2EMXA

Solution structure of the c2h2 type zinc finger (region 273-303) of human zinc finger protein 268
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
44
structure length
44
Chain Sequence
b'GSSGSSGEKPFGCSCCEKAFSSKSYLLVHQQTHAEEKPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 268
molecule tags Transcription
source organism Homo sapiens
publication title Solution structure of the C2H2 type zinc finger (region 273-303) of human Zinc finger protein 268
rcsb
total genus 8
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emxA01
3MHHC 1LLMC 2JP9A 1AAYA 2EM2A 2ADRA 4F6MA 2EMIA 3MHSC 1A1HA 2EOJA 1F2IG 5KL7A 2EM6A 4F6NA 2YTPA 3EPJA 2LCEA 2JPAA 2EM7A 2RPCA 1NCSA 2EOHA 1ZAAC 2MKDA 2YU8A 4R2SA 2WBSA 2EMGA 2EOSA 2NABA 2WBTA 2J7JA 2BB8A 2LO3A 2EMZA 1YSAC 2DMIA 2EN7A 1ZR9A 3EPKA 2YTQA 1A1FA 2E72A 1ZU1A 2EM8A 4R2RA 2YRMA 4R2QA 2CT1A 5KL2A 2DRPA 2ENAA 2EMXA 1MEYC 2YTNA 2EMKA 2EMBA 1YUIA 4FK5C 2ENHA 4GZNC 1A1IA 2MKNA 2EMAA 4R2DA 1X5WA 2EPZA 2YTDA 2PRTA 2YRHA 1DGCA 1X3CA 2DLKA 2EOFA 4IS1C 2VRDA 1BBOA 2EP3A 2EMCA 1G2FC 4IJDA 2EN6A 2EOXA 2YSOA 2YTOA 1A1GA 5KL4A 2EOOA 1BB8A 2YTFA 2RSIA 2EN4A 2EOYA 1TF3A 5KL5A 2D9HA 5KL3A 1A1KA 1A1LA 3EPHA 2YTIA 1UBDC 2MDGA 1G2DC 2R1FA 2EL4A 1P47A 5KL6A 4F2JC 2EOZA 2EN1A 2WBUA 2ELYA 1WJPA 2EE8A 4R2CA 2EN8A 2EJ4A 2EQ3A 2EPUA 2HGHA 2DGCA 2EN3A 2EOMA 3UK3C 2EPRA 2EN2A 2GHFA 2YTEA 4R2EA 2LT7A 1Z1BA 1B69A 2GLIA 2EPCA 2EORA 2I13A 1X6FA 2EM4A 2M9AA 2DLQA 2EPAA 4WSGA 3VHTB 4R2AA 2A25A 2EMHA 2ENCA 1X6HA 2EOEA 2EMFA 2YRKA 1JK1A 4R2PA 2ELZA 2CTDA 2EL6A 2CSHA 2EM5A 1X6EA 2YTGA 1UN6B 2YSPA 2YU5A 2EPXA 2EMLA 2LV2A 3EPLA 2EQ1A 4M9VC 2LVHA 1KJKA 4X9JA 1TF6A 3M99B 2EMWA 1YUJA 2YTJA 2EPPA 1RMDA 2WCC3 2EQ0A 1JK2A 2EL5A 1A1JA 2EM0A 2EM3A 2EOQA 2EMYA 1TN9A 2EOIA 2EM9A
chains in the Genus database with same CATH superfamily
