2EMXA

Solution structure of the c2h2 type zinc finger (region 273-303) of human zinc finger protein 268
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
44
structure length
44
Chain Sequence
GSSGSSGEKPFGCSCCEKAFSSKSYLLVHQQTHAEEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 273-303) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 268
total genus 8
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emxA01
2EOQA 2EM5A 2EN6A 1KJKA 2EOXA 3MHSC 2EOOA 4R2CA 2I13A 1TF3A 1NCSA 2YTOA 2EMCA 1X6FA 2EMFA 1UBDC 2YTEA 1A1IA 2JP9A 1DGCA 5KL5A 2EQ3A 2EM3A 2DLKA 2EM7A 2EORA 2YRHA 2ENHA 2YRKA 4R2QA 3UK3C 1A1JA 1B69A 1A1FA 2YTFA 2EOFA 4F6MA 2HGHA 4WSGA 1X6HA 2EMWA 2EM6A 2GHFA 2EPUA 2J7JA 2YU5A 2VRDA 1BBOA 2EM9A 2LO3A 2A25A 2PRTA 2EN8A 2EL6A 1X3CA 1UN6B 1BB8A 2EP3A 2ADRA 2WCC3 2EPCA 1Z1BA 2E72A 2JPAA 1P47A 1A1GA 3MHHC 5KL2A 1G2FC 2EQ1A 4IS1C 2DLQA 2EMLA 1TF6A 2EL4A 2EOJA 2RSIA 2YSOA 1WJPA 2RPCA 2WBUA 2YTDA 2ELYA 4M9VC 2EM4A 2EN3A 2LCEA 2YTQA 2CSHA 2EMAA 1X5WA 2EPAA 2DRPA 2ENCA 2EN4A 2EMKA 2ENAA 2YTIA 2ELZA 1RMDA 5KL6A 2BB8A 1YUIA 1YSAC 1F2IG 5KL7A 2EOIA 1MEYC 1YUJA 1A1KA 2CTDA 2CT1A 2EMGA 1ZU1A 4F2JC 2DMIA 2R1FA 1AAYA 2EJ4A 1X6EA 1JK2A 2EOMA 2EOZA 2EQ0A 2LV2A 4F6NA 1A1LA 2YRMA 4IJDA 4R2RA 2EN7A 2EOSA 2YTGA 2YTNA 2EM0A 2EN1A 2EPXA 1A1HA 1TN9A 2EE8A 2EN2A 4R2AA 2WBSA 2EPZA 4R2DA 2WBTA 2EMYA 5KL3A 2MKNA 5KL4A 2D9HA 2EM8A 2EOYA 2EMXA 2YSPA 3EPLA 2EOHA 2MDGA 3M99B 1JK1A 2EM2A 2GLIA 2YTJA 1ZR9A 2LVHA 2EOEA 1ZAAC 1G2DC 2EPPA 4X9JA 2NABA 4GZNC 3EPKA 2LT7A 3VHTB 2YTPA 1LLMC 2MKDA 2EPRA 4R2EA 4R2SA 3EPHA 3EPJA 2EMBA 4FK5C 2EMIA 2M9AA 4R2PA 2DGCA 2EL5A 2YU8A 2EMHA 2EMZA
chains in the Genus database with same CATH superfamily
