2EMXA

Solution structure of the c2h2 type zinc finger (region 273-303) of human zinc finger protein 268
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
44
structure length
44
Chain Sequence
GSSGSSGEKPFGCSCCEKAFSSKSYLLVHQQTHAEEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 268
publication title Solution structure of the C2H2 type zinc finger (region 273-303) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
total genus 8
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emxA01
1A1FA 1DGCA 1X6HA 5KL2A 2CT1A 2EPAA 1B69A 1YSAC 2EM0A 2EORA 2YTFA 1A1LA 2J7JA 2ADRA 2EM5A 4M9VC 2EMCA 1BBOA 5KL3A 2MKDA 2DMIA 2EOIA 2LT7A 2EPPA 3MHSC 4R2RA 1TF3A 2LVHA 3UK3C 1KJKA 2EQ3A 2EL6A 1LLMC 2EN7A 2D9HA 2EM7A 2LV2A 2MDGA 2EMHA 2DGCA 2YRHA 4F2JC 2EMGA 2HGHA 2NABA 1TN9A 2ENHA 2EM8A 2EOXA 2ELYA 2VRDA 1UBDC 2A25A 1A1GA 4R2AA 4R2QA 2EMAA 2DRPA 2YTNA 2EN1A 2EMBA 2EM6A 2EOQA 2EM4A 2CTDA 2EOEA 2EOZA 3EPKA 1YUIA 1G2DC 5KL5A 1P47A 2RSIA 2EMIA 2YTJA 2EPZA 2YRMA 1A1HA 2EMKA 4FK5C 2EMWA 4R2DA 1G2FC 2EP3A 2DLQA 2LO3A 1ZR9A 1Z1BA 2EPCA 2YTIA 4R2PA 3EPLA 1X5WA 2EJ4A 2EOJA 4R2CA 2EMYA 3M99B 2EL4A 4F6MA 3EPHA 2ENAA 2WBUA 2YU8A 2GHFA 4IJDA 4X9JA 2EMLA 2EPUA 2YTDA 2WCC3 1BB8A 2E72A 2EQ0A 1YUJA 2YU5A 2EE8A 2YTEA 2YSPA 2GLIA 4GZNC 2MKNA 2YTQA 2BB8A 2EOHA 1ZU1A 5KL4A 2I13A 3EPJA 2EOYA 4IS1C 2EPXA 2ENCA 1X6EA 2JP9A 2YTGA 2R1FA 2EMFA 2WBTA 2DLKA 2EN4A 5KL6A 2JPAA 1JK2A 4WSGA 4F6NA 1ZAAC 2CSHA 2YSOA 2EM2A 2M9AA 1NCSA 1JK1A 2EL5A 1A1KA 2EM9A 2YRKA 2PRTA 2EM3A 1RMDA 1A1JA 1A1IA 2EOFA 2EN6A 3MHHC 1WJPA 1F2IG 2EN8A 2EPRA 2YTPA 2EN3A 1X3CA 3VHTB 1AAYA 1TF6A 1X6FA 2LCEA 2EOOA 2YTOA 4R2SA 2EOSA 2RPCA 2EMXA 2ELZA 4R2EA 2WBSA 1MEYC 2EQ1A 2EN2A 2EMZA 2EOMA 5KL7A 1UN6B
chains in the Genus database with same CATH superfamily