2LMZA 4YHHE 2LRSA 1EH7A 2EM2A 5LMUE 4DV3E 4F6MA 2EMIA 3MHSC 5TSEA 2EOJA 2WZOA 3OMLA 2LUPB 3EPJA 1PJTA 1DI2A 4GEQB 2DB2A 2EM7A 4DV5E 2YU8A 4KHPE 2VQEE 3MSWA 3HXLA 4DV1E 4WSPA 1WHNA 2EN7A 2K7IA 3JU0A 2YTQA 4M0VA 1ZU1A 2YWQA 2EM8A 5F3WA 2L2NA 1EH8A 1YFHA 2ENAA 1WRJA 1MEYC 4DV6E 4FK5C 2ENHA 4NXNE 5A6BD 2EMAA 1X5WA 4F9BB 3HTXA 4X65E 1X3CA 1YYWA 2DLKA 5FLXC 2VRDA 4DR2E 3ECRA 4GKJE 3T1HE 2EMCA 4X66E 1G2FC 5ADZA 2JR1A 2EOXA 5BR8E 2EPKX 2L33A 3T1YE 1A1GA 5KL4A 4RHBB 3KWRA 2UUCE 2RSIA 2EOYA 2L2KB 2JY9A 2D9HA 5KL3A 1A1KA 5CFFE 1IBKE 1IMUA 2UUBE 1FKAE 2M7QA 1P47A 4BC7A 2L3JA 2EOZA 4BMJA 1WJPA 2EE8A 1XMOE 2EQ3A 2HGHA 2DGCA 2EN3A 2EN2A 4LTYA 1Z1BA 1B69A 1XMQE 1YYKA 2GLIA 3P1XA 2I13A 1SFEA 2DLQA 4ZYDA 4DV2E 2EPMX 2EMHA 2ENCA 4LFAE 2EPNA 4L5NC 4JI0E 2YRKA 5LMNE 2EL6A 2CSHA 2EM5A 3K6QA 1UN6B 2YSPA 4WFTA 3C6MA 2EQ1A 2N3HA 1MGTA 2DMYA 2V88A 4MLQA 3M99B 2K4VA 2YTJA 2EPPA 4DUYE 2M4IA 5AE1A 2WCC3 2EQ0A 4O43A 2EPLX 2EL5A 1I94E 4OX9E 4JI8E 2EMYA 2UU9E 2RTXA 1YZ9A 2KHXA 1RC7A 1F2IG 2EM6A 2YTPA 2HC5A 2JOBA 2V8QB 4NZVA 4BCAA 2JPAA 3VYXA 1NCSA 2EOHA 3TQMA 3RMPA 4B3ME 2WBTA 1PJQA 1DQ3A 3C6KA 1QU6A 1X47A 1EKZA 4TUIA 2IHR1 1A1FA 2E72A 2YRMA 3ZOQB 3VK6A 1T39A 4DKKA 4WXDA 3ADIA 2YTNA 3DJWA 2EMBA 1KYQA 4GZNC 1X48A 1FJGE 4R2DA 2NUGA 2PRTA 4Q28A 4NXME 3F6GA 5AE2A 4JI3E 1GZ6A 2ZM6E 4BBYA 2YSOA 4WPYA 1RQ0A 2VQFE 1IBLE 4M30A 1BB8A 1A1LA 3KZYA 1UHZA 1O0WA 2YPNA 4DR3E 4M2ZA 2MDGA 1G2DC 2LTRA 5KL6A 4F2JC 3H09A 2ODRD 4P7DA 2WBUA 1QNTA 4AQYE 4DR6E 4ZYGA 2EPUA 2N8XA 1STUA 2LTSA 3UK3C 2EOMA 2HJJA 3LLHA 1J26A 4R2EA 2Q8UA 2B3TB 4LFCE 2L6MA 1GQEA 4F9CB 1N34E 2EM4A 2M9AA 2YZTA 5AE3A 4LFBE 2RQLA 3BF2A 3AUZA 2EPAA 3C4TA 4WSGA 3VHTB 2UXDE 3BGHA 4K0KE 4DR7E 1T38A 2CTDA 2KONA 2F4VE 2UXBE 4JI2E 2EMLA 2LV2A 2R76A 1XNQE 5AC5A 1IBME 3J80C 4BC9A 5A2QC 4DR5E 4O5GA 2EM3A 3QG5C 4DR4E 2UXCE 1TN9A 2EOIA 2EM9A 2DMIA 1LLMC 2JP9A 1AAYA 4X64E 2H36X 4DUZE 3ADJA 4JI5E 3FIGA 5IXMB 3OTOE 4F6NA 4HTGA 2LCEA 4F54A 1ZAAC 2EMGA 2LBSB 2NABA 2BB8A 2LO3A 1YSAC 3AV0A 4HEIA 4R2RA 2NUFA 4LF6E 1AH5A 1NEIA 1X49A 2EMXA 5IWAE 1T4LB 2ODRC 1YUIA 1A1IA 4KZSA 2MKNA 1HR0E 4JV5E 2B9DA 2EPZA 4LU9A 2YTDA 4DR1E 2GPIA 2YRHA 1ZBQA 4DV7E 