4DR2E 1FJGE 3OTOE 2EN6A 2HJJA 4R2CA 2NUGA 2EWLA 2V88A 3MSWA 4LU9A 2EMFA 1UBDC 4B3ME 2Q8UA 5KL5A 3QG5C 2EORA 2DLKA 1A1JA 3ADLA 2ENHA 3J80C 2EOFA 3EQ1A 5LL6R 2UXCE 1YYKA 2EPUA 4GEQB 2EPLX 1AH5A 2A25A 4DR6E 2EN8A 2L33A 4R8OA 4K0KE 2VE7C 4BMJA 2ADRA 4F9AB 5A2QC 2WCC3 4DV5E 4DV4E 1WHQA 2JPAA 4M30A 2E1MA 1A1GA 3K6QA 1I94E 3JTZA 4MLQA 3DJWA 1G2FC 4DR4E 3BIDA 2EL4A 1BBGA 4YHHE 2I9IA 5AE3A 2BBGA 3ZOQB 2B3TB 2EMAA 3C4BA 1IBKE 3LMLA 3LLHA 2RTXA 2VF1A 1YUIA 4J8ZA 3RMPA 3KZZA 3OMLA 1IQOA 4F2JC 4P78A 4DV2E 2KOUA 4DR5E 2K7IA 2YWQA 4JYAE 2YRMA 4R03A 4IJDA 5AC4A 2EPXA 4OOGC 2LUQA 4WPYA 2WBTA 1HNZE 2EMYA 2KONA 5ADZA 2KHXA 4LF4E 2JYAA 1IQSA 2EMXA 4BHBA 2JY9A 2V8QB 2MDGA 3ADJA 4B3RE 1JK1A 2YTJA 3J7Yp 2LVHA 1ZAAC 1G2DC 4X9JA 5IV8B 4JI6E 4WFTA 4WYQB 3EPKA 4GKKE 4X64E 2H36X 1SFEA 4R2SA 3KZYA 3TQMA 2B7VA 2MC5A 4O5GA 2YZTA 1MGTA 2JWOA 4JI5E 2YU8A 2EMZA 3THNA 1KJKA 4NXNE 4WXDA 2ODRC 4BHCA 2YTOA 1X6FA 4B3SE 2EM3A 5A6JA 3UK3C 2DIXA 3ECRA 4JI8E 1PJSA 3J81C 2WZOA 4HEIA 4I8OA 4BCAA 4WSGA 2EMWA 3JU0A 2VQFE 4LF5E 4DV1E 2YU5A 2VRDA 2EM9A 1WRJA 4YY3E 4M2ZA 4LTYA 2UUBE 4LFAE 2LMZA 2EP3A 4DV6E 1Z1BA 4ZYEA 2R76A 4JI1E 5AC5A 1P47A 3MHHC 4DV7E 2JVAA 3IWDA 5KL2A 1N33E 2V89A 4IS1C 2DLQA 3J7AG 2RSIA 1N36E 2JR1A 1XMOE 2UXBE 2RPCA 2EPNA 2ELYA 4M9VC 2EM4A 2RQLA 1ZBQA 4ZYDA 2EN4A 2ENCA 4RH8A 2ENAA 1YPNA 2JXPA 2ELZA 1RMDA 5AE1A 4X62E 2BB8A 5LMUE 1KYQA 2YT4A 1MEYC 4TUGA 1IBME 1A1KA 2L3JA 2CTDA 1ZU1A 1AAYA 2R1FA 3C6MA 5A69A 4OX9E 1X6EA 1JK2A 2EOZA 5A6BA 2UUCE 3L00A 4R2RA 3VYYA 5TSEA 1DQ3A 2YTNA 5LLQA 1WXRA 4DUYE 1A1HA 1TN9A 1T4OA 1L4SA 2EN2A 4R2AA 5A6AA 4HTGA 2MDRA 2V86A 2FTXB 5KL3A 1HR0E 5T6JA 2MKNA 1YYWA 2CPNA 4ZYGA 2L2KB 3M99B 4X66E 2EM2A 2GLIA 1FKAE 1ZR9A 4X65E 2V87A 3HXLA 4JV5E 5A6KA 3AV0A 2LBSB 5CFFE 2LT7A 1YZ9A 4LF8E 2MKDA 2EPRA 2JOBA 3HPSA 4JI2E 4M0VA 3EPHA 2F4VE 3BBGA 2EMIA 2L8TA 5FLXC 2UUAE 2M4IA 4R2PA 1EH7A 2EL5A 2EOQA 2EM5A 2EOXA 2RS6A 3MHSC 2MC6A 2I13A 2EMCA 1T38A 1X47A 2RS7A 4BS9A 1DGCA 2JP9A 2EQ3A 4GKJE 2EM7A 2YRHA 4R2QA 3HTXA 2M1SA 2F8BA 4TUIA 4JI0E 1B69A 1IMUA 2YTFA 3IWCA 2B7TA 2HGHA 1X6HA 2GHFA 4LFBE 1XMQE 4LFCE 2PRTA 1UN6B 3HPZA 3T1YE 4WXCA 2YPNA 1XNQE 1BB8A 1EKZA 2EPCA 2ODRD 4DUZE 4DR3E 2VQEE 4BBYA 5IWAE 2EMLA 4NXME 5F3WA 3HQ1A 4O24A 2WBUA 4WSPA 2EPMX 1J5EE 