1A1FA 4JV5E 3JTZA 2EPAA 1B69A 1YSAC 2EWLA 2RSMA 1X48A 1A1LA 1BBOA 2M4IA 5CFFE 3OMLA 2WZOA 2EPPA 2B9DA 3HPSA 2LVHA 2LRSA 2EZ6A 1T4LB 2UXBE 4WFTA 3HXLA 2D9HA 2MDGA 2DGCA 3THNA 2L2NA 4LF9E 2LUQA 4BMJA 4R2AA 2NUFA 2EMAA 3J7AG 1N3GA 4DKKA 2EOQA 2EM4A 2EOEA 2EOZA 5AE2A 1T4NA 1NEIA 2RSIA 4BHBA 5AE3A 4B3TE 4GKKE 2MC5A 2IHR1 3HPZA 4JI0E 1HNWE 2L2MA 1WRJA 2V85A 4DV7E 1UILA 2EJ4A 4R2CA 3EPHA 2JWOA 2BBGA 2YU8A 4IJDA 4X9JA 2YTDA 3DF6A 2E72A 2YT4A 2DIXA 1T38A 2YU5A 1IMUA 1GTKA 3VK6A 2L6MA 2BB8A 3MSWA 4LFCE 3TQMA 2EOYA 3IWCA 1XMOE 4RHBB 4DR7E 2R1FA 4WSPA 3KWRA 2DLKA 4P7DA 1YZ9A 5KL6A 4K0KE 4NZVA 2EM2A 2M9AA 1GZ6A 4JI5E 2EM9A 2PRTA 1GQEA 2JYAA 2G7HA 2EN6A 3QG5C 2RQLA 2ODRD 2RTXA 2EPRA 3KZYA 3J80C 2EN3A 2HC5A 3BGHA 2FGGA 2LCEA 2LJHA 3IWBA 2EOOA 4X8WA 2EOSA 1EH7A 4X62E 2EMXA 4NXME 2I9IA 4R2EA 2WBSA 1MEYC 2EMZA 2EOMA 3BF2A 3JAMC 3OTOE 2EM0A 2EORA 1N33E 2J7JA 3HTXA 5KL3A 4F9AB 2M7QA 2EPNA 4DV6E 4ZYGA 5TSEA 1J26A 2YWQA 2EPLX 1QNTA 4DR1E 2EMHA 5F3WA 1IQOA 4MLQA 2YRHA 3C6MA 2EMGA 2NABA 2EOXA 2ELYA 3K6QA 2VRDA 2LTRA 4DV0E 3T1YE 2DRPA 2EN1A 4BHCA 2MDRA 2EMBA 2EM6A 3C4BA 4F9CB 2CTDA 2HJJA 3ADLA 3EPKA 1SFEA 5LLQA 2R76A 5KL5A 1G2DC 2EMIA 2EPZA 3AV0A 4BC7A 3VYYA 1EH8A 1G2FC 2EP3A 2DLQA 4JI6E 2LO3A 2YZTA 4LTYA 4ZYEA 1Z1BA 2EPCA 2EPKX 1N34E 4NXNE 4O43A 2KOUA 2EOJA 2F8BA 4L5NC 2EMYA 3M99B 2EL4A 2YPNA 5AC4A 2NUGA 2L8TA 4WPYA 2WBUA 3T1HE 2WCC3 2EE8A 1PJSA 2YSPA 5A6BA 3ADGA 4GZNC 2YTQA 4JI7E 5DNYA 2V89A 2MKNA 1ZU1A 1HNXE 2LMZA 1IQSA 2LBSB 4YHHE 2JXPA 2DMYA 3EQ1A 4B3ME 4ZYHA 2JP9A 2L2KB 4P78A 2UUBE 2WBTA 3F6GA 4WSGA 4X65E 1ZAAC 5FLXC 1A1KA 1NCSA 1RMDA 4ZYDA 4OOGC 2Q8UA 3VYXA 1UHZA 2L3CA 2YTPA 1X3CA 5IV8B 4LF7E 2L33A 2VQEE 1X6FA 4DMIA 4M30A 2MC6A 2LE2A 2V88A 5AE1A 3C4TA 2L92A 2B7VA 1DI2A 3LLHA 1PDAA 4LF8E 4O24A 4R8OA 2CPNA 1DGCA 1I94E 4WXCA 4TUGA 4DUZE 2L3JA 2FTXB 2ADRA 2EMCA 1HNZE 3ADJA 2MKDA 2DMIA 2JOXA 1YYOA 4JI8E 2EOIA 3MHSC 1SR9A 3UK3C 1IBLE 4YY3E 3HQ1A 5LMNE 4J8ZA 2EQ3A 2EL6A 1LLMC 2EN7A 2EM7A 2LV2A 4MLVA 4WYQB 2RS6A 1MGTA 2V87A 4L8NA 1STUA 2HGHA 5IXMB 2KONA 3L00A 2ODRC 4LF5E 5A2QC 2A25A 4X66E 2JR1A 2V86A 1PJTA 4R2QA 1FKAE 4LFAE 3H09A 2UU9E 1L4SA 4DV1E 4DV2E 1ZBTA 4F9BB 2EMWA 4I8OA 2N3HA 1ZR9A 4R2PA 2LTSA 