1DGCA 2EOFA 2NA2A 3HPSA 1SR9A 4JI6E 3F6HA 2VE7C 2FTXB 5LL6R 1BBOA 2BBGA 2EP3A 4R8OA 2JOXA 2RS6A 4IJDA 3BIDA 3C4BA 4WYQB 2EN6A 4ZYEA 2RS7A 2L2MA 3THOB 1UILA 4X8WA 2EOOA 2DSYA 2I9IA 2FGGA 2YTFA 2EN4A 4I8OA 1TF3A 5KL5A 1YYOA 2YTIA 1UBDC 4LF7E 2V85A 4O24A 3THNA 2EL4A 2B7VA 1ZBTA 3LMLA 2EN8A 2EJ4A 2M1SA 2KOUA 5AASA 3VYYA 4DMIA 2EPRA 3J81C 1T4NA 4WXCA 2EORA 1X6FA 2V83A 2LUQA 3KZZA 1N36E 4L8NA 1N3GA 1PDAA 1PKPA 2A25A 4NHRA 1X6HA 2EOEA 2EMFA 4YY3E 2RSMA 2F8BA 3HPZA 2N3GA 5IT9C 2VF1A 2YTGA 3BBGA 3ADLA 2YU5A 2EPXA 2MC6A 2LVHA 2HHHE 1KJKA 5A69A 1YPNA 4KWYA 3IWDA 2LJUA 1RMDA 4BHCA 5DNYA 4WX9A 4X62E 2JYAA 2EM0A 5A6JA 2DIXA 2EPCA 2L92A 3MHHC 4RH8A 2E5LE 2L8TA 4LF4E 2ADRA 2EWLA 4JI4E 2FV4B 5A6KA 5KL7A 2NUEA 4LF5E 1L4SA 2RPCA 2MKDA 2WBSA 4R2SA 2EOSA 3L00A 4B3SE 2J7JA 5A6BA 2EMZA 3IWCA 1ZR9A 3J7AG 1HNWE 3EPKA 2L3CA 4JI1E 1WHQA 4OOGC 2JVAA 4R2QA 2CT1A 5KL2A 2DRPA 2EMKA 5AC4A 1N32E 4TUGA 2LJHA 2CPNA 4DV4E 1IQSA 2LE2A 1N33E 2V89A 4IS1C 1T4OA 4P78A 2EZ6A 3HQ1A 4DV0E 4BHBA 4F9AB 4N4RB 1HNXE 5IV8B 2YTOA 1PJSA 3DF6A 2JXPA 2V86A 3EQ1A 2V87A 4MLVA 2JWOA 4LF9E 2UUAE 3EPHA 2R1FA 4JYAE 3IWBA 3JTZA 5A6AA 2EN1A 2ELYA 4R2CA 2G7HA 1HNZE 1WXRA 4JI7E 4O4KA 2B7TA 2GHFA 2YTEA 2LT7A 2E1MA 3J7Yp 4LF8E 1XNRE 1IQOA 4R03A 5LLQA 4R2AA 1GTKA 1JK1A 2YT4A 3JAMC 4R2PA 2ELZA 2EPOA 2MC5A 4B3RE 1X6EA 4GKKE 4Q35B 3EPLA 1J5EE 4M9VC 4BS9A 4B3TE 4X9JA 3ADGA 1TF6A 2EMWA 4J8ZA 1YUJA 4ZYHA 1JK2A 1BBGA 5T6JA 1A1JA 2EOQA 1A1HA 1EH6A 2MDRA
chains in the Genus database with same CATH topology
3MHHC 1LLMC 2JP9A 1AAYA 2EM2A 2ADRA 4F6MA 2EMIA 3MHSC 1A1HA 2EOJA 1F2IG 5KL7A 2EM6A 4F6NA 2YTPA 3EPJA 2LCEA 2JPAA 2EM7A 2RPCA 1NCSA 2EOHA 1ZAAC 2MKDA 2YU8A 4R2SA 2WBSA 2EMGA 2EOSA 2NABA 2WBTA 2J7JA 2BB8A 2LO3A 2EMZA 1YSAC 2DMIA 2EN7A 1ZR9A 3EPKA 2YTQA 1A1FA 2E72A 1ZU1A 2EM8A 4R2RA 2YRMA 4R2QA 2CT1A 5KL2A 2DRPA 2ENAA 2EMXA 1MEYC 2YTNA 2EMKA 2EMBA 1YUIA 4FK5C 2ENHA 4GZNC 1A1IA 2MKNA 2EMAA 4R2DA 1X5WA 2EPZA 2YTDA 2PRTA 2YRHA 1DGCA 1X3CA 2DLKA 2EOFA 4IS1C 2VRDA 