJA 4HF1A 3VEPA 4Q5SF 4I0AA 3QP6A 1YS6A 3HSRA 3I58A 1GXPA 2XV4S 2JTVA 5LGTA 5D5XB 1SFUA 3L9FA 4LJZF 2OA4A 4I98B 1BM9A 3SZPA 3E97A 1KU7A 2ESNA 1U5TB 1S29A 4HX7A 5LGNA 1J7KA 2ZKZA 2QQBA 2DPDA 4DQ2A 2L4AA 4NQWA 4G7HF 1YO5C 3F8NA 2Z5UA 4MQ9F 5D4RA 5J8FA 2E7WA 3ZP5A 1YW7A 3I5UA 3RI4A 1CGPA 3L7WA 1ZRCA 2Z9OA 4P96A 3ZMSA 2J5PA 1LQ1A 4ENNA 1RUOA 5HDGA 2W85A 4RB3C 2HKOA 4L0YB 3I0TA 4IHTA 5KK1A 2XASA 4UXNA 3Q9VA 2HQRA 1IN6A 4L9NA 2NRAC 4TV7A 4RB1A 2HQNA 2DW4A 1HSJA 3HUGA 3BJOA 5FD5A 3TOBA 5EEHA 1DP7P 4JBAA 4PDKA 2V9VA 3DKWA 1FBSA 4ENJA 2FSWA 4XSZF 1TTYA 1OMIA 5HS7A 1EH6A 5D6FA 5HVQC 2K4BA 3RKWA 5LBQA 3TO6A 3HRSA 3TO9A 2W84A 3CO7C 5HS9A 1F4KA 1IN7A 2HTJA 2OQRA 1K78B 3VB2A 1OYWA 4Z2YA 4KIFA 1IRGA 1YW8A 2Z33A 3DQVC 2MH9A 1U8RA 3WE3A 4CHUA 4AIJA 5L3CA 4HA8A 1G4DA 4IPAA 3BJAA 3LQRA 2LF7A 3SQNA 2CQKA 5HS8A 2Q2EA 2X4HA 3ISPA 4HV6A 3ZMDA 1Z6RA 3I59A 1I1GA 1BI2A 2HTSA 1ON2A 1R58A 2VE8A 3LQQA 4R8HA 3PFIA 1P2FA 1V3FA 3MQ0A 2FRHA 2IA1A 4D0PA 1QNTA 2IA0A 2IJLA 4BH9A 1O7FA 1R5HA 2C6YA 1BI3A 1CF7A 3AAFA 1ZLKA 2ZNZA 5LHHA 1TQMA 2Q8KA 5JI6A 2FEZA 3WTYC 3HTUA 3P9KA 2VC0A 2MD5A 4WCGA 4Y15A 5AIPA 2FE3A 2RN7A 2RNJA 2DI3A 1K7AA 2DO7A 1J59A 1Z6TA 1YG2A 1R36A 3GVAA 5L3BA 4UV8A 1Z91A 1E17A 2M30A 4S05A 4LLLA 3NEUA 4U0VA 3TDUC 2ADUA 3VODA 3P9IA 3J80Z 1YQAA 1FBUA 3KP7A 1IN5A 4EM0B 5CLSA 4A5MA 1YYVA 2CO5A 3BY6A 4MGRA 4LD5A 3LSTA 4L5JA 5FLXK 5FGMA 3HRMA 3H3ZA 3RYPA 4EM1A 3WU0A 1WRJA 3IC7A 3LA2A 2PFBA 4MEYF 1P92A 4LLNA 4HX8A 2CW0F 5E17F 2OZUA 4B09A 3CJNA 3WG9A 1XCBA 1STZA 2DK5A 1FSHA 3SHFA 1R22A 1P4WA 2JPBA 1TLHB 2GA1A 2M87A 1TBXA 1FYKA 3MCZA 2L4MA 2ZO4A 4WX9A 2F5DA 4RAYA 3WGHA 2X0LA 3K69A 1T6SA 3K2ZA 2P4WA 2F5FA 4LFUA 2H27A 3FX3A 3PQJA 4G94A 2O3FA 4KIBA 1U78A 1ZGJA 1KGSA 1B6AA 2JRTA 4L9TA 5LLQA 3FZVA 4HV5A 2XVCA 4H0EA 2P6SA 3DF8A 1D5VA 2BV6A 3BZ6A 3EETA 4N9IA 4UUVA 1XSVA 3TOAA 2H6CA 3P9CA 1B1BA 4L0ZB 1RIOH 2DPUA 3FMQA 3F23A 1E2XA 3G73A 1QGPA 4XRFA 2RC4A 3MWMA 4HYEA 4O3MA 1GVJA 5DYMA 4OU0A 3MAJA 5D8LB 4I2OA 1SD5A 1I1SA 3QP5A 3FMSA 1F1ZA 1UCRA 3FXQA 5DV5A 2GZWA 4YFKF 3CUQB 3F21A 1FY7A 3IRRA 4U88A 4AIKA 4HQMA 4EJVA 2NYXA 1FP1D 1LDJA 1VTNC 3LFKA 4QLCU 3ZN0A 2V1XA 3RPUA 3IKVA 2DTRA 1IF1A 3ECHA 2QBYA 2WC2A 2IPQX 2LDUA 1T2KA 3DV8A 1B9NA 1I5ZA 3JW4A 4F7ZA 2AXLA 2RV8A 3V8JA 1YW9A 1Z1DA 3QU6A 5ED4A 3DP7A 4KDPA 1A04A 3GO5A 1IUYA 3M8EA 1WWXA 4PGHA 3F22A 1BI0A 2VBYA 4RB2C 5IT9K 1BIAA 1F5TA 1ZRFA 3GXOA 2VODA 5JFRA 2ZMEA 4RGUA 3FM5A 2W57A 3D5LA 4M71A 2P7CB 3N97A 3W6KB 2VONA 3ZMVA 4HAMA 4IRIA 4FT8A 1FT9A 4CICA 1OPCA 3S2WA 3T1BA 1JHFA 2G9WA 2G7UA 2H94A 2ZCWA 2GA2A 1YTYA 2K02A 2FNPA 1R1TA 1ULYA 5DCMA 4WXHA 4RGSA 4IXAA 2L54A 1D3YA 2XUBA 4HF0A 4MTEA 2QZ8A 4EQQA 3MFKA 5J8CA 4ENMA 2YX7A 4BXUA 2LF8A 2EFNA 4ASNA 4M72A 1B59A 1BC7C 2ZNYA 2PBIA 1BI1A 4Q47A 1REPC 5H6RA 4R79A 1AOYA 5BPIA 3FXUA 1G3YA 2P5VA 3TGNA 1XCVA 2ISZA 2ZXJA 2DQRA 2QWWA 2V1UA 3WGIA 1L3LA 1TW2A 5K1YA 3F8MA 5LRRA 2DAOA 4BHPA 3O3KA 1O3TA 2GWRA 3ERED 2W24A 1XGNA 1B4AA 4KA4A 1YS7A 4JK1X 2D45A 1MJ9A 2K4JA 3R0AA 4I09A 2W25A 1JXSA 2GAUA 3T0YA 5CVVA 4ZZLA 1USTA 3FWEA 1XMAA 3GEZA 4HLXA 3WGGA 3SFZA 2O8XA 3QOPA 2DLLA 1W5TA 1PP7U 5JR3A 4GGGA 2F2EA 1WKMA 5D6EA 5TJJA 3WE2A 5BQTA 3BDDA 3COAC 2GXGA 2R7FA 1FNNA 2EFOA 4DNCA 3J80K 2NS0A 3JSOA 3KP2A 2KKOA 5IT9Z 4JQFA 1L0OC 3V7CA 2Y75A 3IWFA 1T0FA 1U2WA 1SMTA 5ICFA 3HRTA 1H0MA 1MDMA 4QWQA 4LG0A 3E6BA 5KVRA 1IXCA 2K7LA 5CYVA 4KYWA 2CG4A 3RKYA 5L3DA 2BBYA 2XAFA 4AD9A 2JPCA 2DT5A 4G7OF 3ZMTA 1J2XA 5D4SA 1R7JA 3WTWC 1W7PA 3HYIA 5DDGA 4GCVA 5FB2A 1JHHA 2EB7A 3M7GA 2WTEA 3GWZA 1KU9A 4M9SA 2R3SA 2UWMA 3LAPA 3GLXA 4I7HA 2QLZA 2PG4A 2VN2A 4IHSA 5DD4A 4OMYA 4FX0A 3KZZA 2XRNA 4KICA 3WTTC 3GFIA 1S3JA 2CYYA 4MEXF 1IN8A 4EJUA 4K2EA 1D8JA 1T39A 2RQPA 2VOPA 2XHKA 3HIFA 1XMKA 2XIGA 2A6EF 4XSXF 3GF2A 2IVMA 2FU4A
chains in the Genus database with same CATH superfamily