4NHRA 3EPLA 3ADIA 5ADZA 1IBKE 4M2ZA 4F6MA 2ENAA 3AUZA 1T39A 4HEIA 2N8XA 1BB8A 2EPUA 4X64E 1YFHA 4DV4E 1YUJA 4DUYE 5BR8E 2YTEA 2GLIA 1PKPA 2EOHA 2I13A 2V83A 3C6KA 2GPIA 2K7IA 1X6EA 2JOBA 4O4KA 4KHPE 4BC9A 1X49A 2EMFA 4AQYE 4DR6E 3KZZA 5T6JA 1JK2A 2CSHA 2YSOA 1JK1A 4HTGA 5LMUE 2EM3A 3DJWA 4M0VA 4RH8A 2VQFE 4LF4E 2EOFA 3MHHC 4JI4E 1YYWA 4JI3E 2EN8A 3JU0A 2DB2A 3VHTB 2K4VA 4BCAA 4DR2E 4O5GA 2E5LE 4BBYA 4BS9A 2ELZA 3THOB 4DR4E 2LUPB 4DR3E 4N4RB 2EN2A 2FV4B 5KL7A 1UN6B 4JI1E 1X6HA 2B3TB 5KL2A 2CT1A 2M1SA 2ZM6E 5A6KA 1DQ3A 4Q35B 4B3SE 2YTFA 2EM5A 4M9VC 2VF1A 5IT9C 1IBME 5A6AA 1T4OA 4OX9E 5AASA 1N32E 3IWDA 2LT7A 4DV5E 1HR0E 4R2RA 2KHXA 4F54A 1TF3A 1AH5A 4DR5E 1YPNA 4TUIA 2B7TA 2UXDE 5A69A 4F2JC 1TN9A 2ENHA 1ZBQA 4LF6E 2EM8A 2UXCE 1WHQA 1UBDC 2RS7A 1A1GA 3J7Yp 1N36E 2V8QB 2YTNA 1X47A 3J81C 3BBGA 4DV3E 1YUIA 1WHNA 1P47A 2UUAE 2YTJA 2YRMA 1A1HA 2EMKA 4FK5C 1YYKA 2JY9A 2N3GA 4R2DA 5A6JA 2EPOA 2YTIA 1XMQE 1X5WA 1EKZA 2EPMX 3ECRA 5A6BD 2GHFA 2LJUA 2EMLA 2EQ0A 3ZOQB 5IWAE 5LL6R 4R03A 4JI2E 1WXRA 4JYAE 5KL4A 1FJGE 2VE7C 3EPJA 4IS1C 2EPXA 2ENCA 4LU9A 3BIDA 3RMPA 2YTGA 2NUEA 2EN4A 1J5EE 2JPAA 1O0WA 4F6NA 4KWYA 2E1MA 2EL5A 4Q28A 3F6HA 4GKJE 2YRKA 2JVAA 1A1JA 4GEQB 1A1IA 3FIGA 4KZSA 1KYQA 1RQ0A 2H36X 1WJPA 2UUCE 5AC5A 1F2IG 3P1XA 1PJQA 1EH6A 1AAYA 1TF6A 1XNRE 3LMLA 1BBGA 4WXDA 1QU6A 2F4VE 2YTOA 4B3RE 2DSYA 4R2SA 1RC7A 4LFBE 2RPCA 1XNQE 2HHHE 2NA2A 2EQ1A 1KJKA 4WX9A
chains in the Genus database with same CATH topology
1A1FA 1DGCA 1X6HA 5KL2A 2CT1A 2EPAA 1B69A 1YSAC 2EM0A 2EORA 2YTFA 1A1LA 2J7JA 2ADRA 2EM5A 4M9VC 2EMCA 1BBOA 5KL3A 2MKDA 2DMIA 2EOIA 2LT7A 2EPPA 3MHSC 4R2RA 1TF3A 2LVHA 3UK3C 1KJKA 2EQ3A 2EL6A 1LLMC 2EN7A 2D9HA 2EM7A 2LV2A 2MDGA 2EMHA 2DGCA 2YRHA 4F2JC 2EMGA 2HGHA 2NABA 1TN9A 2ENHA 2EM8A 2EOXA 2ELYA 2VRDA 1UBDC 2A25A 1A1GA 4R2AA 4R2QA 2EMAA 2DRPA 2YTNA 2EN1A 2EMBA 2EM6A 2EOQA 2EM4A 2CTDA 2EOEA 2EOZA 3EPKA 1YUIA 1G2DC 5KL5A 1P47A 2RSIA 2EMIA 2YTJA 2EPZA 2YRMA 1A1HA 2EMKA 4FK5C 2EMWA 4R2DA 