1BBOA 2EP3A 2EMCA 1G2FC 4IJDA 2EN6A 2EOXA 2YSOA 2YTOA 1A1GA 5KL4A 2EOOA 1BB8A 2YTFA 2RSIA 2EN4A 2EOYA 1TF3A 5KL5A 2D9HA 5KL3A 1A1KA 1A1LA 3EPHA 2YTIA 1UBDC 2MDGA 1G2DC 2R1FA 2EL4A 1P47A 5KL6A 4F2JC 2EOZA 2EN1A 2WBUA 2ELYA 1WJPA 2EE8A 4R2CA 2EN8A 2EJ4A 2EQ3A 2EPUA 2HGHA 2DGCA 2EN3A 2EOMA 3UK3C 2EPRA 2EN2A 2GHFA 2YTEA 4R2EA 2LT7A 1Z1BA 1B69A 2GLIA 2EPCA 2EORA 2I13A 1X6FA 2EM4A 2M9AA 2DLQA 2EPAA 4WSGA 3VHTB 4R2AA 2A25A 2EMHA 2ENCA 1X6HA 2EOEA 2EMFA 2YRKA 1JK1A 4R2PA 2ELZA 2CTDA 2EL6A 2CSHA 2EM5A 1X6EA 2YTGA 1UN6B 2YSPA 2YU5A 2EPXA 2EMLA 2LV2A 3EPLA 2EQ1A 4M9VC 2LVHA 1KJKA 4X9JA 1TF6A 3M99B 2EMWA 1YUJA 2YTJA 2EPPA 1RMDA 2WCC3 2EQ0A 1JK2A 2EL5A 1A1JA 2EM0A 2EM3A 2EOQA 2EMYA 1TN9A 2EOIA 2EM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MHH C;  1LLM C;  2JP9 A;  1AAY A;  2EM2 A;  2ADR A;  4F6M A;  2EMI A;  3MHS C;  1A1H A;  2EOJ A;  1F2I G;  5KL7 A;  2EM6 A;  4F6N A;  2YTP A;  3EPJ A;  2LCE A;  2JPA A;  2EM7 A;  2RPC A;  1NCS A;  2EOH A;  1ZAA C;  2MKD A;  2YU8 A;  4R2S A;  2WBS A;  2EMG A;  2EOS A;  2NAB A;  2WBT A;  2J7J A;  2BB8 A;  2LO3 A;  2EMZ A;  1YSA C;  2DMI A;  2EN7 A;  1ZR9 A;  3EPK A;  2YTQ A;  1A1F A;  2E72 A;  1ZU1 A;  2EM8 A;  4R2R A;  2YRM A;  4R2Q A;  2CT1 A;  5KL2 A;  2DRP A;  2ENA A;  2EMX A;  1MEY C;  2YTN A;  2EMK A;  2EMB A;  1YUI A;  4FK5 C;  2ENH A;  4GZN C;  1A1I A;  2MKN A;  2EMA A;  4R2D A;  1X5W A;  2EPZ A;  2YTD A;  2PRT A;  2YRH A;  1DGC A;  1X3C A;  2DLK A;  2EOF A;  4IS1 C;  2VRD A;  1BBO A;  2EP3 A;  2EMC A;  1G2F C;  4IJD A;  2EN6 A;  2EOX A;  2YSO A;  2YTO A;  1A1G A;  5KL4 A;  2EOO A;  1BB8 A;  2YTF A;  2RSI A;  2EN4 A;  2EOY A;  1TF3 A;  5KL5 A;  2D9H A;  5KL3 A;  1A1K A;  1A1L A;  3EPH A;  2YTI A;  1UBD C;  2MDG A;  1G2D C;  2R1F A;  2EL4 A;  1P47 A;  5KL6 A;  4F2J C;  2EOZ A;  2EN1 A;  2WBU A;  2ELY A;  1WJP A;  2EE8 A;  4R2C A;  2EN8 A;  2EJ4 A;  2EQ3 A;  2EPU A;  2HGH A;  2DGC A;  2EN3 A;  2EOM A;  3UK3 C;  2EPR A;  2EN2 A;  2GHF A;  2YTE A;  4R2E