5DUIA 4JYAE 2LVHA 1MJAA 1JGGA 1N33E 1XPXA 2L9SA 4O6JA 5HOOA 1IV8A 2V87A 5E20A 4CDGA 1LVAA 3RSNA 2DODA 1FJGE 3K4LA 1BA5A 3V42A 1G8XA 3ZQIA 4EV0A 1YSAC 3DCFA 1UELB 3CDIA 1X47A 2HDDA 4LFBE 4AWXB 1ZR4A 4J8ZA 5FFXA 3H9GA 2JSCA 1EF4A 4YFXF 3G1OA 2DJIA 1LB2A 4S04A 1NK2P 2IGOA 2XGCA 4PSWA 2V9KA 1BW5A 5IV8B 4P55A 2FX0A 2ETHA 2ZJRF 2EZLA 3QPTA 2EPAA 5JVGF 2M5WA 4CUGA 4Q28A 4F6NA 4MNUA 3X2QH 3FF5A 3K7AJ 5E8IA 5CVJA 5FROA 5D5WB 1K4SA 2L3CA 3HRUA 1Z7UA 2CT1A 5A69A 5T6JA 2L3JA 3CUQC 3HGYA 2O6GE 1STUA 5M5WJ 2KOUA 5E8GA 5FLXC 4NXME 2EPZA 2XGXA 2F5EA 3DFGA 3I4PA 5F6FA 1ZAAC 3ELKA 4JI7E 4EM2A 4G6TB 2QCOA 1VQ7I 2EV0A 3QU3A 3GTMJ 3QODA 3E6DA 4X9JA 3C3WA 5F64A 1YHQI 3R60A 4NNJA 3PSIA 1K83J 3GFMA 2FA5A 3QAHA 2NXNB 3V7SA 4WF2A 3CMAI 2WAFA 1FX7A 4NHRA 3TDZC 4B8XA 1JT0A 4HNUA 4QPOA 4ZYDA 2NS7A 3CESA 3I71A 5FRNA 3S2DJ 1LDDA 1MKMA 1JUMA 3H92A 1QA6A 2QSGX 2Z3YA 5HLIA 3MN2A 2A61A 2KJBA 1M1EB 3THNA 3KLOA 2F6CA 2KFDA 5IP9J 4CYCA 2DGCA 1R23A 5HDNA 1FYMA 2E1NA 3U9GA 3IWDA 2R4GA 2M8GX 4E70A 2UUBE 1L4SA 1LDKB 2LREA 3UK3C 2TDXA 3I9V2 3ZPLA 1R4MB 5DCFA 2VKEA 1F36A 2EMAA 1ZRDA 2NUEA 4ENKA 3DTIA 4OOIA 1WH7A 4YY3E 3NRVA 2ZBKA 2L0KA 1ZG3A 3JTZA 2OPTA 2ISYA 2WY8Q 5TSEA 2DA7A 1RZ4A 4H4KC 1HNZE 3A01B 1I27A 1N34E 2YT4A 2F4MB 5BS6A 2L9VA 4KMFA 5GAEJ 3J81Z 5AONA 4PCQA 4XQFA 2EJRA 2CQXA 5CKTA 5L3GA 1ORKA 3RIRA 3T5XA 4JI2E 3AL0B 1JUSA 4BCAA 4N9HA 4P9FA 2DT6A 2STWA 3HL2A 3BJ6A 3VDXA 3FKIJ 1SFXA 1WQ2A 1XGOA 2IW5A 3HSEA 4E7KA 4F9AB 2M1BA 1K6OA 1MMAA 1K61A 3A2KA 5EEGA 2FQ3A 4BGDA 3PNVA 2CV2A 5TRDA 3KZYA 4G9YA 2VC1A 5D8KB 2PI0A 2HGHA 3ML6A 1P7IA 2O9LA 1YYOA 4U7BA 2M45A 2A07F 3JAMZ 2EINH 1T38A 2DIXA 1D0YA 2EFQA 1J5YA 4PZJA 2YTGA 1FLIA 3BWGA 2K86A 1YRNA 2X6YA 3OOPA 1ONVA 4JOMA 2BGCA 2NNNA 2EPUA 1MNMC 2PMUA 2VXDA 2EPPA 3KP6A 1OKRA 2WAQN 2MC3A 4ZYGA 3M1EA 1N77A 3CQZJ 5ILSA 4IJDA 4AVZA 3RZDJ 4RBOA 3OYCA 3JRHA 1W0UA 5FRMA 2EN8A 3MSWA 5E3OA 3BTIA 1TWAJ 1ZKGA 3ONQA 3UR3C 2TRTA 3IWZA 2ZXWH 1G3SA 4BYYA 3HTSB 4OAZA 1A1IA 5J1YA 4GYIA 1X1DA 2EN4A 2EA4A 2EN3A 4LB6B 4AYBN 3M99B 4BE0A 4NQWB 3PO2J 2DA3A 4E7LA 3KETA 2CH0A 4WXDA 2YU9J 1FZPB 1U5TA 1ENHA 3C2GA 5HLHA 4FCYA 4IS1C 4ETSA 4B4CA 1I3AA 4DMIA 2EPOA 3LNQA 1TQPA 2Z99A 2EM3A 1V4RA 2FOWA 3GUDA 1LJ9A 3KEQA 4MHGA 2MDRA 4E6KG 3IWCA 1D1CA 1ZAOA 4HQEA 5EDNA 3J7YJ 1I3QJ 1IBME 1OYIA 2CUJA 2X9DA 3WTXC 5IYCJ 4M73A 4IRHA 4A3LJ 2O03A 1T4OA 2X51A 1XS9A 2KIQA 2KHXA 1R1VA 4XKWA 3R0JA 1MBJA 2Y48A 1MH4A 4XMYA 4HZFA 4E7SA 2L9RA 4D9JA 4F55A 3C4BA 4BMJA 1U6GA 3PIOF 1WJBA 3GZ5A 2IS1A 1W1WE 1YYKA 2COMA 4NC6A 3M8JA 4WWCA 2DK8A 3I4MJ 2DLQA 5A6AA 1GV2A 1KYQA 4NB5A 3K4BA 4A6EA 3J7AO 1RMDA 2LC2A 2JVGA 2WB1A 2FBIA 2DXIA 2XGEA 2JZYA 5LRSA 3CDLA 4YHHE 3QPSA 1P47A 2K27A 3HUGB 3VSLA 5J47A 3IKTA 1T08B 1DQUA 2KDZA 3CMEI 4HW0A 3WTSC 1UHZA 2LUQA 3A1YA 5DM6F 1X6HA 2X6WA 2FTXB 3W6JB 4I99C 1IW7F 1KONA 2DBBA 3EYYA 1WPKA 4IKFA 3HOWJ 1LUJB 3KCCA 4LIUA 3GTGJ 4P9UA 4YIIA 2B7VA 1OCCH 3S3MA 4FK5C 1A1FA 4AIHA 4JI1E 2XKPA 5E1ZB 2V4JC 5DNYA 3THOB 5FKKA 4A5NA 1AA7A 2ESHA 2BE5F 4IQJA 3GZNB 4BEHA 4ZYEA 3P5JA 4FHTA 2E72A 2FJ1A 3FIWA 4LMYA 2LVSA 2P81A 5DEQA 4BAYA 4EMSA 5E3NA 2R7VA 3HOSA 3LA7A 3ABMH 1FMVA 2KPMA 1KZHA 3OYIA 2LBFA 3FBNB 2JMWA 5LHIA 4ZH4F 2GLIA 2XAQA 1FP2A 3SXYA 3AKZA 4JI8E 5IT9C 4A3KJ 5HLGA 4I8OA 1X1PA 3HC7A 4LK0F 2R7TA 3QYEA 4M3FA 1X6FA 3FDYA 2FGGA 3RKXA 1XDSA 5FD6A 3QYFA 2VOOA 2V86A 2JVHA 2COBA 2HDWA 1PJRA 2VIXA 1HKTA 2EN1A 1Z67A 2GIZA 5KL6A 3JCUC 3MKWB 4WSPA 4IHVA 2W00A 3EPHA 3DTEA 5F0HA 1FMWA 1H88C 1WH5A 1O0WA 2HZTA 4Y13A 2X1DA 4N4OB 2NOGA 2ZXIA 1Q1HA 1VQMI 1FYLA 4LK1F 2NVQJ 3RCOA 2MH2A 1KQ0A 2HQAA 1FPQA 5F08A 4DV6E 1TZLA 1LE8B 4BE1A 4LF6E 2XAJA 4L5NC 2M7AA 2EPMX 3CMMA 4XLNF 5AE1A 4XR6A 4YIFA 2HC5A 3E0JB 1K78A 4EGZA 3H0DA 2K9NA 5DUKA 2Q2EB 1RI7A 4GKKE 2A69F 2KRHA 4BBRJ 3WODF 1UZCA 4P1WA 4U0YA 1NG7A 2P7VB 3I59B 2DU9A 4UB6C 3C6MA 1J26A 2EV5A 1ETWA 4WK8F 2ID6A 1ZREA 5LEKA 2VJIA 2CMPA 1OISA 1DDNA 1G3WA 3CCLI 2HDCA 2HWVA 3H3VK 1OR7A 1MBHA 4KN4X 5AIQA 3ZXSA 1LEBA 3HOXJ 4M30A 2E34A 2O5RA 4JYKA 3IH3A 3S1MJ 3ERMA 4F92B 5K7HA 4P7DA 5J40A 2RDPA 3JRGA 3U1DA 1AAYA 1PJSA 3S17J 1GQEA 1OJLA 4MTDA 2EL5A 3K6QA 1I94E 3M3YJ 4G8XA 4ZDOA 3G71I 4NXNE 3TBIA 1FOYA 1BOBA 1NHAA 4CH7A 2DCEA 2IGKA 1B72B 1CF7B 2KRFA 4A69C 1WZ2A 3JTGA 4KFCA 1LFBA 4W97A 1PJTA 1XGMA 2LRSA 3T8TA 4O43A 3GTPJ 1FOWA 3E6CC 1N3GA 2YTEA 1X1BA 5C4XJ 3GZ6A 4RAZA 5C3EJ 3B02A 3TP0A 5CQGA 3H9QA 3ZQ7A 2H6BA 2V89A 1R49A 2BY1A 5JHUA 3ZR8X 4DYRA 3V8LA 3VSKA 4LIVA 3KP5A 2P6TA 4XLAA 1YX3A 1QO0D 1QZZA 2M9HA 1GHCA 4DR4E 5ERIA 2HPMA 3WG7H 1G6NA 2VJ4A 2E71A 4OMZA 2K40A 2M2EA 4HEA2 2OJED 3RMPA 4R2PA 3VPRA 1X4OA 2XF7A 5A2QK 1OYYA 3E5XA 1R5GA 2XB5A 2JWOA 2Y0MA 3I3LA 1SVOA 2OZ6A 4BC9A 2KLOA 1A31A 4D7MA 4PJNA 2VKHA 3EUAA 3GW2A 4G7ZF 2M4KA 2DFHA 3ZMZA 2R5YA 5HODA 1SR9A 4PSXA 2EWNA 2OBPA 2XAHA 2DT7B 2EV6A 4X66E 2CJJA 3L1PA 2X48A 4CCKA 2DLKA 1IRXA 2FMYA 1HKQA 1VI0A 1FBQA 4KT5C 1N32E 3CCMI 1ETXA 3K1MA 3RYRA 5B66C 