1G2FC 2EP3A 2DLQA 2LO3A 1ZR9A 1Z1BA 2EPCA 2YTIA 4R2PA 3EPLA 1X5WA 2EJ4A 2EOJA 4R2CA 2EMYA 3M99B 2EL4A 4F6MA 3EPHA 2ENAA 2WBUA 2YU8A 2GHFA 4IJDA 4X9JA 2EMLA 2EPUA 2YTDA 2WCC3 1BB8A 2E72A 2EQ0A 1YUJA 2YU5A 2EE8A 2YTEA 2YSPA 2GLIA 4GZNC 2MKNA 2YTQA 2BB8A 2EOHA 1ZU1A 5KL4A 2I13A 3EPJA 2EOYA 4IS1C 2EPXA 2ENCA 1X6EA 2JP9A 2YTGA 2R1FA 2EMFA 2WBTA 2DLKA 2EN4A 5KL6A 2JPAA 1JK2A 4WSGA 4F6NA 1ZAAC 2CSHA 2YSOA 2EM2A 2M9AA 1NCSA 1JK1A 2EL5A 1A1KA 2EM9A 2YRKA 2PRTA 2EM3A 1RMDA 1A1JA 1A1IA 2EOFA 2EN6A 3MHHC 1WJPA 1F2IG 2EN8A 2EPRA 2YTPA 2EN3A 1X3CA 3VHTB 1AAYA 1TF6A 1X6FA 2LCEA 2EOOA 2YTOA 4R2SA 2EOSA 2RPCA 2EMXA 2ELZA 4R2EA 2WBSA 1MEYC 2EQ1A 2EN2A 2EMZA 2EOMA 5KL7A 1UN6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A1F A;  1DGC A;  1X6H A;  5KL2 A;  2CT1 A;  2EPA A;  1B69 A;  1YSA C;  2EM0 A;  2EOR A;  2YTF A;  1A1L A;  2J7J A;  2ADR A;  2EM5 A;  4M9V C;  2EMC A;  1BBO A;  5KL3 A;  2MKD A;  2DMI A;  2EOI A;  2LT7 A;  2EPP A;  3MHS C;  4R2R A;  1TF3 A;  2LVH A;  3UK3 C;  1KJK A;  2EQ3 A;  2EL6 A;  1LLM C;  2EN7 A;  2D9H A;  2EM7 A;  2LV2 A;  2MDG A;  2EMH A;  2DGC A;  2YRH A;  4F2J C;  2EMG A;  2HGH A;  2NAB A;  1TN9 A;  2ENH A;  2EM8 A;  2EOX A;  2ELY A;  2VRD A;  1UBD C;  2A25 A;  1A1G A;  4R2A A;  4R2Q A;  2EMA A;  2DRP A;  2YTN A;  2EN1 A;  2EMB A;  2EM6 A;  2EOQ A;  2EM4 A;  2CTD A;  2EOE A;  2EOZ A;  3EPK A;  1YUI A;  1G2D C;  5KL5 A;  1P47 A;  2RSI A;  2EMI A;  2YTJ A;  2EPZ A;  2YRM A;  1A1H A;  2EMK A;  4FK5 C;  2EMW A;  4R2D A;  1G2F C;  2EP3 A;  2DLQ A;  2LO3 A;  1ZR9 A;  1Z1B A;  2EPC A;  2YTI A;  4R2P A;  3EPL A;  1X5W A;  2EJ4 A;  2EOJ A;  4R2C A;  2EMY A;  3M99 B;  2EL4 A;  4F6M A;  3EPH A;  2ENA A;  2WBU A;  2YU8 A;  2GHF A;  4IJD A;  4X9J A;  2EML A;  2EPU A;  2YTD A;  2WCC 3;  1BB8 A;  2E72 A;  2EQ0 A;  1YUJ A;  2YU5 A;  2EE8 A;  2YTE A;  2YSP A;  2GLI A;  4GZN C;  2MKN A;  2YTQ A;  2BB8 A;  2EOH A;  1ZU1 A;  5KL4 A;  2I13 A;  3EPJ A;  2EOY A;  4IS1 C;  2EPX A;  2ENC A;  