5IXMB 2YTQA 2JOXA 1GTKA 2CSHA 3JAMC 4O4KA 4LF6E 1X5WA 2EPAA 2DRPA 2N3GA 1HNXE 3IWBA 2YTIA 2L6MA 4DMIA 2LE2A 1F2IG 1YSAC 1PKPA 2EOIA 5KL7A 3VYXA 1YUJA 3FIGA 2B9DA 2ZM6E 2EMGA 2E5LE 3ADGA 4NHRA 2EJ4A 4N4RB 3VK6A 4ZYHA 2LV2A 4F6NA 1A1LA 5AASA 2EN7A 2EOSA 2RSMA 4WX9A 1GZ6A 2EN1A 2DSYA 2EE8A 2L3CA 2WBSA 2EPZA 3ADIA 1N3GA 3P1XA 1EH6A 4F54A 2YSPA 2EOHA 3H09A 2NUFA 2DMYA 1PJTA 2DB2A 2EPPA 1RQ0A 3BGHA 1J26A 1IBLE 2LRSA 4F9BB 4NZVA 2FGGA 4Q35B 1X48A 1PJQA 2V83A 3VHTB 4MLVA 5A6BD 1T4LB 4FK5C 2LUPB 1SR9A 2N8XA 1RC7A 4LF7E 2DGCA 3C6KA 1O0WA 2EOOA 1TF3A 1NCSA 3AUZA 2YTEA 1A1IA 1XNRE 4BC9A 2YRKA 1A1FA 4F6MA 2UXDE 4KWYA 1NEIA 2EM6A 2J7JA 4B3TE 1BBOA 2EPKX 2LO3A 2K4VA 3KWRA 2EL6A 1X3CA 2LJUA 1UHZA 2NUEA 2L2MA 1UILA 1T4NA 2EPOA 4Q28A 4KZSA 4DKKA 4P7DA 2E72A 4JI3E 1QNTA 2NA2A 2EQ1A 4L5NC 1N34E 4F9CB 1TF6A 2EOJA 2YSOA 3T1HE 1WJPA 3BF2A 2YTDA 4JI7E 5DNYA 2EN3A 2LCEA 2LJHA 2M7QA 5BR8E 4DV0E 2EMKA 4AQYE 3F6HA 5KL6A 1T39A 2EZ6A 1QU6A 2LTSA 2IHR1 2HHHE 2CT1A 2DMIA 4BC7A 5IT9C 2UU9E 2LTRA 2V85A 2EOMA 2EQ0A 3C4TA 2GPIA 1DI2A 3F6GA 1GQEA 2YTGA 5LMNE 2EM0A 2FV4B 4X8WA 1YFHA 4RHBB 4R2DA 5KL4A 3DF6A 2D9HA 4LF9E 2EM8A 2EOYA 1ZBTA 3EPLA 4DV3E 4JI4E 2HC5A 1WHNA 1STUA 4O43A 5AE2A 2L92A 3THOB 2EOEA 2N3HA 4KHPE 1HNWE 2NABA 4DR1E 1YYOA 4GZNC 1X49A 2G7HA 2YTPA 1PDAA 1LLMC 1N32E 4R2EA 4L8NA 4DR7E 3EPJA 1EH8A 2EMBA 2L2NA 2M9AA 2EMHA
chains in the Genus database with same CATH topology
2EOQA 2EM5A 2EN6A 1KJKA 2EOXA 3MHSC 2EOOA 4R2CA 2I13A 1TF3A 1NCSA 2YTOA 2EMCA 1X6FA 2EMFA 1UBDC 2YTEA 1A1IA 2JP9A 1DGCA 5KL5A 2EQ3A 2EM3A 2DLKA 2EM7A 2EORA 2YRHA 2ENHA 2YRKA 4R2QA 3UK3C 1A1JA 1B69A 1A1FA 2YTFA 2EOFA 4F6MA 2HGHA 4WSGA 1X6HA 2EMWA 2EM6A 2GHFA 2EPUA 2J7JA 2YU5A 2VRDA 1BBOA 2EM9A 2LO3A 2A25A 2PRTA 2EN8A 2EL6A 1X3CA 1UN6B 1BB8A 2EP3A 2ADRA 2WCC3 2EPCA 1Z1BA 2E72A 2JPAA 1P47A 1A1GA 3MHHC 5KL2A 1G2FC 2EQ1A 4IS1C 2DLQA 2EMLA 1TF6A 2EL4A 2EOJA 2RSIA 2YSOA 1WJPA 2RPCA 2WBUA 2YTDA 2ELYA 4M9VC 2EM4A 2EN3A 2LCEA 2YTQA 2CSHA 2EMAA 