2R76A 4RGXA 4EJTA 2QKMB 3S8PA 4BXFA 1IRFA 3F8CA 3FXRA 4W1UA 3R6SA 3R61A 1ACIA 2CW7A 2Q0OA 4IVNA 1AKHB 1W7PD 3HHGA 3E3VA 1IN4A 3BG3A 4XLFA 1O7LA 5LFAA 3BPXA 2TCTA 2F4OB 3U1KA 4L9JA 3K4KA 4ESBA 4I01A 4IO9F 1QPMA 1ZARA 1QVUA 2FBHA 3RQIA 1KQ8A 3C4TA 2R5ZB 2FQ4A 2L6MA 3F8FA 3OYFA 2YPRA 2M1SA 4QIWN 1Y8QB 4EEFG 5LEJA 4A3GJ 1XGSA 1I6HJ 4PJLA 4L8NA 4LTYA 4DOZA 2UU9E 3RPQA 4TUIA 1XD7A 1D5YA 2FV4B 2H1LA 2ZMEC 4A3CJ 2UXDE 4YFNF 5LHGA 1SAXA 2D1VA 4LB5A 3CD6I 1JE8A 4BBSJ 1UILA 1OFCX 2UUZA 4ZYAA 3VOEA 1HSTA 1I6XA 4XKBA 5E79C 2O61A 1R1UA 2KIFA 2YTNA 4DR7E 2VBWA 1TNSA 2VLAA 2X1EA 1EH8A 3F72A 3HKZA 1T8IA 2YU3A 4X8WA 4HX4A 2PEXA 1BC8C 1IMUA 1ZR9A 4WPYA 1W5SA 2W7NA 3J80C 4DV7E 3R4KA 4CCOA 2EOJA 1HNXE 1MMDA 1SFEA 2MD0A 4HSTA 3DXJF 3RDIA 2QGUA 3TKYA 5BPDA 2NNYA 2WWYA 1R5ID 2BXZA 4F93B 4J01A 4IHXA 4FETA 4A3EJ 3DBHB 4ITVA 1Y1WJ 4FQGA 3TMOA 3HOUJ 2LH9A 2B3TB 4A3JJ 1IXRC 4FX4A 1OCTC 2RKHA 2EMFA 3K10A 1FEXA 3W2AA 5EF6A 1BN5A 3C7JA 2EIKH 4B3TE 4A93J 1XSXA 2E1CA 3RKQA 4L9VA 3G6EI 5CFFE 4ESFA 2RVCA 4OIQF 2GXBA 5H20A 1Y0UA 1QZYA 1ZK8A 4Q4ZF 1T4LB 3TQNA 4RA2A 4K0KE 2EPNA 2EM0A 5K5QA 1ZG5A 1XNQE 1R71A 1HXDA 1XN7A 5IWAE 2F4VE 2NVXJ 2EILH 3HHHA 1BW6A 3ZN1A 2IRFG 1A1GA 5GTHC 1T56A 3DPLC 5J6XA 2QEXI 3HOZJ 2LTRA 4BHBA 1SMYF 2V9PA 3CLQA 3IAM2 2IBDA 4MO7A 2ACJA 1QU6A 1PDNC 3A4CA 5D5UB 2WV0A 1FJLA 1WHUA 1ZYRF 5E3LA 1SFOJ 1ON1A 1USSA 3FKJA 4AVPA 2VL8A 3K70D 3BIDA 2LJHA 2UUCE 5FKLA 4ON0A 4EJOA 2VJJA 2MSYA 1MJBA 3VHTB 4HSRA 4R2EA 4CYDA 2HXOA 1X5WA 4MLQA 2RQQA 2EK5A 2L2MA 1KU2A 4A12A 5E18F 2A6HF 4BJ5C 5IT3A 2V85A 3MD2A 3H5RA 4XLHA 1ETVA 1YPNA 1Z9CA 4P5OA 5EGOB 3ZQHA 5B5EC 5TISC 1LVKA 4WXCA 1IAWA 4PJMA 3J81K 1SAUA 2DMUA 2EMBA 1C0WA 5CVIA 4IF4A 2EQ3A 3FMRA 2R1FA 2DMNA 4R2AA 5DD8A 3SYTA 4UY8I 4KN7X 2VBXA 4HLYA 2CSOA 3L09A 2QUFA 3FK7A 4GYGA 1O3QA 2E2JJ 1ERDA 3K0LA 3HSFA 5BNGA 2GLOA 3MMYB 2WV1A 3CJTB 1B8IA 1UFMA 2L7KA 1X3ZB 2YTIA 4FE7A 1X3UA 3MZHA 2WCC3 1WXRA 5D5VB 2L02A 3HQ1A 4EVIA 2X6XA 4BXXJ 1NCSA 1B9MA 2EOIA 2EFPA 6PAXA 5A2QZ 3HOYJ 2V6CA 4L5IA 2E1MC 2M0CA 4B44A 3JAMK 3CC4I 3E5QA 1MEYC 5F1RA 3F6OA 2ZB9A 1ZH5A 2ECBA 2PQ8A 3QQAA 1F2IG 5GAGJ 4Y7NJ 4M3DA 2EQ0A 3ASOH 1S6LA 3S3NA 2E7XA 2JWTA 2XSDC 3V8KA 4M9ZA 3FHZA 2PLYA 3IL2A 1VFCA 1S7EA 1DQ3A 2XAGA 1HC8A 3NWSA 1PUFB 3IAS2 1Q1VA 4NHJA 5B3SH 2WBMA 4M74A 3JTHA 2EMYA 2JT1A 1FOKA 2OAZA 3U21A 3D5RC 5EG0A 2JPAA 4A3MJ 1SFKA 3EDPA 3BLYA 2FBKA 5EYRA 4UNOA 2ZSHB 1XNRE 4B1RA 3VYXA 2W4SA 2EM4A 1XSDA 3KP3A 4CCLA 2Z16A 3OIPA 2QBYB 1IQSA 2QVOA 3T8RA 2KJCA 2F8BA 3CUQA 4XRSG 2HYGD 1BBGA 4E7HA 2L01A 1JGSA 4O5VA 2OF7A 3KLNA 2EL6A 3OSGA 5F3WA 1IXSB 5J4YA 1I50J 2F5CA 3ADIA 1YIOA 1EA3A 1RKWA 2I5UA 5GTIC 1J75A 1FKAE 3JU0A 5AC5A 2GQQA 1IZ1A 4UVBA 4CO8A 4O24A 1T0FC 3FBIB 2YRMA 3T1YE 2MLKA 1FSEA 4HBLA 4LF7E 2EOQA 2VBZA 2VI6A 2P5KA 1MBGA 1G2FC 3EYIA 1UHMA 2MLGA 1J9IA 1KYWA 2EORA 3HOTA 4HPQA 5E1XA 4LFAE 3BOQA 2CGPA 5H6QA 3BG5A 2DA6A 1A36A 1OCOH 4WFTA 1DGRM 2JUGA 2KHMA 2AQFA 2Y30A 2EMHA 1P6RA 2LKPA 2UXNA 3OYBA 1YIJI 2V83A 2B0LA 1WJEA 3EQLF 4DW6A 2ADRA 2ELHA 2RGVA 3LSJA 2G7HA 1APLC 4PUSA 3CLOA 1DUXC 1MZBA 4KUMA 3GMEA 4EGYA 2QSFX 3BROA 1AU7A 2FUG2 2BHZA 2ZMEB 4KNYA 2UXCE 3SFIA 4RAFA 2EFWA 1PUEE 1WI9A 3S32A 1SD7A 2M8EA 1A1HA 1D8KA 2XPVA 3GX4X 3WTZA 2N3HA 2ZSIB 3C18A 4M6YA 3HG9A 1TT5B 3OYGA 2E2HJ 2PN6A 2RAEA 1MD0A 3W6VA 5BR8E 2YRKA 2ODRD 1UN6B 4RM3A 1MNDA 1KQ9A 3KEOA 4A0ZA 4EJWA 3VYYA 1HW5A 1S7OA 3LWFA 4Y17A 3FXMA 1HW1A 3KPHA 2WAQA 2QYOA 3FXLA 4BJTA 4RGRA 5K7ZA 4BQQA 2PJPA 4BY7J 1ZGAA 1DP3A 2HXIA 4I02A 1X3WB 3G3ZA 4WYQB 2GPIA 4AYBA 3A02A 1P4AA 2GIVA 4XLPF 4GDFA 2HKXA 2PMZN 1ITYA 2KT0A 1NEIA 5ADZA 4DJAA 4LGWA 5A6KA 5IPAA 4R2QA 4HOBA 4RB0A 1TNTA 1KYZA 1Z1BA 3RTRA 2QQAA 5ICCA 4Y33A 5DCMB 2LD5A 2OC6A 3F9KA 3HXLA 3GFJA 4PGGA 3ABTA 2NVUB 5ICGA 1HLVA 1D0ZA 3PQKA 1BOAA 3HGGA 4YIRX 2ZFWA 1P4XA 3B6AA 4RLQA 4DBRA 2F5VA 2VXZA 3LMMA 1PP8F 3CDHA 5CVRA 4C9YA 3IHUA 2HYFA 2EM2A 1Y39A 2H8WA 2VQCA 1TC3C 2UXXA 2HNHA 3L2QA 3VK6A 3LOCA 3I54A 2IP2A 3BC8A 1FC3A 4A0XA 2KZGA 3WTUC 2VASA 1PYVA 3LSIA 5TGTA 2DA5A 2LSOA 4OIRF 5J1RA 1LEAA 1AWCA 1VQLI 3BP8A 2ELYA 1ZQ3P 4U87A 4PJ0C 3CCQI 4CCJA 2KIUA 2D2WA 4II3A 2GHFA 3FM3A 2QM3A 4IJAA 5B1BH 2YSRA 3JRBA 2E19A 3PM1A 1P7JA 2EP3A 3MHSC 3Q3SA 2M4IA 2FOKA 5FKOA 1YLFA 1U3EM 4HDVA 2L8TA 1S9HA 1U9OA 3MZ8A 1Y6IA 3OS1A 4OIOF 4HTGA 1OCZH 1Z0XA 1U9NA 3F6VA 4BU2A 2NUGA 3O6BB 1DGCA 3MEXA 5IP7J 5JVTA 3OY9A 4BNCA 