1X6E A;  2JP9 A;  2YTG A;  2R1F A;  2EMF A;  2WBT A;  2DLK A;  2EN4 A;  5KL6 A;  2JPA A;  1JK2 A;  4WSG A;  4F6N A;  1ZAA C;  2CSH A;  2YSO A;  2EM2 A;  2M9A A;  1NCS A;  1JK1 A;  2EL5 A;  1A1K A;  2EM9 A;  2YRK A;  2PRT A;  2EM3 A;  1RMD A;  1A1J A;  1A1I A;  2EOF A;  2EN6 A;  3MHH C;  1WJP A;  1F2I G;  2EN8 A;  2EPR A;  2YTP A;  2EN3 A;  1X3C A;  3VHT B;  1AAY A;  1TF6 A;  1X6F A;  2LCE A;  2EOO A;  2YTO A;  4R2S A;  2EOS A;  2RPC A;  2EMX A;  2ELZ A;  4R2E A;  2WBS A;  1MEY C;  2EQ1 A;  2EN2 A;  2EMZ A;  2EOM A;  5KL7 A;  1UN6 B; 
#chains in the Genus database with same CATH topology
 1A1F A;  4JV5 E;  3JTZ A;  2EPA A;  1B69 A;  1YSA C;  2EWL A;  2RSM A;  1X48 A;  1A1L A;  1BBO A;  2M4I A;  5CFF E;  3OML A;  2WZO A;  2EPP A;  2B9D A;  3HPS A;  2LVH A;  2LRS A;  2EZ6 A;  1T4L B;  2UXB E;  4WFT A;  3HXL A;  2D9H A;  2MDG A;  2DGC A;  3THN A;  2L2N A;  4LF9 E;  2LUQ A;  4BMJ A;  4R2A A;  2NUF A;  2EMA A;  3J7A G;  1N3G A;  4DKK A;  2EOQ A;  2EM4 A;  2EOE A;  2EOZ A;  5AE2 A;  1T4N A;  1NEI A;  2RSI A;  4BHB A;  5AE3 A;  4B3T E;  4GKK E;  2MC5 A;  2IHR 1;  3HPZ A;  4JI0 E;  1HNW E;  2L2M A;  1WRJ A;  2V85 A;  4DV7 E;  1UIL A;  2EJ4 A;  4R2C A;  3EPH A;  2JWO A;  2BBG A;  2YU8 A;  4IJD A;  4X9J A;  2YTD A;  3DF6 A;  2E72 A;  2YT4 A;  2DIX A;  1T38 A;  2YU5 A;  1IMU A;  1GTK A;  3VK6 A;  2L6M A;  2BB8 A;  3MSW A;  4LFC E;  3TQM A;  2EOY A;  3IWC A;  1XMO E;  4RHB B;  4DR7 E;  2R1F A;  4WSP A;  3KWR A;  2DLK A;  4P7D A;  1YZ9 A;  5KL6 A;  4K0K E;  4NZV A;  2EM2 A;  2M9A A;  1GZ6 A;  4JI5 E;  2EM9 A;  2PRT A;  1GQE A;  2JYA A;  2G7H A;  2EN6 A;  3QG5 C;  2RQL A;  2ODR D;  2RTX A;  2EPR A;  3KZY A;  3J80 C;  2EN3 A;  2HC5 A;  3BGH A;  2FGG A;  2LCE A;  2LJH A;  3IWB A;  2EOO A;  4X8W A;  2EOS A;  1EH7 A;  4X62 E;  2EMX A;  4NXM E;  2I9I A;  4R2E A;  2WBS A;  1MEY C;  2EMZ A;  2EOM A;  3BF2 A;  3JAM C;  3OTO E;  2EM0 A;  2EOR A;  1N33 E;  2J7J A;  3HTX A;  5KL3 A;  4F9A B;  2M7Q A;  2EPN A;  