1X5WA 2EPAA 2DRPA 2ENCA 2EN4A 2EMKA 2ENAA 2YTIA 2ELZA 1RMDA 5KL6A 2BB8A 1YUIA 1YSAC 1F2IG 5KL7A 2EOIA 1MEYC 1YUJA 1A1KA 2CTDA 2CT1A 2EMGA 1ZU1A 4F2JC 2DMIA 2R1FA 1AAYA 2EJ4A 1X6EA 1JK2A 2EOMA 2EOZA 2EQ0A 2LV2A 4F6NA 1A1LA 2YRMA 4IJDA 4R2RA 2EN7A 2EOSA 2YTGA 2YTNA 2EM0A 2EN1A 2EPXA 1A1HA 1TN9A 2EE8A 2EN2A 4R2AA 2WBSA 2EPZA 4R2DA 2WBTA 2EMYA 5KL3A 2MKNA 5KL4A 2D9HA 2EM8A 2EOYA 2EMXA 2YSPA 3EPLA 2EOHA 2MDGA 3M99B 1JK1A 2EM2A 2GLIA 2YTJA 1ZR9A 2LVHA 2EOEA 1ZAAC 1G2DC 2EPPA 4X9JA 2NABA 4GZNC 3EPKA 2LT7A 3VHTB 2YTPA 1LLMC 2MKDA 2EPRA 4R2EA 4R2SA 3EPHA 3EPJA 2EMBA 4FK5C 2EMIA 2M9AA 4R2PA 2DGCA 2EL5A 2YU8A 2EMHA 2EMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOQ A;  2EM5 A;  2EN6 A;  1KJK A;  2EOX A;  3MHS C;  2EOO A;  4R2C A;  2I13 A;  1TF3 A;  1NCS A;  2YTO A;  2EMC A;  1X6F A;  2EMF A;  1UBD C;  2YTE A;  1A1I A;  2JP9 A;  1DGC A;  5KL5 A;  2EQ3 A;  2EM3 A;  2DLK A;  2EM7 A;  2EOR A;  2YRH A;  2ENH A;  2YRK A;  4R2Q A;  3UK3 C;  1A1J A;  1B69 A;  1A1F A;  2YTF A;  2EOF A;  4F6M A;  2HGH A;  4WSG A;  1X6H A;  2EMW A;  2EM6 A;  2GHF A;  2EPU A;  2J7J A;  2YU5 A;  2VRD A;  1BBO A;  2EM9 A;  2LO3 A;  2A25 A;  2PRT A;  2EN8 A;  2EL6 A;  1X3C A;  1UN6 B;  1BB8 A;  2EP3 A;  2ADR A;  2WCC 3;  2EPC A;  1Z1B A;  2E72 A;  2JPA A;  1P47 A;  1A1G A;  3MHH C;  5KL2 A;  1G2F C;  2EQ1 A;  4IS1 C;  2DLQ A;  2EML A;  1TF6 A;  2EL4 A;  2EOJ A;  2RSI A;  2YSO A;  1WJP A;  2RPC A;  2WBU A;  2YTD A;  2ELY A;  4M9V C;  2EM4 A;  2EN3 A;  2LCE A;  2YTQ A;  2CSH A;  2EMA A;  1X5W A;  2EPA A;  2DRP A;  2ENC A;  2EN4 A;  2EMK A;  2ENA A;  2YTI A;  2ELZ A;  1RMD A;  5KL6 A;  2BB8 A;  1YUI A;  1YSA C;  1F2I G;  5KL7 A;  2EOI A;  1MEY C;  1YUJ A;  1A1K A;  2CTD A;  2CT1 A;  2EMG A;  1ZU1 A;  4F2J C;  2DMI A;  2R1F A;  1AAY A;  2EJ4 A;  1X6E A;  1JK2 A;  2EOM A;  2EOZ A;  2EQ0 A;  2LV2 A;  4F6N A;  1A1L A;  2YRM A;  4IJD A;  4R2R A;  2EN7 A;  2EOS A;  2YTG A;  2YTN A;  2EM0 A;  2EN1 A;  2EPX A;  1A1H