2EMXA

Solution structure of the c2h2 type zinc finger (region 273-303) of human zinc finger protein 268
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
44
structure length
44
Chain Sequence
GSSGSSGEKPFGCSCCEKAFSSKSYLLVHQQTHAEEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 268
publication title Solution structure of the C2H2 type zinc finger (region 273-303) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 8
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emxA01
2CT1A 2JP9A 3UK3C 1TF3A 3MHHC 2R1FA 2E72A 2EL5A 2EOEA 2NABA 2EM5A 1YUJA 1AAYA 4R2AA 2YTNA 1X6FA 2CSHA 2EMKA 4R2EA 1G2FC 2EN3A 5KL6A 2YSPA 2YU5A 2ENHA 2EN2A 2EPZA 1MEYC 3MHSC 5KL7A 2ELYA 2EOXA 2YSOA 2EMXA 1A1GA 1X6HA 2EOHA 2EM6A 2EOQA 2BB8A 2VRDA 2YTGA 2EL4A 1P47A 4IJDA 2EQ3A 2EMLA 2YTFA 1X6EA 2EN8A 4R2RA 1BB8A 2EN1A 2YRMA 2YTIA 1Z1BA 1UN6B 2EMIA 2A25A 1JK1A 2EPUA 5KL5A 2DGCA 2YRHA 2GLIA 2MKNA 2EN6A 1BBOA 4R2QA 1NCSA 2LT7A 2EPPA 2EPRA 1YUIA 4X9JA 2EORA 1WJPA 1JK2A 2JPAA 1KJKA 4R2DA 2EN4A 1X3CA 2GHFA 2YRKA 2EMZA 2DLQA 2EOZA 2RSIA 4IS1C 4M9VC 2D9HA 2YTOA 2WCC3 2YTJA 2DLKA 2WBUA 1A1LA 2EMWA 2ADRA 1DGCA 1A1FA 2EMGA 4WSGA 3M99B 2J7JA 2YTEA 2EM7A 1LLMC 4R2PA 3EPKA 1F2IG 3EPHA 2EJ4A 2EPCA 1YSAC 4R2SA 4F2JC 2EOOA 5KL3A 2EMCA 2MKDA 2EOMA 2EMBA 1B69A 4F6MA 2CTDA 4R2CA 2LVHA 2EOSA 2ENAA 4F6NA 1UBDC 2EOFA 1G2DC 2EL6A 2EP3A 2LCEA 2YTQA 2EMHA 2EM9A 5KL2A 1A1JA 2LV2A 2EN7A 2PRTA 2DMIA 2ELZA 2EQ0A 5KL4A 2EE8A 2DRPA 1A1IA 2ENCA 2EOIA 2WBSA 1TF6A 2EOJA 2EM0A 2MDGA 1ZAAC 2EPXA 1A1KA 2M9AA 1A1HA 2I13A 2WBTA 2EMAA 2EM2A 4FK5C 3EPLA 2EQ1A 1TN9A 1ZR9A 2EMYA 2YU8A 3EPJA 2EPAA 2LO3A 1RMDA 2EM8A 4GZNC 2RPCA 2YTDA 2HGHA 2YTPA 2EM3A 3VHTB 2EM4A 2EMFA 1ZU1A 1X5WA 2EOYA
chains in the Genus database with same CATH superfamily