4DV6 E;  4ZYG A;  5TSE A;  1J26 A;  2YWQ A;  2EPL X;  1QNT A;  4DR1 E;  2EMH A;  5F3W A;  1IQO A;  4MLQ A;  2YRH A;  3C6M A;  2EMG A;  2NAB A;  2EOX A;  2ELY A;  3K6Q A;  2VRD A;  2LTR A;  4DV0 E;  3T1Y E;  2DRP A;  2EN1 A;  4BHC A;  2MDR A;  2EMB A;  2EM6 A;  3C4B A;  4F9C B;  2CTD A;  2HJJ A;  3ADL A;  3EPK A;  1SFE A;  5LLQ A;  2R76 A;  5KL5 A;  1G2D C;  2EMI A;  2EPZ A;  3AV0 A;  4BC7 A;  3VYY A;  1EH8 A;  1G2F C;  2EP3 A;  2DLQ A;  4JI6 E;  2LO3 A;  2YZT A;  4LTY A;  4ZYE A;  1Z1B A;  2EPC A;  2EPK X;  1N34 E;  4NXN E;  4O43 A;  2KOU A;  2EOJ A;  2F8B A;  4L5N C;  2EMY A;  3M99 B;  2EL4 A;  2YPN A;  5AC4 A;  2NUG A;  2L8T A;  4WPY A;  2WBU A;  3T1H E;  2WCC 3;  2EE8 A;  1PJS A;  2YSP A;  5A6B A;  3ADG A;  4GZN C;  2YTQ A;  4JI7 E;  5DNY A;  2V89 A;  2MKN A;  1ZU1 A;  1HNX E;  2LMZ A;  1IQS A;  2LBS B;  4YHH E;  2JXP A;  2DMY A;  3EQ1 A;  4B3M E;  4ZYH A;  2JP9 A;  2L2K B;  4P78 A;  2UUB E;  2WBT A;  3F6G A;  4WSG A;  4X65 E;  1ZAA C;  5FLX C;  1A1K A;  1NCS A;  1RMD A;  4ZYD A;  4OOG C;  2Q8U A;  3VYX A;  1UHZ A;  2L3C A;  2YTP A;  1X3C A;  5IV8 B;  4LF7 E;  2L33 A;  2VQE E;  1X6F A;  4DMI A;  4M30 A;  2MC6 A;  2LE2 A;  2V88 A;  5AE1 A;  3C4T A;  2L92 A;  2B7V A;  1DI2 A;  3LLH A;  1PDA A;  4LF8 E;  4O24 A;  4R8O A;  2CPN A;  1DGC A;  1I94 E;  4WXC A;  4TUG A;  4DUZ E;  2L3J A;  2FTX B;  2ADR A;  2EMC A;  1HNZ E;  3ADJ A;  2MKD A;  2DMI A;  2JOX A;  1YYO A;  4JI8 E;  2EOI A;  3MHS C;  1SR9 A;  3UK3 C;  1IBL E;  4YY3 E;  3HQ1 A;  5LMN E;  4J8Z A;  2EQ3 A;  2EL6 A;  1LLM C;  2EN7 A;  2EM7 A;  2LV2 A;  4MLV A;  4WYQ B;  2RS6 A;  1MGT A;  2V87 A;  4L8N A;  1STU A;  2HGH A;  5IXM B;  2KON A;  3L00 A;  2ODR C;  4LF5 E;  5A2Q C;  2A25 A;  4X66 E;  2JR1 A;  2V86 A;  1PJT A;  4R2Q A;  1FKA E;  4LFA E;  3H09 A;  2UU9 E;  1L4S A;  4DV1 E;  4DV2 E;  1ZBT A;  4F9B B;  2EMW A;  4I8O A;  2N3H A;  1ZR9 A;  4R2P A;  2LTS A;  4NHR A;  3EPL A;  3ADI A;  5ADZ A;  1IBK E;  4M2Z A;  4F6M A;  2ENA