2YSPA 5E1WA 1MBKA 2XC7A 3HEFA 4MLVA 4M6XA 2OTJI 3KZIC 5ICEA 4BJ6C 1LKXA 1WJDA 3F3XA 5LD2C 3OMLA 4M9XA 1ZLJA 2VQFE 1ZN2A 3CCYA 2PJRB 5KL5A 1O3SA 1KA8A 1BBYA 5LGUA 2EMIA 3ZMUA 5KNLA 2E1MB 2D1HA 5H2FC 3K1PA 1H9TA 2WBTA 2IGMA 1ZGWA 1ETKA 3V7RA 2DFEA 4U7DA 4KISA 4B3RE 2FMLA 1G59A 3CF5F 2KONA 3DEUA 2DQLA 2IT0A 3ABUA 2FXAA 4II2A 3CJQB 2V6EA 2O0YA 2XDVA 2BEOA 2K9SA 2XROA 3IRQA 1XDUA 2EM8A 2RSMA 3K9TA 1BBOA 4LG3A 4HDUA 1SD6A 4OINF 4A0YA 2M4GA 3ROUA 4ANJA 5L3FA 1V54H 1JKQC 1WHNA 1IV6A 3K4JA 1IJWC 2A5YB 2L7MP 3ZQCA 1E3OC 5K5OA 3NAUA 3L2CA 1OLTA 3CUOA 3OL3A 4G6QA 2V79A 4UUSB 4IHYA 2YX4A 2EOFA 1W4MA 4BHCA 1Z7LA 5K5RA 3JRDA 2B9DA 2MC6A 4A3FJ 3ADJA 2VT2A 2V1DA 3NQOA 3JREA 1VQ9I 3B73A 3I64A 4ZYHA 2VRDA 4XORA 3Q0UA 4BQAA 1MSEC 2JY9A 4LF5E 1RNLA 4YEJA 2HI3A 2FNAA 2RS6A 2XF6A 1TQIA 3E1SA 2HFHA 4ESJA 1ZG1A 3KE2A 1GLNA 3VWBA 2LNBA 1S7AA 3SZTA 4TUGA 1JKPC 2NVTJ 5KL3A 4IZZA 1MGTA 3PSFA 4A2UA 1MDMB 4L18B 3Q5FA 4Y52J 4ZZDA 1YITI 2OD5A 3J7AY 3N05A 5ILVA 2ZJ2A 4LG0B 1IC8A 1XB4A 3OS0A 2LE2A 4KIGA 2UZKA 4UV9A 5IY5H 2LFBA 1K79A 2EPFA 1BIBA 3VYUB 2WBUA 2P8TA 3ULQB 2PMHA 1A6IA 3P7NA 3EPZA 3QPHA 2WZOA 4HNVA 2J5OA 3CCRI 2P5LC 5CJ9A 1G3TA 2EMCA 4PFOA 2RPCA 4ZTFA 3WU1B 3GTJJ 2HEOA 4CGZA 3QRFF 3UKGA 1W7PB 4GXOA 5FFZA 2EOXA 1SD4A 2CWEA 4MQVA 2MBFA 2QQ9A 1EJ9A 3CTAA 4N0BA 5KAFC 1N78A 4JI0E 4DYQA 2CSHA 1MBEA 3QYBA 4UVCA 1U5TC 1O3RA 1WJPA 2R7DA 5HDKA 2L92A 2XGDA 1GXQA 1UG0A 4KMUX 1DPUA 2BVMA 2NOJB 2A68F 1EV7A 1XX5A 2EIJH 1PVEA 2R7OA 5M3MJ 4CXFA 2IA2A 2V1NA 1SVMA 3GYHX 1QHGA 2XPUA 4OIPF 3BG6A 2GM4A 5L3EA 4RDUA 3H9JA 4HF2A 3OYNA 3U2RA 3BQZA 3CCSI 3ZQLA 1PKPA 3DJWA 1HQCA 4UVAA 1TL8A 3CO6C 1YZ9A 1EH7A 3MZYA 1UHWA 1ZR2A 1HOMA 1OQYA 2EOYA 3VFZA 3FK6A 2EZIA 5JHFA 3S93A 2DFIA 1HW2A 4A3DJ 1DPRA 2Q1ZB 2LRDA 2HZDA 4GRIA 4RS8A 4O4KA 3HPGA 3PO3J 1FWZA 2I9IA 3K2AA 4Q48A 5A2QC 1AHDP 3CP2A 3GTLJ 2VE9A 1BJAA 4LLGF 1X6EA 1X58A 1O57A 4HRIA 4U0WA 1IBKE 2XKOA 2R92J 2LLKA 1VNDA 3BCBA 3KX2A 5CVUA 2AS5F 2EMGA 3JSPA 5KL7A 3H3UA 5BMZA 3BR0A 2BW3B 2VT3A 2LY9A 3UNGC 2B9SA 2L3DA 2F48A 4XBFA 3M1CA 3IUOA 4G6DA 3D0SA 1TP4A 2A3SA 3TL4X 4CSWA 5FLXZ 2EPKX 2W48A 1LNWA 3KFWX 3N4MA 1Z05A 1T33A 2BHYA 2CRGA 4A6DA 2EOEA 3GFLA 4JI6E 2IAIA 1R9TJ 3MKLA 5EZHA 3I53A 4DGWB 1GT0C 1KU3A 3BPVA 2VPLA 3LA3A 2BYVE 3ZOQB 2EOHA 1TW3A 2BOLA 3WTVC 1QBJA 1HKSA 2OQGA 5FO5A 1X1CA 3K1NA 3LMLA 1VQ5I 1A1LA 2E35A 3MKZA 3REOA 2HGCA 1KJKA 4RHBB 1JJ6C 4RH8A 3G1MA 5F0CA 1YX5A 2NS8A 3AFHA 2DOFA 1RKTA 2FF4A 3NWTA 2G0EA 2IGNA 2ME6A 1W36D 1H9GA 3IH2A 1F9NA 2M7QA 1ODDA 2YR2A 2MA3A 3DEWA 3DU5A 3JR9A 4AM3A 2DSYA 2JYAA 3LSHA 2HS5A 3D5SC 4PJJA 3OV8A 2CUZA 2EA2A 2KIMA 3O2PE 4J19A 4BACA 1FTZA 3E5UA 1T98A 2HOEA 4IRGA 2Y9YA 3HM5A 2DTZA 1J0RA 4UHTA 3CF2A 1RQ0A 4IX7A 2E2IJ 2VJ5A 1WHQA 2DN0A 2Y9ZA 4MFEA 3F8BA 2EE8A 2H36X 2UXBE 4V2GA 4GO1A 2QENA 4CYCB 3J7AG 5HNFA 2CV0A 1XMQE 1UB9A 3RJPA 3DPTA 1LFUP 2HR3A 3TO7A 4BL0B 1VF9A 3VYSB 2B7EA 2CQ7A 4E7ZA 2JQ7A 5ILUA 2ZC2A 9ANTA 3ECOA 3EUHA 1S8NA 2JA2A 2NAZA 4ZTJA 4RMNA 2QF7A 1YOVB 4YG2F 2DMIA 1A6QA 2X85A 2DA1A 3S3OA 4J00A 2YRHA 2JP9A 1HDPA 3Q9SA 3L00A 3SDGA 2WBSA 4B3SE 3M8FA 3OWTA 1OR7C 1QQIA 3KP4A 2CFXA 3O8HA 3M9AA 4RM2A 4DYCA 2VB6A 3BG7A 2IEKA 1R00A 1S5LC 1VQ8I 3OYAA 4XL9A 3AV0A 1YFHA 3E6MA 1RUNA 2EOZA 1ZHFA 5BOXA 4R1HA 3V4GA 1LLMC 2R7WA 1OCPA 3MHHC 5AASA 2OU2A 3C1DA 1W5CC 3SEZA 4CZZA 3GTKJ 2STTA 1HBXG 1RR8C 2R0QC 2H09A 3A01A 4B3XA 1WGXA 5DM7F 2CS3A 2CU7A 4I0BA 1WSUA 3LAJA 4HF1A 3VEPA 4DBQA 4FISA 2H1KA 2QSHX 2LTPA 4Q5SF 2L9NA 4I0AA 3QP6A 1YS6A 4YRVA 4FASD 3HSRA 2MYSA 3I58A 3SJMA 2LTSA 1GXPA 2XV4S 3AG3H 2JTVA 4D7NA 5LGTA 1YRNB 3M4OJ 4I76A 1Z77A 5D5XB 1BR4A 1WJAA 1SFUA 4DV2E 3L9FA 2XF5A 4XN0A 3J7ZI 4X0GA 4LJZF 2CUFA 1UJ8A 1XG1A 1R6RA 2YS9A 2OA4A 3LLHA 4I98B 5FJ8J 2YU5A 1FTTA 4F9BB 3ECRA 2VUMJ 4KWYA 3J81C 2ME0A 3H1CA 1X49A 4DZPA 1BM9A 2K9LA 2N8GA 4XLEA 3SZPA 4F52A 2KQRA 2QA4I 5FKMA 3B6CA 2EMXA 2JOXA 2EZ6A 1MBFA 3E97A 1KU7A 2ESNA 1U5TB 5IOYA 1LPQA 2R93J 1S29A 1JKOC 5LL6R 4GKJE 1QVTA 4DV5E 2R7SA 2VKVA 4LFCE 4HX7A 5LGNA 2N8XA 1J7KA 2ZKZA 3BR3A 3FXOA 1A1JA 2LMZA 2Y0SN 2EZKA 3G1LA 4R2RA 2QQBA 3F0CA 5GADJ 3J7Yp 2DPDA 2P0WA 4DQ2A 2L4AA 4NQWA 3L2RA 4G7HF 3JAMC 1YO5C 3F8NA 2Z5UA 4MQ9F 5D4RA 2WY7Q 3A03A 5J8FA 3OYMA 2E7WA 3ZP5A 3CCUI 1ZTRA 2Y2ZA 4CCMA 3SDBA 1YW7A 2OCCH 1VZ0A 2DJNA 1D1AA 3I5UA 3RI4A 1MSFC 1CGPA 4C2TA 3F6HA 4DKKA 2EZHA 3L7WA 1ZRCA 2Z9OA 4P96A 3ZMSA 3PFYA 