3VYXA 2NUFA 1GQEA 3MHHC 4LF6E 4DKKA 1GTKA 2DIXA 1ZBQA 2KOUA 4NHRA 4RH8A 4LTYA 2UXDE 4B3TE 2YSPA 2RS6A 1HNWE 5IT9C 5A6KA 2EPZA 4ZYDA 3AV0A 2VRDA 4R8OA 1J26A 2EPNA 2YTIA 2L3JA 2UUCE 1N34E 1T4OA 2I9IA 4M30A 2MKNA 2MDRA 2M1SA 4WX9A 1YYKA 4NXNE 1YPNA 2EPPA 1YUIA 2JPAA 2BBGA 4WXCA 4DV2E 4LFBE 2EMZA 2YTOA 2VQEE 3KWRA 4BC7A 1DGCA 4WSGA 4DR6E 2V8QB 1IBLE 4LF8E 3EPHA 5A6BD 2LJHA 5IV8B 2JOBA 4ZYEA 3ADIA 2NA2A 1FKAE 2EOOA 4DUYE 5AE2A 1T4LB 2CTDA 4O24A 5TSEA 4F9BB 2EPKX 2EOSA 2ENAA 1UBDC 4F9AB 2EL6A 2EP3A 2YTQA 2RQLA 4DV3E 2EM9A 4LU9A 5F3WA 1N33E 4AQYE 3ZOQB 2G7HA 2EE8A 2WBSA 3VYYA 2EOJA 2MDGA 3F6HA 3T1HE 2EPXA 2M7QA 4R03A 2EM2A 2F8BA 2UXCE 1MGTA 4O43A 2Q8UA 3RMPA 3EPJA 4F9CB 4L8NA 2LO3A 2YWQA 2V88A 3JU0A 2EM4A 5A6BA 1X5WA 1NEIA 1EH6A 2V85A 2RSMA 2V86A 3ADLA 2F4VE 1TF3A 4F54A 1T4NA 4R2AA 4X64E 1X6FA 2CSHA 2EMKA 4R2EA 2EPMX 5IXMB 2YT4A 5AE1A 5AE3A 5IWAE 2HHHE 4BC9A 2V87A 1J5EE 2VQFE 3DJWA 2EN2A 1DQ3A 4ZYGA 4JI6E 2JWOA 4KHPE 2B9DA 5KL7A 3JAMC 1A1GA 1STUA 2EM6A 4RHBB 2BB8A 1AH5A 2LTSA 2CPNA 2YTGA 1P47A 2EMLA 4YHHE 1BB8A 1T38A 5LL6R 4KZSA 1UN6B 4WSPA 4M2ZA 2A25A 2EPUA 3BIDA 1XMQE 5KL5A 2N3GA 2EN6A 2RTXA 4LFAE 3OMLA 3TQMA 2LT7A 1IQOA 2JOXA 4WFTA 2B7VA 2EOZA 2HC5A 2RSIA 4IS1C 4M9VC 2LRSA 1A1LA 3QG5C 4O5GA 2EMWA 2ADRA 2UXBE 1EH8A 2UU9E 4DMIA 2ODRD 3THNA 4TUIA 2J7JA 2YTEA 1LLMC 4BBYA 1SFEA 1WHNA 1PKPA 1SR9A 3BBGA 2K4VA 4DR5E 1PDAA 1L4SA 5T6JA 5KL3A 2MKDA 2FGGA 2ZM6E 5A2QC 3HPZA 5LMUE 5KL2A 4ZYHA 2EQ0A 4DR7E 1HR0E 2DRPA 2EOIA 3H09A 1TF6A 2UUAE 1I94E 3IWBA 1ZAAC 4X62E 4WYQB 2RS7A 1A1KA 2YZTA 1A1HA 1XNQE 4FK5C 3EPLA 1DI2A 4GEQB 4X65E 4X66E 2LBSB 1WXRA 2V83A 3J7Yp 2EMYA 2YU8A 4BS9A 1WRJA 2EPAA 2LUPB 2JVAA 1ZBTA 2DMYA 2HGHA 4LF9E 3LLHA 2JYAA 3J7AG 3IWCA 2JXPA 2EOYA 3IWDA 1UILA 3P1XA 2CT1A 2JP9A 4GKJE 3UK3C 2R1FA 2E72A 2EL5A 1UHZA 2EOEA 2L6MA 2L2MA 1AAYA 2YTNA 4DV5E 3ECRA 1IBKE 3KZYA 3FIGA 5LLQA 1YYOA 2EN3A 5KL6A 2L2KB 5A69A 5CFFE 4MLVA 3HQ1A 1MEYC 2LUQA 4DUZE 2JR1A 2EMXA 2KHXA 1X6HA 3HTXA 2EOQA 2GPIA 2IHR1 4IJDA 1XMOE 1X6EA 2EN8A 4R2RA 2EN1A 2YRMA 1Z1BA 1N36E 4DR3E 