A;  1TN9 A;  2EE8 A;  2EN2 A;  4R2A A;  2WBS A;  2EPZ A;  4R2D A;  2WBT A;  2EMY A;  5KL3 A;  2MKN A;  5KL4 A;  2D9H A;  2EM8 A;  2EOY A;  2EMX A;  2YSP A;  3EPL A;  2EOH A;  2MDG A;  3M99 B;  1JK1 A;  2EM2 A;  2GLI A;  2YTJ A;  1ZR9 A;  2LVH A;  2EOE A;  1ZAA C;  1G2D C;  2EPP A;  4X9J A;  2NAB A;  4GZN C;  3EPK A;  2LT7 A;  3VHT B;  2YTP A;  1LLM C;  2MKD A;  2EPR A;  4R2E A;  4R2S A;  3EPH A;  3EPJ A;  2EMB A;  4FK5 C;  2EMI A;  2M9A A;  4R2P A;  2DGC A;  2EL5 A;  2YU8 A;  2EMH A;  2EMZ A; 
#chains in the Genus database with same CATH topology
 4DR2 E;  1FJG E;  3OTO E;  2EN6 A;  2HJJ A;  4R2C A;  2NUG A;  2EWL A;  2V88 A;  3MSW A;  4LU9 A;  2EMF A;  1UBD C;  4B3M E;  2Q8U A;  5KL5 A;  3QG5 C;  2EOR A;  2DLK A;  1A1J A;  3ADL A;  2ENH A;  3J80 C;  2EOF A;  3EQ1 A;  5LL6 R;  2UXC E;  1YYK A;  2EPU A;  4GEQ B;  2EPL X;  1AH5 A;  2A25 A;  4DR6 E;  2EN8 A;  2L33 A;  4R8O A;  4K0K E;  2VE7 C;  4BMJ A;  2ADR A;  4F9A B;  5A2Q C;  2WCC 3;  4DV5 E;  4DV4 E;  1WHQ A;  2JPA A;  4M30 A;  2E1M A;  1A1G A;  3K6Q A;  1I94 E;  3JTZ A;  4MLQ A;  3DJW A;  1G2F C;  4DR4 E;  3BID A;  2EL4 A;  1BBG A;  4YHH E;  2I9I A;  5AE3 A;  2BBG A;  3ZOQ B;  2B3T B;  2EMA A;  3C4B A;  1IBK E;  3LML A;  3LLH A;  2RTX A;  2VF1 A;  1YUI A;  4J8Z A;  3RMP A;  3KZZ A;  3OML A;  1IQO A;  4F2J C;  4P78 A;  4DV2 E;  2KOU A;  4DR5 E;  2K7I A;  2YWQ A;  4JYA E;  2YRM A;  4R03 A;  4IJD A;  5AC4 A;  2EPX A;  4OOG C;  2LUQ A;  4WPY A;  2WBT A;  1HNZ E;  2EMY A;  2KON A;  5ADZ A;  2KHX A;  4LF4 E;  2JYA A;  1IQS A;  2EMX A;  4BHB A;  2JY9 A;  2V8Q B;  2MDG A;  3ADJ A;  4B3R E;  1JK1 A;  2YTJ A;  3J7Y p;  2LVH A;  1ZAA C;  1G2D C;  4X9J A;  5IV8 B;  4JI6 E;  4WFT A;  4WYQ B;  3EPK A;  4GKK E;  4X64 E;  2H36 X;  1SFE A;  4R2S A;  3KZY A;  3TQM A;  2B7V A;  2MC5 A;  4O5G A;  2YZT A;  1MGT A;  2JWO A;  4JI5 E;  2YU8 A;  2EMZ A;  3THN A;  1KJK A;  4NXN E;  4WXD A;  2ODR C;  4BHC A;  2YTO A;  1X6F A;  4B3S E;  2EM3 A;  