4X62E 2J5PA 1LQ1A 1S72I 2R7QA 4ENNA 1RUOA 2BVLA 5HDGA 2HJJA 5K7FA 4E7JA 4IHWA 2W85A 4M3GA 4RB3C 2HKOA 1QZEA 4L0YB 2KZVA 3FXKA 1H89C 3I0TA 1QU3A 4IHTA 5KK1A 2XASA 4UXNA 3HBLA 3Q9VA 4Y4RA 2HQRA 3PUFA 1IQOA 1IN6A 2RQLA 2WAEA 4L9NA 3EPLA 2NRAC 4TV7A 5JLWA 2HQNA 4RB1A 1IGNA 2DW4A 2MC4A 5HLTA 1HSJA 2LY1A 1GTKA 2OTLI 4BEHB 4B43A 3HUGA 2EPRA 2EMLA 1DGWY 4NUBA 1HA8A 3BJOA 5FD5A 1A1KA 3TOBA 2I10A 1JTYA 2A25A 3DTKA 2LBSB 2E1OA 2LBFB 3HB9A 5EEHA 1DP7P 1NK3P 4JBAA 5JLXA 3LSPA 4PDKA 2V9VA 4KITB 2E60A 3OIQA 4BDYA 3DKWA 1FBSA 1AH5A 4XLCA 2A05A 4ENJA 2FSWA 4GFBA 1MW7A 2YTOA 3G2BA 4XSZF 3OYEA 1TWGJ 1TTYA 4G12A 4NC7A 1MH3A 3C6KA 1OMIA 5HS7A 1HF0A 1F43A 1EH6A 4DV0E 5D6FA 2ELKA 5HVQC 2YUSA 2K4BA 1YUIA 2JOBA 1YJWI 3RKWA 2PMZA 4MIMA 2NA2A 5LBQA 1BR1A 3TO6A 3HRSA 3TO9A 1RRJA 2W84A 2Z1DA 3OYHA 3CO7C 3QG5C 3G4SI 2MDGA 5HS9A 4XICA 2GOMA 2K7IA 1F4KA 5F04A 2WA0A 5A6BD 1IN7A 2K9QA 2HTJA 5J4VA 1JTXA 3BR2A 3ZRGA 5C44J 5GAHJ 3DF6A 2OQRA 4AC0A 1K78B 3VB2A 2IS2A 1OYWA 1Y56A 1MIJA 4Z2YA 2W82A 4KIFA 4BS9A 1IRGA 1JI8A 4ZC3A 1YW8A 1H8AC 3TP3A 1PJQA 4E4HA 3CCJI 3IH4A 4F6MA 2Z33A 3DQVC 4BC7A 2MH9A 1U8RA 3WE3A 4CHUA 4AIJA 1CQTA 5L3CA 4HA8A 3ZGKA 2VPRA 4UUTA 1G4DA 4IPAA 2K5CA 1LE8A 2O8KA 2LO3A 3BJAA 2CUEA 3LQRA 5DS9A 2RS7A 2LF7A 3SQNA 2RREA 2CQKA 2GOXB 4ZJZA 5HS8A 3TEDA 2Q2EA 2IHR1 2X4HA 3ISPA 2DDAA 4HV6A 3ZMDA 1Z6RA 2X6OA 3FIGA 3I59A 1I1GA 3LSGA 2LT7A 2R7RA 4JI4E 1BI2A 4B48A 1TF3A 2HTSA 1ON2A 3K6GA 3HDDA 1R58A 4C3HJ 2VE8A 3LQQA 2XPWA 4O5GA 5AC4A 4R8HA 3AG2H 3PFIA 1JJ8C 2BW3A 5EEAA 4F91B 1P2FA 1V3FA 2HOSA 3HPZA 3MQ0A 1YJ9I 2JUCA 2FRHA 2IA1A 5J3LA 4D0PA 3JRIA 1GZ6A 1XMOE 2LK2A 4DR6E 1QNTA 2IA0A 3F6GA 2IJLA 4LF8E 4BH9A 3ZQGA 1O7FA 1R5HA 1U8BA 2C6YA 1BI3A 1CF7A 3AAFA 1B72A 1ZLKA 1IBLE 2ZNZA 1TQMA 5LHHA 2Q8KA 3ADGA 4YELA 5JI6A 2PRTA 1FIAA 1X4PA 3LSMA 2FEZA 2OUMA 3WTYC 3ZQQA 3BZCA 3HTUA 2ZM6E 1X1AA 4M9VC 3P9KA 1EKZA 3S1RJ 2Y31A 4MFDA 4BY1J 2VC0A 3BTJA 2MD5A 1HCRA 2R5YB 4JX5A 2AQEA 3A0BC 3DLAA 4XONA 4WCGA 1IDZA 4Y15A 5AIPA 2FE3A 2NVYJ 4XM3A 4DR1E 4LU9A 2RN7A 2RNJA 5FLMJ 1HR0E 2DI3A 1IG7A 3GTQJ 2R7ZJ 2DA2A 1K7AA 2DO7A 1J59A 2JJ7A 1Z6TA 2L2OA 2DMYA 4C3JJ 1D0XA 2L2KB 5IP6A 1LFPA 1YG2A 1R36A 3GVAA 3BR1A 5L3BA 3DBLB 3H5NA 4L5EA 4F3QA 3CMYA 4UV8A 2MGQA 2B7TA 2IS4A 2V88A 1Z91A 1E17A 3OIOA 2M30A 4JP0A 3DKXA 2A5WA 4S05A 4XIDA 4LLLA 3NEUA 3Q0WA 4DZJA 4U0VA 3TDUC 1IO2A 1J09A 2ADUA 3VODA 4Q35B 4BQOA 2UV1A 3QWLA 3P9IA 3J80Z 1YQAA 1DU0A 2NABA 1IRZA 1FBUA 3ESWB 3KP7A 2DFFA 4IOAF 1ETQA 1IN5A 4EM0B 5CLSA 2EQ1A 4A5MA 1YYVA 1AKHA 1JT6A 2CO5A 4MLOA 3JRAA 3ABKH 3MKYB 3BY6A 4MGRA 1POGA 3K70C 4LD5A 3LSTA 4D1QA 3FXJA 4N4NB 4L5JA 3NARA 2HVRA 2Q8UA 1JK1A 5FLXK 1A35A 5FGMA 5A6BA 2R5ZA 4C2UA 1SEUA 5IXMB 1YUJA 4M2ZA 3HRMA 3H3ZA 2HU9A 3LL7A 3RYPA 4EM1A 1VQOI 4CCNA 2HVQA 3WU0A 2H8RA 4HEIA 2O7OA 2HVSA 1WRJA 3IC7A 4X6AJ 1D1BA 2PFBA 3LA2A 5DTDA 1VQPI 4MEYF 1V5EA 4M3BA 1UHSA 2QQ8A 5F1JA 3BCAA 1P92A 3EUKL 4LLNA 2YTFA 3RPUD 3HJEA 4HX8A 2CW0F 2CTDA 1E3HA 5E17F 2OZUA 4B09A 2RSIA 4B47A 2XRLA 4XNFA 3CJNA 2L2NA 3WHBA 3HPSA 3H35A 3WG9A 1XCBA 4D5CA 3E7LA 3HPHA 2K3PA 3S15J 1MMNA 1STZA 4ABZA 2DK5A 3EPJA 3BZKA 1FSHA 3SHFA 3S1QJ 1R22A 4NDLA 1P4WA 2JPBA 2M0MA 4DR3E 1TLHB 2GA1A 4S0HB 1WJFA 1GUUA 2KMUA 2JR1A 3DKYA 5KHDA 2ZFUA 2M87A 4F2JC 1TBXA 2ID3A 1FYKA 2MFZA 4GEQB 3MCZA 2L4MA 2ZO4A 4F54A 2AXTC 2EN2A 4FTHA 1N75A 4WX9A 2E36A 2YWQA 1T95A 2F5DA 4RAYA 3WGHA 3PJRA 5CQEA 2X0LA 2V26A 3K69A 3ADLA 1Y0NA 4C30A 1BL0A 1MMSA 1T6SA 3K2ZA 4OWRB 3C2HA 4GZNC 2HQ5A 3PL8A 2KDOA 2EIMH 2P4WA 2F5FA 2X1CA 4LFUA 1TN9A 2CPNA 1ETOA 2EM7A 2H27A 4V19K 3I4NJ 2ZJQF 2HYJA 2RNGA 3FX3A 3PQJA 4G94A 2O3FA 2JRMA 4KIBA 1HDDC 1IUFA 3W3CA 2ZXHA 1U78A 1KGSA 1ZGJA 1G2HA 4PK4A 4XOTA 3PUBA 1B6AA 3ZCOA 2BY3A 1W0TA 4Y3OA 1UG2A 2JRTA 4L9TA 5LLQA 3FZVA 4HV5A 2BY2A 2XVCA 2DYSH 2EM9A 1WFXA 2ENCA 4H0EA 2P6SA 1ZBQA 3KYDB 1JK2A 3DF8A 1NG6A 1D5VA 2YZTA 2BV6A 3BZ6A 3EETA 3OR1C 1TWCJ 4KZSA 4N9IA 4UUVA 3VYTB 2GXAA 4DUYE 3AG1H 2EPLX 2JVAA 3CCVI 1XSVA 2K85A 3A0HC 3TOAA 1EKEA 2H6CA 2JA5J 3P9CA 1B8IB 1B1BA 4XKCA 4BE2A 2LKXA 5KL2A 5KL4A 2ZJPF 5EGOA 4L0ZB 2YTPA 2MW8A 2ELZA 1RIOH 2DPUA 2EQRA 3FMQA 3F23A 1E2XA 2KP6A 3G73A 1QGPA 4RAGA 2MC5A 5A6JA 4XRFA 2RC4A 1B69A 4DR2E 4R03A 3FHNA 3MWMA 4HYEA 5CPRB 5EZGA 4Z6YA 3P1XA 2DOEA 4LF4E 4O3MA 2Y69H 1GVJA 4M3EA 3K4CA 4OU0A 5DYMA 1SC7A 3MAJA 5D8LB 4DR5E 3CJRB 4I2OA 1SD5A 2D9HA 4A3BJ 1I1SA 3QP5A 2ICWG 