1JK1A 1RC7A 3C6KA 2GLIA 2DGCA 2YRHA 1XNRE 4JI4E 4R2QA 1HNXE 1IBME 2M4IA 4BHBA 3ADJA 4J8ZA 2EZ6A 2EPRA 2EORA 1JK2A 4R2DA 1X3CA 2GHFA 1EH7A 1N3GA 4JI8E 2WCC3 2LJUA 2YTJA 2DLKA 4B3ME 2WBUA 4WPYA 1EKZA 4Q28A 2EM7A 2B3TB 5DNYA 4R2PA 4NXME 5ADZA 4BHCA 4R2SA 4BCAA 4JI0E 3KZZA 5A6AA 2EOMA 2EMBA 4R2CA 2E1MA 2LVHA 4P7DA 4NZVA 2UUBE 2EOFA 4B3SE 2EPLX 2L3CA 1WHQA 2LCEA 2ODRC 2EMHA 2PRTA 2DMIA 3ADGA 4I8OA 2ELZA 5KL4A 4TUGA 1RQ0A 4O4KA 2H36X 2L33A 2EWLA 2B7TA 2HJJA 4DR2E 1N32E 4Q35B 2WBTA 3F6GA 2EQ1A 1TN9A 3AUZA 1QU6A 1RMDA 3BGHA 2YTDA 4DV1E 2YTPA 2EM3A 4JI5E 1YYWA 2FV4B 3C4BA 4DV0E 3MSWA 1ZU1A 2NUGA 4P78A 3C4TA 4DR4E 5BR8E 4DV6E 2N8XA 4N4RB 2E5LE 1X49A 3THOB 5LMNE 4GKKE 2NABA 4L5NC 2EM5A 1YUJA 1PJQA 2LTRA 4M0VA 2FTXB 4HEIA 1G2FC 2KONA 1IQSA 4HTGA 2N3HA 2YU5A 2ENHA 3J81C 4YY3E 1X48A 3MHSC 4JI1E 3JTZA 2ELYA 2EOXA 2YSOA 3L00A 3K6QA 2EOHA 4X8WA 3T1YE 2YPNA 4LFCE 2EL4A 2K7IA 2EQ3A 2L2NA 4BMJA 2YTFA 2L8TA 5AC4A 2MC6A 1PJSA 1BBGA 2MC5A 3EQ1A 1X47A 2EMIA 3C6MA 2LE2A 1BBOA 3OTOE 1NCSA 4X9JA 1WJPA 5FLXC 1KJKA 2EN4A 2YRKA 4OOGC 2DLQA 1KYQA 2D9HA 1YFHA 2VF1A 3J80C 1QNTA 5AASA 1A1FA 2EMGA 4OX9E 3M99B 2NUEA 3BF2A 3EPKA 1F2IG 4KWYA 2EJ4A 2EPCA 1O0WA 1YSAC 4LF4E 4F2JC 2WZOA 1GZ6A 1FJGE 2EMCA 1B69A 4JI3E 4F6MA 2R76A 4F6NA 1G2DC 1T39A 1A1JA 2JY9A 2LV2A 2EN7A 4DV7E 4LF5E 4B3RE 5A6JA 3HPSA 3DF6A 2L92A 2V89A 4DV4E 1A1IA 4JI2E 4K0KE 2ENCA 4MLQA 1PJTA 3VK6A 2EM0A 2LMZA 2DB2A 4JI7E 4JV5E 1IMUA 4DR1E 5AC5A 2DSYA 2M9AA 4WXDA 2I13A 2EMAA 1ZR9A 2EPOA 2VE7C 2EM8A 4GZNC 2RPCA 3LMLA 4JYAE 3VHTB 4LF7E 2EMFA 3HXLA 1YZ9A 1HNZE
chains in the Genus database with same CATH topology
2CT1A 2JP9A 3UK3C 1TF3A 3MHHC 2R1FA 2E72A 2EL5A 2EOEA 2NABA 2EM5A 1YUJA 1AAYA 4R2AA 2YTNA 1X6FA 2CSHA 2EMKA 4R2EA 1G2FC 2EN3A 5KL6A 2YSPA 2YU5A 2ENHA 2EN2A 2EPZA 1MEYC 3MHSC 5KL7A 2ELYA 2EOXA 2YSOA 2EMXA 1A1GA 1X6HA 2EOHA 2EM6A 2EOQA 2BB8A 2VRDA 2YTGA 2EL4A 1P47A 4IJDA 2EQ3A 2EMLA 