5A6J A;  3UK3 C;  2DIX A;  3ECR A;  4JI8 E;  1PJS A;  3J81 C;  2WZO A;  4HEI A;  4I8O A;  4BCA A;  4WSG A;  2EMW A;  3JU0 A;  2VQF E;  4LF5 E;  4DV1 E;  2YU5 A;  2VRD A;  2EM9 A;  1WRJ A;  4YY3 E;  4M2Z A;  4LTY A;  2UUB E;  4LFA E;  2LMZ A;  2EP3 A;  4DV6 E;  1Z1B A;  4ZYE A;  2R76 A;  4JI1 E;  5AC5 A;  1P47 A;  3MHH C;  4DV7 E;  2JVA A;  3IWD A;  5KL2 A;  1N33 E;  2V89 A;  4IS1 C;  2DLQ A;  3J7A G;  2RSI A;  1N36 E;  2JR1 A;  1XMO E;  2UXB E;  2RPC A;  2EPN A;  2ELY A;  4M9V C;  2EM4 A;  2RQL A;  1ZBQ A;  4ZYD A;  2EN4 A;  2ENC A;  4RH8 A;  2ENA A;  1YPN A;  2JXP A;  2ELZ A;  1RMD A;  5AE1 A;  4X62 E;  2BB8 A;  5LMU E;  1KYQ A;  2YT4 A;  1MEY C;  4TUG A;  1IBM E;  1A1K A;  2L3J A;  2CTD A;  1ZU1 A;  1AAY A;  2R1F A;  3C6M A;  5A69 A;  4OX9 E;  1X6E A;  1JK2 A;  2EOZ A;  5A6B A;  2UUC E;  3L00 A;  4R2R A;  3VYY A;  5TSE A;  1DQ3 A;  2YTN A;  5LLQ A;  1WXR A;  4DUY E;  1A1H A;  1TN9 A;  1T4O A;  1L4S A;  2EN2 A;  4R2A A;  5A6A A;  4HTG A;  2MDR A;  2V86 A;  2FTX B;  5KL3 A;  1HR0 E;  5T6J A;  2MKN A;  1YYW A;  2CPN A;  4ZYG A;  2L2K B;  3M99 B;  4X66 E;  2EM2 A;  2GLI A;  1FKA E;  1ZR9 A;  4X65 E;  2V87 A;  3HXL A;  4JV5 E;  5A6K A;  3AV0 A;  2LBS B;  5CFF E;  2LT7 A;  1YZ9 A;  4LF8 E;  2MKD A;  2EPR A;  2JOB A;  3HPS A;  4JI2 E;  4M0V A;  3EPH A;  2F4V E;  3BBG A;  2EMI A;  2L8T A;  5FLX C;  2UUA E;  2M4I A;  4R2P A;  1EH7 A;  2EL5 A;  2EOQ A;  2EM5 A;  2EOX A;  2RS6 A;  3MHS C;  2MC6 A;  2I13 A;  2EMC A;  1T38 A;  1X47 A;  2RS7 A;  4BS9 A;  1DGC A;  2JP9 A;  2EQ3 A;  4GKJ E;  2EM7 A;  2YRH A;  4R2Q A;  3HTX A;  2M1S A;  2F8B A;  4TUI A;  4JI0 E;  1B69 A;  1IMU A;  2YTF A;  3IWC A;  2B7T A;  2HGH A;  1X6H A;  2GHF A;  4LFB E;  1XMQ E;  4LFC E;  2PRT A;  1UN6 B;  3HPZ A;  3T1Y E;  4WXC A;  2YPN A;  1XNQ E;  1BB8 A;  1EKZ A;  2EPC A;  2ODR D;  4DUZ E;  4DR3 E;  2VQE E;  4BBY A;  5IWA E;  2EML A;  4NXM E;  5F3W A;  3HQ1 A;  4O24 A;  2WBU A;  4WSP A;  2EPM X;  1J5E E;  5IXM