1RETA 4A3IJ 3OYJA 4E7IA 1DU6A 1V5GA 3FMSA 3H0GJ 5EG0B 3ZQFA 3GTOJ 3LSRA 3H09A 1F1ZA 1RPWA 1UCRA 3FXQA 4HNTA 3T1HE 3PNTA 1NTCA 3O8GA 5DV5A 2GZWA 4YFKF 3S16J 3CUQB 5GP9A 3F21A 1YYWA 1FY7A 5FLVA 2EL4A 2VE7C 3IRRA 4R2CA 2ODRC 4U88A 4AIKA 1QHHD 2HOTA 4DUZE 3BT9A 2R7UA 1G2DC 4HQMA 4IEJA 2NYXA 4EJVA 1FP1D 1PUFA 1LDJA 2EN7A 4JV5E 1VTNC 3LFKA 3ZN0A 4QLCU 3CZ6A 5KCMA 3LSKA 4XKVA 3OOUA 2V1XA 3OSFA 2L7ZA 3RPUA 3IKVA 2AO9A 2DTRA 2HHHE 2OV7A 1IF1A 3ECHA 2QBYA 2WC2A 2IPQX 2VF1A 4AIDA 2LDUA 1FIPA 3Q0VA 1T2KA 1ETYA 3DV8A 1B9NA 3JRCA 2DB2A 1I5ZA 2VQEE 2K9MA 5F27A 2CV1A 3JW4A 1YI2I 4F7ZA 2BB8A 4DV1E 2LJUA 4ZDPA 2M34A 2JN6A 1Y8RB 1Z3XA 2CQQA 2AXLA 2RV8A 3KIOA 3V8JA 4N4RB 1YW9A 2IXSA 1Z1DA 2WB1N 2CFOA 3QU6A 5ED4A 2V7FA 3DP7A 4X1EA 2EPCA 3WU2C 4JI3E 2D5VA 2JK3A 3RQ4A 4KDPA 1T4NA 1J5EE 1A04A 3GO5A 1IUYA 3M8EA 4NC8A 1WWXA 4BUPA 3WHCA 1FOXA 1DI2A 4PGHA 3F22A 2GBYA 2DRPA 1BI0A 4B3ME 1QPIA 2VBYA 4RB2C 1GV5A 3BG9A 1BR2A 5IT9K 1BIAA 1A5JA 2YTJA 1F5TA 3IP4B 1ZRFA 5M5YJ 2UUAE 3GXOA 1BB8A 1ZU1A 3S2HJ 2XAUA 2VODA 2EJ4A 4XOPA 5JFRA 2A6TA 2ZMEA 2F4IA 5GPCA 4XRSA 4RGUA 3FM5A 2W57A 3D5LA 4M71A 2P7CB 3N97A 4I6ZA 2JXPA 2EBIA 2EM5A 2KRCA 5AE2A 3W6KB 3SEQA 2VONA 2CQNA 3FISA 2BZTA 2EOMA 3CC2I 3ZMVA 3S1NJ 4HAMA 2LCEA 3I55I 1BJZA 4IRIA 4BBYA 1TF6A 4FT8A 1FT9A 4CICA 1OPCA 2OCEA 2PX9A 3S2WA 4OAYA 1UAAA 1TWFJ 3T1BA 5IYBJ 2L5QA 1X48A 1JHFA 2EPXA 4OOGC 3GCMA 2EH3A 3TW7A 3RZOJ 3OYLA 4DIQA 2EMZA 2Y0SA 1VQ6I 2LV2A 4B3AA 2HOAA 2G9WA 1RC7A 1UBDC 2G7UA 3OL4A 3W2VA 2H94A 2ZCWA 2MKDA 3CCEI 2GA2A 4D5FA 5EJCA 1Z3YA 4C3IJ 1YTYA 2K02A 4IOCF 2FNPA 1QRYA 1R1TA 3QOEA 1ULYA 5DCMA 1WCMJ 4WXHA 4RGSA 5F0FA 4IXAA 3BTLA 2L54A 5KAIC 3TQMA 1D3YA 1WVRA 3LFUA 2XUBA 3K4MA 1WJ5A 4HF0A 3GLLA 5J1UA 2ELJA 2DMTA 4MTEA 1Z21A 1JKRC 2LYCA 2QZ8A 3BR5A 4EQQA 3MFKA 2M7BA 1GDTA 1K6YA 5M5XJ 4UB8C 5J8CA 1JUPA 2EOSA 4F9CB 2VQGA 3PIPF 2Z2SB 2AHQA 4ENMA 2YX7A 2IS6A 4BXUA 1XC5A 3BBGA 2BY0A 2BXYA 1V55H 2LF8A 3ASNH 2EFNA 4AU7A 4ASNA 2YPNA 2NUFA 4M0VA 4M72A 1B59A 3SZGA 4XN3A 1BC7C 2ZNYA 1P9QC 3C2BA 3DWLE 2LY2A 2PBIA 1BI1A 1YJNI 2LP0A 2E5ZA 2WADA 3BF2A 2N3GA 4Q47A 1NH3A 2VKDA 3QPLA 1REPC 3KEYA 5H6RA 2J7JA 2XSJC 4R79A 3OTOE 1SANA 1AOYA 4QTRA 5BPIA 3FXUA 1G3YA 3DPUA 4JI5E 4X65E 3MVPA 4JX4A 2P5VA 3TGNA 1UMQA 1XCVA 4P78A 3IV5A 2ZXJA 2DQRA 2ISZA 2QWWA 4BQNA 2V1UA 2E5NA 2DDBA 5C4JJ 3WGIA 1L3LA 2QKLB 1RC9A 1TW2A 5K1YA 3F8MA 5LRRA 2M3AA 2DAOA 4BHPA 3O3KA 4BDZA 1O3TA 3IWBA 1ZELA 2PJRA 2LG4A 4EATA 2GWRA 3ERED 2W24A 1X2MA 3EUHC 3CC7I 4DV3E 1VQNI 2DA4A 5IOZA 4R2DA 1XGNA 1HNWE 3KYLA 3KYCB 4NBQA 1X3CA 2E1MA 1WI3A 3TW6A 1B4AA 4KA4A 3AUZA 3BR6A 2JA7J 1YS7A 3JRFA 4JK1X 2D45A 1SVLA 3ABLH 1PDAA 1MJ9A 2K4JA 3R0AA 3K4NA 2W25A 4I09A 2L33A 1JXSA 2XB0X 1X19A 2GAUA 5LMUE 3T0YA 2K4VA 5CVVA 3DEEA 2I8DA 1ZBTA 3BQYA 4ZZLA 1USTA 3FWEA 1XMAA 3OYKA 4LOCA 3GEZA 4HLXA 4HG2A 3WGGA 4NZVA 3H36A 2DMQA 2M9AA 3SFZA 2ENHA 2KISA 2O8XA 3QOPA 2DLLA 1W5TA 1PP7U 4X64E 5JR3A 4GGGA 2F2EA 1WKMA 3DBRB 4V2FA 3EQ1A 5D6EA 3L2VA 2LKSA 5TJJA 4UUSA 3WE2A 4PFPA 2EM6A 5BQTA 1N36E 2DOAA 2LOOA 3BDDA 1TT0A 3DU6A 3EPKA 2KL4A 2EWLA 2I13A 3COAC 2EOOA 2YSOA 2GXGA 2R7FA 2YTQA 5B1AH 1FNNA 2MG4A 2MKNA 2ENAA 3HZJA 3AG4H 2LR8A 4JX6A 3D1NI 4QPQA 2EFOA 4DNCA 3OS2A 1WJCA 2ECCA 3J80K 1IDYA 3DLLF 3AL0C 2NS0A 3JSOA 3KP2A 2KKOA 5IYDJ 5IT9Z 4JQFA 1L0OC 3V7CA 2Y75A 5HNHA 3IWFA 1T0FA 1U2WA 1RR7A 3I56I 1SMTA 5ICFA 2E5LE 4AQYE 2EN6A 3HRTA 2CW8A 3BGHA 1R4NB 1H0MA 3S14J 5E3MA 1MDMA 2LUPB 4QWQA 2LMDA 2DMPA 3HTXA 4LG0A 3E6BA 5LMNE 3ZOBA 4AUXA 1RESA 4IQ4A 2YU8A 4DV4E 5KVRA 1IXCA 1O4XA 3HKZN 2K7LA 5CYVA 5GPAA 4KYWA 1V5FA 4R8OA 4C2MJ 2CG4A 3RKYA 5L3DA 2BBYA 4M6VA 3HOVJ 3M07A 3W2WA 2XAFA 4AD9A 1E0EA 2EMKA 2JPCA 1K4TA 2DT5A 1VQKI 2L7FP 4G7OF 2JA8J 2R7XA 3ZMTA 1XMXA 4KT6A 1J2XA 5D4SA 5AE3A 1R7JA 3WTWC 1W7PA 4IL6C 4R2SA 1GVDA 3HYIA 5DDGA 4GCVA 5FB2A 2V8QB 1JHHA 1XTAA 2EB7A 3M7GA 2WTEA 3GWZA 3H5AA 1TWHJ 4XRMA 1KU9A 2JA6J 4M9SA 2R3SA 4KJZA 2EMWA 4OX9E 2UWMA 3LAPA 4RLFA 1E3PA 1Y1VJ 3GLXA 4I7HA 1W36C 3KWRA 2QLZA 2PG4A 3CP8A 4CA0A 2VN2A 2MABA 4IHSA 2VQLA 3OR2C 1U0JA 4BKXA 2HPIA 1MNEA 5DD4A 4ZDLA 4OMYA 1VQ4I 4FX0A 4FE4A 4WSGA 1X2NA 4CZCA 3KZZA 5M3FJ 2B63J 2XRNA 2FD5A 3GBGA 4KICA 3L2WA 3WTTC 3OYDA 2BBGA 2YTDA 2DYRH 5FKNA 3GFIA 1S3JA 2CYYA 3L2UA 4LF9E 4KHPE 3PNYA 4MEXF 1IN8A 4EJUA 3OMYA 3VYRB 4K2EA 1D8JA 2W1OA 1T39A 2RQPA 3BTCA 2K3FA 2VOPA 1N25A 2XHKA 2VQHA 1YE9A 3HIFA 1XMKA 1MMGA 2JSPA 4XK4A 2XIGA 4QSHA 4LITA 2RTXA 1I39A 1OCRH 2A6EF 4XSXF 3GF2A 2IVMA 2FU4A