A;  2LT7 A;  1Z1B A;  1B69 A;  2GLI A;  2EPC A;  2EOR A;  2I13 A;  1X6F A;  2EM4 A;  2M9A A;  2DLQ A;  2EPA A;  4WSG A;  3VHT B;  4R2A A;  2A25 A;  2EMH A;  2ENC A;  1X6H A;  2EOE A;  2EMF A;  2YRK A;  1JK1 A;  4R2P A;  2ELZ A;  2CTD A;  2EL6 A;  2CSH A;  2EM5 A;  1X6E A;  2YTG A;  1UN6 B;  2YSP A;  2YU5 A;  2EPX A;  2EML A;  2LV2 A;  3EPL A;  2EQ1 A;  4M9V C;  2LVH A;  1KJK A;  4X9J A;  1TF6 A;  3M99 B;  2EMW A;  1YUJ A;  2YTJ A;  2EPP A;  1RMD A;  2WCC 3;  2EQ0 A;  1JK2 A;  2EL5 A;  1A1J A;  2EM0 A;  2EM3 A;  2EOQ A;  2EMY A;  1TN9 A;  2EOI A;  2EM9 A; 
#chains in the Genus database with same CATH topology
 2LMZ A;  4YHH E;  2LRS A;  1EH7 A;  2EM2 A;  5LMU E;  4DV3 E;  4F6M A;  2EMI A;  3MHS C;  5TSE A;  2EOJ A;  2WZO A;  3OML A;  2LUP B;  3EPJ A;  1PJT A;  1DI2 A;  4GEQ B;  2DB2 A;  2EM7 A;  4DV5 E;  2YU8 A;  4KHP E;  2VQE E;  3MSW A;  3HXL A;  4DV1 E;  4WSP A;  1WHN A;  2EN7 A;  2K7I A;  3JU0 A;  2YTQ A;  4M0V A;  1ZU1 A;  2YWQ A;  2EM8 A;  5F3W A;  2L2N A;  1EH8 A;  1YFH A;  2ENA A;  1WRJ A;  1MEY C;  4DV6 E;  4FK5 C;  2ENH A;  4NXN E;  5A6B D;  2EMA A;  1X5W A;  4F9B B;  3HTX A;  4X65 E;  1X3C A;  1YYW A;  2DLK A;  5FLX C;  2VRD A;  4DR2 E;  3ECR A;  4GKJ E;  3T1H E;  2EMC A;  4X66 E;  1G2F C;  5ADZ A;  2JR1 A;  2EOX A;  5BR8 E;  2EPK X;  2L33 A;  3T1Y E;  1A1G A;  5KL4 A;  4RHB B;  3KWR A;  2UUC E;  2RSI A;  2EOY A;  2L2K B;  2JY9 A;  2D9H A;  5KL3 A;  1A1K A;  5CFF E;  1IBK E;  1IMU A;  2UUB E;  1FKA E;  2M7Q A;  1P47 A;  4BC7 A;  2L3J A;  2EOZ A;  4BMJ A;  1WJP A;  2EE8 A;  1XMO E;  2EQ3 A;  2HGH A;  2DGC A;  2EN3 A;  2EN2 A;  4LTY A;  1Z1B A;  1B69 A;  1XMQ E;  1YYK A;  2GLI A;  3P1X A;  2I13 A;  1SFE A;  2DLQ A;  4ZYD A;  4DV2 E;  2EPM X;  2EMH A;  2ENC A;  4LFA E;  2EPN A;  4L5N C;  4JI0 E;  2YRK A;  5LMN E;  2EL6 A;  2CSH A;  2EM5 A;  3K6Q A;  1UN6 B;  2YSP A;  4WFT A;  3C6M A;  2EQ1 A;  2N3H A;  1MGT A;  2DMY A;  2V88 A;  4MLQ A;  3M99 B;  2K4V A;  2YTJ A;  2EPP A;  4DUY E;  