B;  2YTQ A;  2JOX A;  1GTK A;  2CSH A;  3JAM C;  4O4K A;  4LF6 E;  1X5W A;  2EPA A;  2DRP A;  2N3G A;  1HNX E;  3IWB A;  2YTI A;  2L6M A;  4DMI A;  2LE2 A;  1F2I G;  1YSA C;  1PKP A;  2EOI A;  5KL7 A;  3VYX A;  1YUJ A;  3FIG A;  2B9D A;  2ZM6 E;  2EMG A;  2E5L E;  3ADG A;  4NHR A;  2EJ4 A;  4N4R B;  3VK6 A;  4ZYH A;  2LV2 A;  4F6N A;  1A1L A;  5AAS A;  2EN7 A;  2EOS A;  2RSM A;  4WX9 A;  1GZ6 A;  2EN1 A;  2DSY A;  2EE8 A;  2L3C A;  2WBS A;  2EPZ A;  3ADI A;  1N3G A;  3P1X A;  1EH6 A;  4F54 A;  2YSP A;  2EOH A;  3H09 A;  2NUF A;  2DMY A;  1PJT A;  2DB2 A;  2EPP A;  1RQ0 A;  3BGH A;  1J26 A;  1IBL E;  2LRS A;  4F9B B;  4NZV A;  2FGG A;  4Q35 B;  1X48 A;  1PJQ A;  2V83 A;  3VHT B;  4MLV A;  5A6B D;  1T4L B;  4FK5 C;  2LUP B;  1SR9 A;  2N8X A;  1RC7 A;  4LF7 E;  2DGC A;  3C6K A;  1O0W A;  2EOO A;  1TF3 A;  1NCS A;  3AUZ A;  2YTE A;  1A1I A;  1XNR E;  4BC9 A;  2YRK A;  1A1F A;  4F6M A;  2UXD E;  4KWY A;  1NEI A;  2EM6 A;  2J7J A;  4B3T E;  1BBO A;  2EPK X;  2LO3 A;  2K4V A;  3KWR A;  2EL6 A;  1X3C A;  2LJU A;  1UHZ A;  2NUE A;  2L2M A;  1UIL A;  1T4N A;  2EPO A;  4Q28 A;  4KZS A;  4DKK A;  4P7D A;  2E72 A;  4JI3 E;  1QNT A;  2NA2 A;  2EQ1 A;  4L5N C;  1N34 E;  4F9C B;  1TF6 A;  2EOJ A;  2YSO A;  3T1H E;  1WJP A;  3BF2 A;  2YTD A;  4JI7 E;  5DNY A;  2EN3 A;  2LCE A;  2LJH A;  2M7Q A;  5BR8 E;  4DV0 E;  2EMK A;  4AQY E;  3F6H A;  5KL6 A;  1T39 A;  2EZ6 A;  1QU6 A;  2LTS A;  2IHR 1;  2HHH E;  2CT1 A;  2DMI A;  4BC7 A;  5IT9 C;  2UU9 E;  2LTR A;  2V85 A;  2EOM A;  2EQ0 A;  3C4T A;  2GPI A;  1DI2 A;  3F6G A;  1GQE A;  2YTG A;  5LMN E;  2EM0 A;  2FV4 B;  4X8W A;  1YFH A;  4RHB B;  4R2D A;  5KL4 A;  3DF6 A;  2D9H A;  4LF9 E;  2EM8 A;  2EOY A;  1ZBT A;  3EPL A;  4DV3 E;  4JI4 E;  2HC5 A;  1WHN A;  1STU A;  4O43 A;  5AE2 A;  2L92 A;  3THO B;  2EOE A;  2N3H A;  4KHP E;  1HNW E;  2NAB A;  4DR1 E;  1YYO A;  4GZN C;  1X49 A;  2G7H A;  2YTP A;  1PDA A;  1LLM C;  1N32 E;  4R2E A;  4L8N A;  4DR7 E;  3EPJ A;  1EH8 A;  2EMB A;  2L2N A;  2M9A A;  2EMH A; 