chains in the Genus database with same CATH topology
5DUIA 1MJAA 4O6JA 5HOOA 5E20A 4CDGA 1LVAA 4EV0A 4AWXB 5FFXA 2JSCA 4YFXF 1LB2A 4S04A 4P55A 2ETHA 3QPTA 2M5WA 4MNUA 3FF5A 5E8IA 5CVJA 5D5WB 3HRUA 1Z7UA 3CUQC 2O6GE 5E8GA 2XGXA 2F5EA 3DFGA 3I4PA 5F6FA 3ELKA 4EM2A 2EV0A 3QU3A 3E6DA 3C3WA 5F64A 3R60A 3GFMA 3QAHA 2FA5A 3V7SA 4WF2A 1FX7A 3TDZC 4B8XA 4ZYDA 3I71A 1LDDA 1MKMA 3H92A 2Z3YA 5HLIA 2A61A 2KJBA 3KLOA 1R23A 5HDNA 1FYMA 2E1NA 3U9GA 4E70A 1LDKB 2TDXA 3ZPLA 5DCFA 1ZRDA 4ENKA 4OOIA 3NRVA 2ZBKA 1ZG3A 2ISYA 1RZ4A 1I27A 5BS6A 4KMFA 3J81Z 5AONA 4PCQA 2EJRA 5L3GA 3RIRA 3T5XA 4N9HA 4P9FA 2STWA 3BJ6A 1SFXA 1WQ2A 1XGOA 2IW5A 3HSEA 2M1BA 1K6OA 5EEGA 2FQ3A 5TRDA 3KZYA 4G9YA 2VC1A 5D8KB 2PI0A 3ML6A 4U7BA 2M45A 2A07F 3JAMZ 1T38A 2EFQA 1J5YA 4PZJA 1FLIA 3BWGA 2K86A 3OOPA 1ONVA 2BGCA 2NNNA 2PMUA 3KP6A 1OKRA 2MC3A 4ZYGA 3M1EA 5ILSA 4BYYA 3HTSB 3IWZA 1G3SA 4GYIA 2EA4A 4LB6B 3KETA 4WXDA 1FZPB 1U5TA 5HLHA 4ETSA 1TQPA 2Z99A 1V4RA 3GUDA 1LJ9A 3KEQA 4MHGA 1ZAOA 4HQEA 1OYIA 3WTXC 4M73A 4IRHA 2O03A 1R1VA 3R0JA 2Y48A 4HZFA 1U6GA 3GZ5A 2COMA 4WWCA 2DK8A 4NB5A 4A6EA 3J7AO 2FBIA 5LRSA 2JZYA 2K27A 3IKTA 4HW0A 3WTSC 3W6JB 1IW7F 2DBBA 3EYYA 3KCCA 4P9UA 4YIIA 4AIHA 2XKPA 5E1ZB 4A5NA 2ESHA 2BE5F 4ZYEA 4FHTA 4LMYA 4BAYA 5DEQA 4EMSA 3HOSA 3LA7A 5LHIA 4ZH4F 2XAQA 1FP2A 3SXYA 5HLGA 4LK0F 3RKXA 1XDSA 5FD6A 2VOOA 1HKTA 2HZTA 4Y13A 1FYLA 1Q1HA 4LK1F 2MH2A 1KQ0A 1FPQA 2XAJA 4XLNF 4YIFA 1K78A 4EGZA 5DUKA 1RI7A 2A69F 3WODF 4U0YA 2P7VB 3I59B 2DU9A 2EV5A 4WK8F 1ZREA 5LEKA 1DDNA 2HDCA 1G3WA 2HWVA 1OR7A 4KN4X 5AIQA 1LEBA 2RDPA 3U1DA 4MTDA 4G8XA 1NHAA 1CF7B 2KRFA 3JTGA 4KFCA 1XGMA 3T8TA 3E6CC 3GZ6A 4RAZA 3B02A 3ZQ7A 2H6BA 5JHUA 3V8LA 3KP5A 2P6TA 1QO0D 1QZZA 1GHCA 5ERIA 1G6NA 4OMZA 5A2QK 1OYYA 3E5XA 1R5GA 2Y0MA 2OZ6A 3GW2A 4G7ZF 3ZMZA 2EWNA 2OBPA 2XAHA 2EV6A 2FMYA 1HKQA 1FBQA 4KT5C 3K1MA 3RYRA 4RGXA 4EJTA 1IRFA 3F8CA 3FXRA 3R6SA 3R61A 2Q0OA 4IVNA 1W7PD 3HHGA 3E3VA 1IN4A 1O7LA 3BPXA 4L9JA 4ESBA 4I01A 1QPMA 1ZARA 2FBHA 1KQ8A 3F8FA 2YPRA 5LEJA 1XGSA 3RPQA 1XD7A 4YFNF 5LHGA 1SAXA 2D1VA 4LB5A 1JE8A 3VOEA 1HSTA 1I6XA 2O61A 1R1UA 2KIFA 2VBWA 1TNSA 1EH8A 3F72A 2YU3A 4HX4A 2PEXA 1BC8C 1W5SA 3R4KA 1SFEA 3DXJF 3RDIA 3TKYA 5BPDA 2NNYA 2WWYA 1IXRC 4FX4A 2RKHA 1BN5A 3C7JA 1XSXA 2E1CA 4L9VA 4ESFA 2RVCA 4OIQF 2GXBA 5H20A 1Y0UA 1QZYA 4Q4ZF 3TQNA 5K5QA 1ZG5A 1HXDA 1XN7A 3HHHA 3ZN1A 2IRFG 3DPLC 5J6XA 4BHBA 1SMYF 2ACJA 1PDNC 5D5UB 2WV0A 1ZYRF 1ON1A 1USSA 4AVPA 4ON0A 4EJOA 1MJBA 4CYDA 2EK5A 1KU2A 4A12A 5E18F 2A6HF 5IT3A 1Z9CA 4P5OA 1IAWA 4WXCA 3J81K 1C0WA 5CVIA 4IF4A 3FMRA 5DD8A 4KN7X 2VBXA 4HLYA 2CSOA 3L09A 2QUFA 1O3QA 4GYGA 3K0LA 3HSFA 1UFMA 1X3UA 3MZHA 5D5VB 2L02A 4EVIA 1B9MA 2EFPA 6PAXA 5A2QZ 2V6CA 4L5IA 3JAMK 3E5QA 5F1RA 3F6OA 1ZH5A 2PQ8A 1S6LA 2E7XA 3V8KA 4M9ZA 3FHZA 2PLYA 3IL2A 2XAGA 4NHJA 4M74A 3JTHA 2JT1A 1FOKA 2OAZA 3EDPA 2FBKA 4UNOA 1XSDA 3KP3A 2QBYB 2QVOA 3T8RA 2KJCA 3CUQA 2HYGD 2L01A 1JGSA 4O5VA 3KLNA 1IXSB 2F5CA 1YIOA 1J75A 2GQQA 1IZ1A 4UVBA 4CO8A 2MLKA 1FSEA 4HBLA 2VBZA 2P5KA 3EYIA 1UHMA 2MLGA 1J9IA 1KYWA 3HOTA 5E1XA 3BOQA 2CGPA 5H6QA 1P6RA 2LKPA 2UXNA 2B0LA 3EQLF 2ELHA 2RGVA 2G7HA 3CLOA 1DUXC 1MZBA 4KUMA 4EGYA 3BROA 2ZMEB 4KNYA 2EFWA 1PUEE 1WI9A 1SD7A 2M8EA 1D8KA 3GX4X 3WTZA 3C18A 4M6YA 2PN6A 1MD0A 3KEOA 1KQ9A 4A0ZA 4EJWA 1HW5A 1S7OA 3LWFA 4Y17A 1HW1A 2QYOA 4RGRA 2PJPA 1ZGAA 4I02A 3G3ZA 1P4AA 2GIVA 4XLPF 2HKXA 4LGWA 4HOBA 4RB0A 1TNTA 1KYZA 3RTRA 2QQAA 5ICCA 5DCMB 3GFJA 4PGGA 3ABTA 5ICGA 3PQKA 1BOAA 2ZFWA 1P4XA 2VXZA 1PP8F 3CDHA 5CVRA 3IHUA 2HYFA 2UXXA 3I54A 2IP2A 4A0XA 1FC3A 3WTUC 4OIRF 2LSOA 1AWCA 1LEAA 3BP8A 2KIUA 2D2WA 3FM3A 2QM3A 4IJAA 2YSRA 2FOKA 1YLFA 1U3EM 4HDVA 4OIOF 3F6VA 3O6BB 3MEXA 5JVTA 4BNCA 5E1WA 4M6XA 5ICEA 3F3XA 4M9XA 1ZLJA 1ZN2A 1O3SA 1KA8A 1BBYA 5LGUA 3ZMUA 2D1HA 1H9TA 3K1PA 3V7RA 4U7DA 2FMLA 3DEUA 2DQLA 2IT0A 3ABUA 2FXAA 2O0YA 2BEOA 2XROA 3IRQA 1XDUA 3K9TA 4HDUA 1SD6A 4OINF 4A0YA 3ROUA 5L3FA 2A5YB 5K5OA 3L2CA 3CUOA 4G6QA 2V79A 2YX4A 1W4MA 4BHCA 5K5RA 2VT2A 2V1DA 3NQOA 3B73A 3I64A 4ZYHA 4BQAA 1RNLA 2FNAA 1TQIA 2HFHA 4ESJA 1ZG1A 3KE2A 2LNBA 1S7AA 3SZTA 1MGTA 4A2UA 1MDMB 4L18B 3Q5FA 4ZZDA 2OD5A 5ILVA 2ZJ2A 4LG0B 1XB4A 4KIGA 2UZKA 4UV9A 1K79A 1BIBA 2P8TA 3ULQB 2PMHA 3P7NA 3QPHA 2J5OA 2P5LC 5CJ9A 1G3TA 3WU1B 2HEOA 4CGZA 3QRFF 1W7PB 4GXOA 