2YTFA 1X6EA 2EN8A 4R2RA 1BB8A 2EN1A 2YRMA 2YTIA 1Z1BA 1UN6B 2EMIA 2A25A 1JK1A 2EPUA 5KL5A 2DGCA 2YRHA 2GLIA 2MKNA 2EN6A 1BBOA 4R2QA 1NCSA 2LT7A 2EPPA 2EPRA 1YUIA 4X9JA 2EORA 1WJPA 1JK2A 2JPAA 1KJKA 4R2DA 2EN4A 1X3CA 2GHFA 2YRKA 2EMZA 2DLQA 2EOZA 2RSIA 4IS1C 4M9VC 2D9HA 2YTOA 2WCC3 2YTJA 2DLKA 2WBUA 1A1LA 2EMWA 2ADRA 1DGCA 1A1FA 2EMGA 4WSGA 3M99B 2J7JA 2YTEA 2EM7A 1LLMC 4R2PA 3EPKA 1F2IG 3EPHA 2EJ4A 2EPCA 1YSAC 4R2SA 4F2JC 2EOOA 5KL3A 2EMCA 2MKDA 2EOMA 2EMBA 1B69A 4F6MA 2CTDA 4R2CA 2LVHA 2EOSA 2ENAA 4F6NA 1UBDC 2EOFA 1G2DC 2EL6A 2EP3A 2LCEA 2YTQA 2EMHA 2EM9A 5KL2A 1A1JA 2LV2A 2EN7A 2PRTA 2DMIA 2ELZA 2EQ0A 5KL4A 2EE8A 2DRPA 1A1IA 2ENCA 2EOIA 2WBSA 1TF6A 2EOJA 2EM0A 2MDGA 1ZAAC 2EPXA 1A1KA 2M9AA 1A1HA 2I13A 2WBTA 2EMAA 2EM2A 4FK5C 3EPLA 2EQ1A 1TN9A 1ZR9A 2EMYA 2YU8A 3EPJA 2EPAA 2LO3A 1RMDA 2EM8A 4GZNC 2RPCA 2YTDA 2HGHA 2YTPA 2EM3A 3VHTB 2EM4A 2EMFA 1ZU1A 1X5WA 2EOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CT1 A;  2JP9 A;  3UK3 C;  1TF3 A;  3MHH C;  2R1F A;  2E72 A;  2EL5 A;  2EOE A;  2NAB A;  2EM5 A;  1YUJ A;  1AAY A;  4R2A A;  2YTN A;  1X6F A;  2CSH A;  2EMK A;  4R2E A;  1G2F C;  2EN3 A;  5KL6 A;  2YSP A;  2YU5 A;  2ENH A;  2EN2 A;  2EPZ A;  1MEY C;  3MHS C;  5KL7 A;  2ELY A;  2EOX A;  2YSO A;  2EMX A;  1A1G A;  1X6H A;  2EOH A;  2EM6 A;  2EOQ A;  2BB8 A;  2VRD A;  2YTG A;  2EL4 A;  1P47 A;  4IJD A;  2EQ3 A;  2EML A;  2YTF A;  1X6E A;  2EN8 A;  4R2R A;  1BB8 A;  2EN1 A;  2YRM A;  2YTI A;  1Z1B A;  1UN6 B;  2EMI A;  2A25 A;  1JK1 A;  2EPU A;  5KL5 A;  2DGC A;  2YRH A;  2GLI A;  2MKN A;  2EN6 A;  1BBO A;  4R2Q A;  1NCS A;  2LT7 A;  2EPP A;  2EPR A;  1YUI A;  4X9J A;  2EOR A;  1WJP A;  1JK2 A;  2JPA A;  1KJK A;  4R2D A;  2EN4 A;  1X3C A;  2GHF A;  2YRK A;  2EMZ A;  2DLQ A;  2EOZ A;  2RSI A;  4IS1 C;  4M9V C;  2D9H A;  2YTO A;  2WCC 3;  2YTJ A;  2DLK A;  2WBU A;  1A1L A;  2EMW A;  2ADR A;  1DGC A;  1A1F