A;  3AUZ A;  1T39 A;  4HEI A;  2N8X A;  1BB8 A;  2EPU A;  4X64 E;  1YFH A;  4DV4 E;  1YUJ A;  4DUY E;  5BR8 E;  2YTE A;  2GLI A;  1PKP A;  2EOH A;  2I13 A;  2V83 A;  3C6K A;  2GPI A;  2K7I A;  1X6E A;  2JOB A;  4O4K A;  4KHP E;  4BC9 A;  1X49 A;  2EMF A;  4AQY E;  4DR6 E;  3KZZ A;  5T6J A;  1JK2 A;  2CSH A;  2YSO A;  1JK1 A;  4HTG A;  5LMU E;  2EM3 A;  3DJW A;  4M0V A;  4RH8 A;  2VQF E;  4LF4 E;  2EOF A;  3MHH C;  4JI4 E;  1YYW A;  4JI3 E;  2EN8 A;  3JU0 A;  2DB2 A;  3VHT B;  2K4V A;  4BCA A;  4DR2 E;  4O5G A;  2E5L E;  4BBY A;  4BS9 A;  2ELZ A;  3THO B;  4DR4 E;  2LUP B;  4DR3 E;  4N4R B;  2EN2 A;  2FV4 B;  5KL7 A;  1UN6 B;  4JI1 E;  1X6H A;  2B3T B;  5KL2 A;  2CT1 A;  2M1S A;  2ZM6 E;  5A6K A;  1DQ3 A;  4Q35 B;  4B3S E;  2YTF A;  2EM5 A;  4M9V C;  2VF1 A;  5IT9 C;  1IBM E;  5A6A A;  1T4O A;  4OX9 E;  5AAS A;  1N32 E;  3IWD A;  2LT7 A;  4DV5 E;  1HR0 E;  4R2R A;  2KHX A;  4F54 A;  1TF3 A;  1AH5 A;  4DR5 E;  1YPN A;  4TUI A;  2B7T A;  2UXD E;  5A69 A;  4F2J C;  1TN9 A;  2ENH A;  1ZBQ A;  4LF6 E;  2EM8 A;  2UXC E;  1WHQ A;  1UBD C;  2RS7 A;  1A1G A;  3J7Y p;  1N36 E;  2V8Q B;  2YTN A;  1X47 A;  3J81 C;  3BBG A;  4DV3 E;  1YUI A;  1WHN A;  1P47 A;  2UUA E;  2YTJ A;  2YRM A;  1A1H A;  2EMK A;  4FK5 C;  1YYK A;  2JY9 A;  2N3G A;  4R2D A;  5A6J A;  2EPO A;  2YTI A;  1XMQ E;  1X5W A;  1EKZ A;  2EPM X;  3ECR A;  5A6B D;  2GHF A;  2LJU A;  2EML A;  2EQ0 A;  3ZOQ B;  5IWA E;  5LL6 R;  4R03 A;  4JI2 E;  1WXR A;  4JYA E;  5KL4 A;  1FJG E;  2VE7 C;  3EPJ A;  4IS1 C;  2EPX A;  2ENC A;  4LU9 A;  3BID A;  3RMP A;  2YTG A;  2NUE A;  2EN4 A;  1J5E E;  2JPA A;  1O0W A;  4F6N A;  4KWY A;  2E1M A;  2EL5 A;  4Q28 A;  3F6H A;  4GKJ E;  2YRK A;  2JVA A;  1A1J A;  4GEQ B;  1A1I A;  3FIG A;  4KZS A;  1KYQ A;  1RQ0 A;  2H36 X;  1WJP A;  2UUC E;  5AC5 A;  1F2I G;  3P1X A;  1PJQ A;  1EH6 A;  1AAY A;  1TF6 A;  1XNR E;  3LML A;  1BBG A;  4WXD A;  1QU6 A;  2F4V E;  2YTO A;  4B3R E;  2DSY A;  4R2S A;  1RC7 A;  4LFB E;  2RPC A;  1XNQ E;  2HHH E;  2NA2 A;  2EQ1 A;  1KJK A;  4WX9 A; 