5FFZA 1SD4A 2CWEA 4MQVA 2MBFA 2QQ9A 3CTAA 4N0BA 4UVCA 1U5TC 1O3RA 2R7DA 5HDKA 1GXQA 1DPUA 4KMUX 2A68F 1EV7A 4CXFA 2IA2A 3GYHX 4OIPF 5L3EA 4HF2A 3U2RA 1HQCA 4UVAA 3CO6C 1EH7A 3MZYA 1UHWA 3VFZA 2DFIA 1HW2A 1DPRA 4RS8A 1FWZA 4Q48A 2VE9A 1BJAA 4LLGF 1O57A 4U0WA 2XKOA 5CVUA 2AS5F 3JSPA 3H3UA 5BMZA 2VT3A 2L3DA 4XBFA 4G6DA 3D0SA 2A3SA 5FLXZ 1LNWA 3KFWX 3N4MA 1Z05A 4A6DA 3GFLA 3I53A 1KU3A 3BPVA 3LA3A 2BYVE 1TW3A 3WTVC 1QBJA 1HKSA 2OQGA 5FO5A 3K1NA 3REOA 2HGCA 2FF4A 1H9GA 1F9NA 1ODDA 2YR2A 2MA3A 2HS5A 3OV8A 2EA2A 2KIMA 3O2PE 3E5UA 1T98A 2HOEA 4IRGA 1J0RA 4UHTA 3F8BA 4GO1A 2QENA 1UB9A 3RJPA 3DPTA 2HR3A 3TO7A 5ILUA 3ECOA 3EUHA 1S8NA 2NAZA 4YG2F 3Q9SA 3L00A 3M8FA 1QQIA 3KP4A 2CFXA 3M9AA 1R00A 1YFHA 3E6MA 1RUNA 1ZHFA 5BOXA 4R1HA 3V4GA 2OU2A 3C1DA 4CZZA 2STTA 1HBXG 2H09A 4I0BA 1WSUA 3LAJA 4HF1A 3VEPA 4Q5SF 4I0AA 3QP6A 1YS6A 3HSRA 3I58A 1GXPA 2XV4S 2JTVA 5LGTA 5D5XB 1SFUA 3L9FA 4LJZF 2OA4A 4I98B 1BM9A 3SZPA 3E97A 1KU7A 2ESNA 1U5TB 1S29A 4HX7A 5LGNA 1J7KA 2ZKZA 2QQBA 2DPDA 4DQ2A 2L4AA 4NQWA 4G7HF 1YO5C 3F8NA 2Z5UA 4MQ9F 5D4RA 5J8FA 2E7WA 3ZP5A 1YW7A 3I5UA 3RI4A 1CGPA 3L7WA 1ZRCA 2Z9OA 4P96A 3ZMSA 2J5PA 1LQ1A 4ENNA 1RUOA 5HDGA 2W85A 4RB3C 2HKOA 4L0YB 3I0TA 4IHTA 5KK1A 2XASA 4UXNA 3Q9VA 2HQRA 1IN6A 4L9NA 2NRAC 4TV7A 4RB1A 2HQNA 2DW4A 1HSJA 3HUGA 3BJOA 5FD5A 3TOBA 5EEHA 1DP7P 4JBAA 4PDKA 2V9VA 3DKWA 1FBSA 4ENJA 2FSWA 4XSZF 1TTYA 1OMIA 5HS7A 1EH6A 5D6FA 5HVQC 2K4BA 3RKWA 5LBQA 3TO6A 3HRSA 3TO9A 2W84A 3CO7C 5HS9A 1F4KA 1IN7A 2HTJA 2OQRA 1K78B 3VB2A 1OYWA 4Z2YA 4KIFA 1IRGA 1YW8A 2Z33A 3DQVC 2MH9A 1U8RA 3WE3A 4CHUA 4AIJA 5L3CA 4HA8A 1G4DA 4IPAA 3BJAA 3LQRA 2LF7A 3SQNA 2CQKA 5HS8A 2Q2EA 2X4HA 3ISPA 4HV6A 3ZMDA 1Z6RA 3I59A 1I1GA 1BI2A 2HTSA 1ON2A 1R58A 2VE8A 3LQQA 4R8HA 3PFIA 1P2FA 1V3FA 3MQ0A 2FRHA 2IA1A 4D0PA 1QNTA 2IA0A 2IJLA 4BH9A 1O7FA 1R5HA 2C6YA 1BI3A 1CF7A 3AAFA 1ZLKA 2ZNZA 5LHHA 1TQMA 2Q8KA 5JI6A 2FEZA 3WTYC 3HTUA 3P9KA 2VC0A 2MD5A 4WCGA 4Y15A 5AIPA 2FE3A 2RN7A 2RNJA 2DI3A 1K7AA 2DO7A 1J59A 1Z6TA 1YG2A 1R36A 3GVAA 5L3BA 4UV8A 1Z91A 1E17A 2M30A 4S05A 4LLLA 3NEUA 4U0VA 3TDUC 2ADUA 3VODA 3P9IA 3J80Z 1YQAA 1FBUA 3KP7A 1IN5A 4EM0B 5CLSA 4A5MA 1YYVA 2CO5A 3BY6A 4MGRA 4LD5A 3LSTA 4L5JA 5FLXK 5FGMA 3HRMA 3H3ZA 3RYPA 4EM1A 3WU0A 1WRJA 3IC7A 3LA2A 2PFBA 4MEYF 1P92A 4LLNA 4HX8A 2CW0F 5E17F 2OZUA 4B09A 3CJNA 3WG9A 1XCBA 1STZA 2DK5A 1FSHA 3SHFA 1R22A 1P4WA 2JPBA 1TLHB 2GA1A 2M87A 1TBXA 1FYKA 3MCZA 2L4MA 2ZO4A 4WX9A 2F5DA 4RAYA 3WGHA 2X0LA 3K69A 1T6SA 3K2ZA 2P4WA 2F5FA 4LFUA 2H27A 3FX3A 3PQJA 4G94A 2O3FA 4KIBA 1U78A 1ZGJA 1KGSA 1B6AA 2JRTA 4L9TA 5LLQA 3FZVA 4HV5A 2XVCA 4H0EA 2P6SA 3DF8A 1D5VA 2BV6A 3BZ6A 3EETA 4N9IA 4UUVA 1XSVA 3TOAA 2H6CA 3P9CA 1B1BA 4L0ZB 1RIOH 2DPUA 3FMQA 3F23A 1E2XA 3G73A 1QGPA 4XRFA 2RC4A 3MWMA 4HYEA 4O3MA 1GVJA 5DYMA 4OU0A 3MAJA 5D8LB 4I2OA 1SD5A 1I1SA 3QP5A 3FMSA 1F1ZA 1UCRA 3FXQA 5DV5A 2GZWA 4YFKF 3CUQB 3F21A 1FY7A 3IRRA 4U88A 4AIKA 4HQMA 4EJVA 2NYXA 1FP1D 1LDJA 1VTNC 3LFKA 4QLCU 3ZN0A 2V1XA 3RPUA 3IKVA 2DTRA 1IF1A 3ECHA 2QBYA 2WC2A 2IPQX 2LDUA 1T2KA 3DV8A 1B9NA 1I5ZA 3JW4A 4F7ZA 2AXLA 2RV8A 3V8JA 1YW9A 1Z1DA 3QU6A 5ED4A 3DP7A 4KDPA 1A04A 3GO5A 1IUYA 3M8EA 1WWXA 4PGHA 3F22A 1BI0A 2VBYA 4RB2C 5IT9K 1BIAA 1F5TA 1ZRFA 3GXOA 2VODA 5JFRA 2ZMEA 4RGUA 3FM5A 2W57A 3D5LA 4M71A 2P7CB 3N97A 3W6KB 2VONA 3ZMVA 4HAMA 4IRIA 4FT8A 1FT9A 4CICA 1OPCA 3S2WA 3T1BA 1JHFA 2G9WA 2G7UA 2H94A 2ZCWA 2GA2A 1YTYA 2K02A 2FNPA 1R1TA 1ULYA 5DCMA 4WXHA 4RGSA 4IXAA 2L54A 1D3YA 2XUBA 4HF0A 4MTEA 2QZ8A 4EQQA 3MFKA 5J8CA 4ENMA 2YX7A 4BXUA 2LF8A 2EFNA 4ASNA 4M72A 1B59A 1BC7C 2ZNYA 2PBIA 1BI1A 4Q47A 1REPC 5H6RA 4R79A 1AOYA 5BPIA 3FXUA 1G3YA 2P5VA 3TGNA 1XCVA 2ISZA 2ZXJA 2DQRA 2QWWA 2V1UA 3WGIA 1L3LA 1TW2A 5K1YA 3F8MA 5LRRA 2DAOA 4BHPA 3O3KA 1O3TA 2GWRA 3ERED 2W24A 1XGNA 1B4AA 4KA4A 1YS7A 4JK1X 2D45A 1MJ9A 2K4JA 3R0AA 4I09A 2W25A 1JXSA 2GAUA 3T0YA 5CVVA 4ZZLA 1USTA 3FWEA 1XMAA 3GEZA 4HLXA 3WGGA 3SFZA 2O8XA 3QOPA 2DLLA 1W5TA 1PP7U 5JR3A 4GGGA 2F2EA 1WKMA 5D6EA 5TJJA 3WE2A 5BQTA 3BDDA 3COAC 2GXGA 2R7FA 1FNNA 2EFOA 4DNCA 3J80K 2NS0A 3JSOA 3KP2A 2KKOA 5IT9Z 4JQFA 1L0OC 3V7CA 2Y75A 3IWFA 1T0FA 1U2WA 1SMTA 5ICFA 3HRTA 1H0MA 1MDMA 4QWQA 4LG0A 3E6BA 5KVRA 1IXCA 2K7LA 5CYVA 4KYWA 2CG4A 3RKYA 5L3DA 2BBYA 2XAFA 4AD9A 2JPCA 2DT5A 4G7OF 3ZMTA 1J2XA 5D4SA 1R7JA 3WTWC 1W7PA 3HYIA 5DDGA 4GCVA 5FB2A 1JHHA 2EB7A 3M7GA 2WTEA 3GWZA 1KU9A 4M9SA