A;  2EMG A;  4WSG A;  3M99 B;  2J7J A;  2YTE A;  2EM7 A;  1LLM C;  4R2P A;  3EPK A;  1F2I G;  3EPH A;  2EJ4 A;  2EPC A;  1YSA C;  4R2S A;  4F2J C;  2EOO A;  5KL3 A;  2EMC A;  2MKD A;  2EOM A;  2EMB A;  1B69 A;  4F6M A;  2CTD A;  4R2C A;  2LVH A;  2EOS A;  2ENA A;  4F6N A;  1UBD C;  2EOF A;  1G2D C;  2EL6 A;  2EP3 A;  2LCE A;  2YTQ A;  2EMH A;  2EM9 A;  5KL2 A;  1A1J A;  2LV2 A;  2EN7 A;  2PRT A;  2DMI A;  2ELZ A;  2EQ0 A;  5KL4 A;  2EE8 A;  2DRP A;  1A1I A;  2ENC A;  2EOI A;  2WBS A;  1TF6 A;  2EOJ A;  2EM0 A;  2MDG A;  1ZAA C;  2EPX A;  1A1K A;  2M9A A;  1A1H A;  2I13 A;  2WBT A;  2EMA A;  2EM2 A;  4FK5 C;  3EPL A;  2EQ1 A;  1TN9 A;  1ZR9 A;  2EMY A;  2YU8 A;  3EPJ A;  2EPA A;  2LO3 A;  1RMD A;  2EM8 A;  4GZN C;  2RPC A;  2YTD A;  2HGH A;  2YTP A;  2EM3 A;  3VHT B;  2EM4 A;  2EMF A;  1ZU1 A;  1X5W A;  2EOY A; 
#chains in the Genus database with same CATH topology
 3VYX A;  2NUF A;  1GQE A;  3MHH C;  4LF6 E;  4DKK A;  1GTK A;  2DIX A;  1ZBQ A;  2KOU A;  4NHR A;  4RH8 A;  4LTY A;  2UXD E;  4B3T E;  2YSP A;  2RS6 A;  1HNW E;  5IT9 C;  5A6K A;  2EPZ A;  4ZYD A;  3AV0 A;  2VRD A;  4R8O A;  1J26 A;  2EPN A;  2YTI A;  2L3J A;  2UUC E;  1N34 E;  1T4O A;  2I9I A;  4M30 A;  2MKN A;  2MDR A;  2M1S A;  4WX9 A;  1YYK A;  4NXN E;  1YPN A;  2EPP A;  1YUI A;  2JPA A;  2BBG A;  4WXC A;  4DV2 E;  4LFB E;  2EMZ A;  2YTO A;  2VQE E;  3KWR A;  4BC7 A;  1DGC A;  4WSG A;  4DR6 E;  2V8Q B;  1IBL E;  4LF8 E;  3EPH A;  5A6B D;  2LJH A;  5IV8 B;  2JOB A;  4ZYE A;  3ADI A;  2NA2 A;  1FKA E;  2EOO A;  4DUY E;  5AE2 A;  1T4L B;  2CTD A;  4O24 A;  5TSE A;  4F9B B;  2EPK X;  2EOS A;  2ENA A;  1UBD C;  4F9A B;  2EL6 A;  2EP3 A;  2YTQ A;  2RQL A;  4DV3 E;  2EM9 A;  4LU9 A;  5F3W A;  1N33 E;  4AQY E;  3ZOQ B;  2G7H A;  2EE8 A;  2WBS A;  3VYY A;  2EOJ A;  2MDG A;  3F6H A;  3T1H E;  2EPX A;  2M7Q A;  4R03 A;  2EM2 A;  2F8B A;  2UXC E;  1MGT