#chains in the Genus database with same CATH homology
 1A1F A;  1DGC A;  1X6H A;  5KL2 A;  2CT1 A;  2EPA A;  1B69 A;  1YSA C;  2EM0 A;  2EOR A;  2YTF A;  1A1L A;  2J7J A;  2ADR A;  2EM5 A;  4M9V C;  2EMC A;  1BBO A;  5KL3 A;  2MKD A;  2DMI A;  2EOI A;  2LT7 A;  2EPP A;  3MHS C;  4R2R A;  1TF3 A;  2LVH A;  3UK3 C;  1KJK A;  2EQ3 A;  2EL6 A;  1LLM C;  2EN7 A;  2D9H A;  2EM7 A;  2LV2 A;  2MDG A;  2EMH A;  2DGC A;  2YRH A;  4F2J C;  2EMG A;  2HGH A;  2NAB A;  1TN9 A;  2ENH A;  2EM8 A;  2EOX A;  2ELY A;  2VRD A;  1UBD C;  2A25 A;  1A1G A;  4R2A A;  4R2Q A;  2EMA A;  2DRP A;  2YTN A;  2EN1 A;  2EMB A;  2EM6 A;  2EOQ A;  2EM4 A;  2CTD A;  2EOE A;  2EOZ A;  3EPK A;  1YUI A;  1G2D C;  5KL5 A;  1P47 A;  2RSI A;  2EMI A;  2YTJ A;  2EPZ A;  2YRM A;  1A1H A;  2EMK A;  4FK5 C;  2EMW A;  4R2D A;  1G2F C;  2EP3 A;  2DLQ A;  2LO3 A;  1ZR9 A;  1Z1B A;  2EPC A;  2YTI A;  4R2P A;  3EPL A;  1X5W A;  2EJ4 A;  2EOJ A;  4R2C A;  2EMY A;  3M99 B;  2EL4 A;  4F6M A;  3EPH A;  2ENA A;  2WBU A;  2YU8 A;  2GHF A;  4IJD A;  4X9J A;  2EML A;  2EPU A;  2YTD A;  2WCC 3;  1BB8 A;  2E72 A;  2EQ0 A;  1YUJ A;  2YU5 A;  2EE8 A;  2YTE A;  2YSP A;  2GLI A;  4GZN C;  2MKN A;  2YTQ A;  2BB8 A;  2EOH A;  1ZU1 A;  5KL4 A;  2I13 A;  3EPJ A;  2EOY A;  4IS1 C;  2EPX A;  2ENC A;  1X6E A;  2JP9 A;  2YTG A;  2R1F A;  2EMF A;  2WBT A;  2DLK A;  2EN4 A;  5KL6 A;  2JPA A;  1JK2 A;  4WSG A;  4F6N A;  1ZAA C;  2CSH A;  2YSO A;  2EM2 A;  2M9A A;  1NCS A;  1JK1 A;  2EL5 A;  1A1K A;  2EM9 A;  2YRK A;  2PRT A;  2EM3 A;  1RMD A;  1A1J A;  1A1I A;  2EOF A;  2EN6 A;  3MHH C;  1WJP A;  1F2I G;  2EN8 A;  2EPR A;  2YTP A;  2EN3 A;  1X3C A;  3VHT B;  1AAY A;  1TF6 A;  1X6F A;  2LCE A;  2EOO A;  2YTO A;  4R2S A;  2EOS A;  2RPC A;  2EMX A;  2ELZ A;  4R2E A;  2WBS A;  1MEY C;  2EQ1 A;  2EN2 A;  2EMZ A;  2EOM A;  5KL7 A;  1UN6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...