2M4I A;  5AE1 A;  2WCC 3;  2EQ0 A;  4O43 A;  2EPL X;  2EL5 A;  1I94 E;  4OX9 E;  4JI8 E;  2EMY A;  2UU9 E;  2RTX A;  1YZ9 A;  2KHX A;  1RC7 A;  1F2I G;  2EM6 A;  2YTP A;  2HC5 A;  2JOB A;  2V8Q B;  4NZV A;  4BCA A;  2JPA A;  3VYX A;  1NCS A;  2EOH A;  3TQM A;  3RMP A;  4B3M E;  2WBT A;  1PJQ A;  1DQ3 A;  3C6K A;  1QU6 A;  1X47 A;  1EKZ A;  4TUI A;  2IHR 1;  1A1F A;  2E72 A;  2YRM A;  3ZOQ B;  3VK6 A;  1T39 A;  4DKK A;  4WXD A;  3ADI A;  2YTN A;  3DJW A;  2EMB A;  1KYQ A;  4GZN C;  1X48 A;  1FJG E;  4R2D A;  2NUG A;  2PRT A;  4Q28 A;  4NXM E;  3F6G A;  5AE2 A;  4JI3 E;  1GZ6 A;  2ZM6 E;  4BBY A;  2YSO A;  4WPY A;  1RQ0 A;  2VQF E;  1IBL E;  4M30 A;  1BB8 A;  1A1L A;  3KZY A;  1UHZ A;  1O0W A;  2YPN A;  4DR3 E;  4M2Z A;  2MDG A;  1G2D C;  2LTR A;  5KL6 A;  4F2J C;  3H09 A;  2ODR D;  4P7D A;  2WBU A;  1QNT A;  4AQY E;  4DR6 E;  4ZYG A;  2EPU A;  2N8X A;  1STU A;  2LTS A;  3UK3 C;  2EOM A;  2HJJ A;  3LLH A;  1J26 A;  4R2E A;  2Q8U A;  2B3T B;  4LFC E;  2L6M A;  1GQE A;  4F9C B;  1N34 E;  2EM4 A;  2M9A A;  2YZT A;  5AE3 A;  4LFB E;  2RQL A;  3BF2 A;  3AUZ A;  2EPA A;  3C4T A;  4WSG A;  3VHT B;  2UXD E;  3BGH A;  4K0K E;  4DR7 E;  1T38 A;  2CTD A;  2KON A;  2F4V E;  2UXB E;  4JI2 E;  2EML A;  2LV2 A;  2R76 A;  1XNQ E;  5AC5 A;  1IBM E;  3J80 C;  4BC9 A;  5A2Q C;  4DR5 E;  4O5G A;  2EM3 A;  3QG5 C;  4DR4 E;  2UXC E;  1TN9 A;  2EOI A;  2EM9 A;  2DMI A;  1LLM C;  2JP9 A;  1AAY A;  4X64 E;  2H36 X;  4DUZ E;  3ADJ A;  4JI5 E;  3FIG A;  5IXM B;  3OTO E;  4F6N A;  4HTG A;  2LCE A;  4F54 A;  1ZAA C;  2EMG A;  2LBS B;  2NAB A;  2BB8 A;  2LO3 A;  1YSA C;  3AV0 A;  4HEI A;  4R2R A;  2NUF A;  4LF6 E;  1AH5 A;  1NEI A;  1X49 A;  2EMX A;  5IWA E;  1T4L B;  2ODR C;  1YUI A;  1A1I A;  4KZS A;  2MKN A;  1HR0 E;  4JV5 E;  2B9D A;  2EPZ A;  4LU9 A;  2YTD A;  4DR1 E;  2GPI A;  2YRH A;  1ZBQ A;  4DV7 E;  1DGC A;  2EOF A;  2NA2 A;  3HPS A;  1SR9 A;  4JI6 E;  3F6H A;  2VE7 C;  2FTX B;  5LL6 R;  1BBO A;  2BBG A;  