#chains in the Genus database with same CATH homology
 2EOQ A;  2EM5 A;  2EN6 A;  1KJK A;  2EOX A;  3MHS C;  2EOO A;  4R2C A;  2I13 A;  1TF3 A;  1NCS A;  2YTO A;  2EMC A;  1X6F A;  2EMF A;  1UBD C;  2YTE A;  1A1I A;  2JP9 A;  1DGC A;  5KL5 A;  2EQ3 A;  2EM3 A;  2DLK A;  2EM7 A;  2EOR A;  2YRH A;  2ENH A;  2YRK A;  4R2Q A;  3UK3 C;  1A1J A;  1B69 A;  1A1F A;  2YTF A;  2EOF A;  4F6M A;  2HGH A;  4WSG A;  1X6H A;  2EMW A;  2EM6 A;  2GHF A;  2EPU A;  2J7J A;  2YU5 A;  2VRD A;  1BBO A;  2EM9 A;  2LO3 A;  2A25 A;  2PRT A;  2EN8 A;  2EL6 A;  1X3C A;  1UN6 B;  1BB8 A;  2EP3 A;  2ADR A;  2WCC 3;  2EPC A;  1Z1B A;  2E72 A;  2JPA A;  1P47 A;  1A1G A;  3MHH C;  5KL2 A;  1G2F C;  2EQ1 A;  4IS1 C;  2DLQ A;  2EML A;  1TF6 A;  2EL4 A;  2EOJ A;  2RSI A;  2YSO A;  1WJP A;  2RPC A;  2WBU A;  2YTD A;  2ELY A;  4M9V C;  2EM4 A;  2EN3 A;  2LCE A;  2YTQ A;  2CSH A;  2EMA A;  1X5W A;  2EPA A;  2DRP A;  2ENC A;  2EN4 A;  2EMK A;  2ENA A;  2YTI A;  2ELZ A;  1RMD A;  5KL6 A;  2BB8 A;  1YUI A;  1YSA C;  1F2I G;  5KL7 A;  2EOI A;  1MEY C;  1YUJ A;  1A1K A;  2CTD A;  2CT1 A;  2EMG A;  1ZU1 A;  4F2J C;  2DMI A;  2R1F A;  1AAY A;  2EJ4 A;  1X6E A;  1JK2 A;  2EOM A;  2EOZ A;  2EQ0 A;  2LV2 A;  4F6N A;  1A1L A;  2YRM A;  4IJD A;  4R2R A;  2EN7 A;  2EOS A;  2YTG A;  2YTN A;  2EM0 A;  2EN1 A;  2EPX A;  1A1H A;  1TN9 A;  2EE8 A;  2EN2 A;  4R2A A;  2WBS A;  2EPZ A;  4R2D A;  2WBT A;  2EMY A;  5KL3 A;  2MKN A;  5KL4 A;  2D9H A;  2EM8 A;  2EOY A;  2EMX A;  2YSP A;  3EPL A;  2EOH A;  2MDG A;  3M99 B;  1JK1 A;  2EM2 A;  2GLI A;  2YTJ A;  1ZR9 A;  2LVH A;  2EOE A;  1ZAA C;  1G2D C;  2EPP A;  4X9J A;  2NAB A;  4GZN C;  3EPK A;  2LT7 A;  3VHT B;  2YTP A;  1LLM C;  2MKD A;  2EPR A;  4R2E A;  4R2S A;  3EPH A;  3EPJ A;  2EMB A;  4FK5 C;  2EMI A;  2M9A A;  4R2P A;  2DGC A;  2EL5 A;  2YU8 A;  2EMH A;  2EMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...