A;  4O43 A;  2Q8U A;  3RMP A;  3EPJ A;  4F9C B;  4L8N A;  2LO3 A;  2YWQ A;  2V88 A;  3JU0 A;  2EM4 A;  5A6B A;  1X5W A;  1NEI A;  1EH6 A;  2V85 A;  2RSM A;  2V86 A;  3ADL A;  2F4V E;  1TF3 A;  4F54 A;  1T4N A;  4R2A A;  4X64 E;  1X6F A;  2CSH A;  2EMK A;  4R2E A;  2EPM X;  5IXM B;  2YT4 A;  5AE1 A;  5AE3 A;  5IWA E;  2HHH E;  4BC9 A;  2V87 A;  1J5E E;  2VQF E;  3DJW A;  2EN2 A;  1DQ3 A;  4ZYG A;  4JI6 E;  2JWO A;  4KHP E;  2B9D A;  5KL7 A;  3JAM C;  1A1G A;  1STU A;  2EM6 A;  4RHB B;  2BB8 A;  1AH5 A;  2LTS A;  2CPN A;  2YTG A;  1P47 A;  2EML A;  4YHH E;  1BB8 A;  1T38 A;  5LL6 R;  4KZS A;  1UN6 B;  4WSP A;  4M2Z A;  2A25 A;  2EPU A;  3BID A;  1XMQ E;  5KL5 A;  2N3G A;  2EN6 A;  2RTX A;  4LFA E;  3OML A;  3TQM A;  2LT7 A;  1IQO A;  2JOX A;  4WFT A;  2B7V A;  2EOZ A;  2HC5 A;  2RSI A;  4IS1 C;  4M9V C;  2LRS A;  1A1L A;  3QG5 C;  4O5G A;  2EMW A;  2ADR A;  2UXB E;  1EH8 A;  2UU9 E;  4DMI A;  2ODR D;  3THN A;  4TUI A;  2J7J A;  2YTE A;  1LLM C;  4BBY A;  1SFE A;  1WHN A;  1PKP A;  1SR9 A;  3BBG A;  2K4V A;  4DR5 E;  1PDA A;  1L4S A;  5T6J A;  5KL3 A;  2MKD A;  2FGG A;  2ZM6 E;  5A2Q C;  3HPZ A;  5LMU E;  5KL2 A;  4ZYH A;  2EQ0 A;  4DR7 E;  1HR0 E;  2DRP A;  2EOI A;  3H09 A;  1TF6 A;  2UUA E;  1I94 E;  3IWB A;  1ZAA C;  4X62 E;  4WYQ B;  2RS7 A;  1A1K A;  2YZT A;  1A1H A;  1XNQ E;  4FK5 C;  3EPL A;  1DI2 A;  4GEQ B;  4X65 E;  4X66 E;  2LBS B;  1WXR A;  2V83 A;  3J7Y p;  2EMY A;  2YU8 A;  4BS9 A;  1WRJ A;  2EPA A;  2LUP B;  2JVA A;  1ZBT A;  2DMY A;  2HGH A;  4LF9 E;  3LLH A;  2JYA A;  3J7A G;  3IWC A;  2JXP A;  2EOY A;  3IWD A;  1UIL A;  3P1X A;  2CT1 A;  2JP9 A;  4GKJ E;  3UK3 C;  2R1F A;  2E72 A;  2EL5 A;  1UHZ A;  2EOE A;  2L6M A;  2L2M A;  1AAY A;  2YTN A;  4DV5 E;  3ECR A;  1IBK E;  3KZY A;  3FIG A;  5LLQ A;  1YYO A;  2EN3 A;  5KL6 A;  2L2K B;  5A69 A;  5CFF E;  4MLV A;  3HQ1 A;  1MEY C;  2LUQ A;  4DUZ E;  