2EP3 A;  4R8O A;  2JOX A;  2RS6 A;  4IJD A;  3BID A;  3C4B A;  4WYQ B;  2EN6 A;  4ZYE A;  2RS7 A;  2L2M A;  3THO B;  1UIL A;  4X8W A;  2EOO A;  2DSY A;  2I9I A;  2FGG A;  2YTF A;  2EN4 A;  4I8O A;  1TF3 A;  5KL5 A;  1YYO A;  2YTI A;  1UBD C;  4LF7 E;  2V85 A;  4O24 A;  3THN A;  2EL4 A;  2B7V A;  1ZBT A;  3LML A;  2EN8 A;  2EJ4 A;  2M1S A;  2KOU A;  5AAS A;  3VYY A;  4DMI A;  2EPR A;  3J81 C;  1T4N A;  4WXC A;  2EOR A;  1X6F A;  2V83 A;  2LUQ A;  3KZZ A;  1N36 E;  4L8N A;  1N3G A;  1PDA A;  1PKP A;  2A25 A;  4NHR A;  1X6H A;  2EOE A;  2EMF A;  4YY3 E;  2RSM A;  2F8B A;  3HPZ A;  2N3G A;  5IT9 C;  2VF1 A;  2YTG A;  3BBG A;  3ADL A;  2YU5 A;  2EPX A;  2MC6 A;  2LVH A;  2HHH E;  1KJK A;  5A69 A;  1YPN A;  4KWY A;  3IWD A;  2LJU A;  1RMD A;  4BHC A;  5DNY A;  4WX9 A;  4X62 E;  2JYA A;  2EM0 A;  5A6J A;  2DIX A;  2EPC A;  2L92 A;  3MHH C;  4RH8 A;  2E5L E;  2L8T A;  4LF4 E;  2ADR A;  2EWL A;  4JI4 E;  2FV4 B;  5A6K A;  5KL7 A;  2NUE A;  4LF5 E;  1L4S A;  2RPC A;  2MKD A;  2WBS A;  4R2S A;  2EOS A;  3L00 A;  4B3S E;  2J7J A;  5A6B A;  2EMZ A;  3IWC A;  1ZR9 A;  3J7A G;  1HNW E;  3EPK A;  2L3C A;  4JI1 E;  1WHQ A;  4OOG C;  2JVA A;  4R2Q A;  2CT1 A;  5KL2 A;  2DRP A;  2EMK A;  5AC4 A;  1N32 E;  4TUG A;  2LJH A;  2CPN A;  4DV4 E;  1IQS A;  2LE2 A;  1N33 E;  2V89 A;  4IS1 C;  1T4O A;  4P78 A;  2EZ6 A;  3HQ1 A;  4DV0 E;  4BHB A;  4F9A B;  4N4R B;  1HNX E;  5IV8 B;  2YTO A;  1PJS A;  3DF6 A;  2JXP A;  2V86 A;  3EQ1 A;  2V87 A;  4MLV A;  2JWO A;  4LF9 E;  2UUA E;  3EPH A;  2R1F A;  4JYA E;  3IWB A;  3JTZ A;  5A6A A;  2EN1 A;  2ELY A;  4R2C A;  2G7H A;  1HNZ E;  1WXR A;  4JI7 E;  4O4K A;  2B7T A;  2GHF A;  2YTE A;  2LT7 A;  2E1M A;  3J7Y p;  4LF8 E;  1XNR E;  1IQO A;  4R03 A;  5LLQ A;  4R2A A;  1GTK A;  1JK1 A;  2YT4 A;  3JAM C;  4R2P A;  2ELZ A;  2EPO A;  2MC5 A;  4B3R E;  1X6E A;  4GKK E;  4Q35 B;  3EPL A;  1J5E E;  4M9V C;  4BS9 A;  4B3T E;  4X9J A;  3ADG A;  1TF6 A;  2EMW A;  4J8Z A;  1YUJ A;  4ZYH A;  1JK2 A;  1BBG A;  5T6J A;  1A1J A;  2EOQ A;  1A1H A;  1EH6 A;  2MDR A; 
#chains in the Genus database with same CATH homology
 3MHH C;  1LLM C;  2JP9 A;  1AAY A;  2EM2 A;  2ADR A;  4F6M A;  2EMI A;  3MHS C;  1A1H A;  2EOJ A;  1F2I G;  5KL7 A;  2EM6 A;  4F6N A;  2YTP A;  3EPJ A;  2LCE A;  2JPA A;  2EM7 A;  2RPC A;  1NCS A;  2EOH A;  1ZAA C;  2MKD A;  2YU8 A;  4R2S A;  2WBS A;  2EMG A;  2EOS A;  2NAB A;  2WBT A;  2J7J A;  2BB8 A;  2LO3 A;  2EMZ A;  1YSA C;  2DMI A;  2EN7 A;  1ZR9 A;  3EPK A;  2YTQ A;  1A1F A;  2E72 A;  1ZU1 A;  2EM8 A;  4R2R A;  2YRM A;  4R2Q A;  2CT1 A;  5KL2 A;  2DRP A;  2ENA A;  2EMX A;  1MEY C;  2YTN A;  2EMK A;  2EMB A;  1YUI A;  4FK5 C;  2ENH A;  4GZN C;  1A1I A;  2MKN A;  2EMA A;  4R2D A;  1X5W A;  2EPZ A;  2YTD A;  2PRT A;  2YRH A;  1DGC A;  1X3C A;  2DLK A;  2EOF A;  4IS1 C;  2VRD A;  1BBO A;  2EP3 A;  2EMC A;  1G2F C;  4IJD A;  2EN6 A;  2EOX A;  2YSO A;  2YTO A;  1A1G A;  5KL4 A;  2EOO A;  1BB8 A;  2YTF A;  2RSI A;  2EN4 A;  2EOY A;  1TF3 A;  5KL5 A;  2D9H A;  5KL3 A;  1A1K A;  1A1L A;  3EPH A;  2YTI A;  1UBD C;  2MDG A;  1G2D C;  2R1F A;  2EL4 A;  1P47 A;  5KL6 A;  4F2J C;  2EOZ A;  2EN1 A;  2WBU A;  2ELY A;  1WJP A;  2EE8 A;  4R2C A;  2EN8 A;  2EJ4 A;  2EQ3 A;  2EPU A;  2HGH A;  2DGC A;  2EN3 A;  2EOM A;  3UK3 C;  2EPR A;  2EN2 A;  2GHF A;  2YTE A;  4R2E A;  2LT7 A;  1Z1B A;  1B69 A;  2GLI A;  2EPC A;  2EOR A;  2I13 A;  1X6F A;  2EM4 A;  2M9A A;  2DLQ A;  2EPA A;  4WSG A;  3VHT B;  4R2A A;  2A25 A;  2EMH A;  2ENC A;  1X6H A;  2EOE A;  2EMF A;  2YRK A;  1JK1 A;  4R2P A;  2ELZ A;  2CTD A;  2EL6 A;  2CSH A;  2EM5 A;  1X6E A;  2YTG A;  1UN6 B;  2YSP A;  2YU5 A;  2EPX A;  2EML A;  2LV2 A;  3EPL A;  2EQ1 A;  4M9V C;  2LVH A;  1KJK A;  4X9J A;  1TF6 A;  3M99 B;  2EMW A;  1YUJ A;  2YTJ A;  2EPP A;  1RMD A;  2WCC 3;  2EQ0 A;  1JK2 A;  2EL5 A;  1A1J A;  2EM0 A;  2EM3 A;  2EOQ A;  2EMY A;  1TN9 A;  2EOI A;  2EM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...