2JR1 A;  2EMX A;  2KHX A;  1X6H A;  3HTX A;  2EOQ A;  2GPI A;  2IHR 1;  4IJD A;  1XMO E;  1X6E A;  2EN8 A;  4R2R A;  2EN1 A;  2YRM A;  1Z1B A;  1N36 E;  4DR3 E;  1JK1 A;  1RC7 A;  3C6K A;  2GLI A;  2DGC A;  2YRH A;  1XNR E;  4JI4 E;  4R2Q A;  1HNX E;  1IBM E;  2M4I A;  4BHB A;  3ADJ A;  4J8Z A;  2EZ6 A;  2EPR A;  2EOR A;  1JK2 A;  4R2D A;  1X3C A;  2GHF A;  1EH7 A;  1N3G A;  4JI8 E;  2WCC 3;  2LJU A;  2YTJ A;  2DLK A;  4B3M E;  2WBU A;  4WPY A;  1EKZ A;  4Q28 A;  2EM7 A;  2B3T B;  5DNY A;  4R2P A;  4NXM E;  5ADZ A;  4BHC A;  4R2S A;  4BCA A;  4JI0 E;  3KZZ A;  5A6A A;  2EOM A;  2EMB A;  4R2C A;  2E1M A;  2LVH A;  4P7D A;  4NZV A;  2UUB E;  2EOF A;  4B3S E;  2EPL X;  2L3C A;  1WHQ A;  2LCE A;  2ODR C;  2EMH A;  2PRT A;  2DMI A;  3ADG A;  4I8O A;  2ELZ A;  5KL4 A;  4TUG A;  1RQ0 A;  4O4K A;  2H36 X;  2L33 A;  2EWL A;  2B7T A;  2HJJ A;  4DR2 E;  1N32 E;  4Q35 B;  2WBT A;  3F6G A;  2EQ1 A;  1TN9 A;  3AUZ A;  1QU6 A;  1RMD A;  3BGH A;  2YTD A;  4DV1 E;  2YTP A;  2EM3 A;  4JI5 E;  1YYW A;  2FV4 B;  3C4B A;  4DV0 E;  3MSW A;  1ZU1 A;  2NUG A;  4P78 A;  3C4T A;  4DR4 E;  5BR8 E;  4DV6 E;  2N8X A;  4N4R B;  2E5L E;  1X49 A;  3THO B;  5LMN E;  4GKK E;  2NAB A;  4L5N C;  2EM5 A;  1YUJ A;  1PJQ A;  2LTR A;  4M0V A;  2FTX B;  4HEI A;  1G2F C;  2KON A;  1IQS A;  4HTG A;  2N3H A;  2YU5 A;  2ENH A;  3J81 C;  4YY3 E;  1X48 A;  3MHS C;  4JI1 E;  3JTZ A;  2ELY A;  2EOX A;  2YSO A;  3L00 A;  3K6Q A;  2EOH A;  4X8W A;  3T1Y E;  2YPN A;  4LFC E;  2EL4 A;  2K7I A;  2EQ3 A;  2L2N A;  4BMJ A;  2YTF A;  2L8T A;  5AC4 A;  2MC6 A;  1PJS A;  1BBG A;  2MC5 A;  3EQ1 A;  1X47 A;  2EMI A;  3C6M A;  2LE2 A;  1BBO A;  3OTO E;  1NCS A;  4X9J A;  1WJP A;  5FLX C;  1KJK A;  2EN4 A;  2YRK A;  4OOG C;  2DLQ A;  1KYQ A;  2D9H A;  1YFH A;  2VF1 A;  3J80 C;  1QNT A;  5AAS A;  1A1F A;  2EMG A;  4OX9 E;  3M99 B;  2NUE A;  3BF2 A;  3EPK A;  1F2I G;  4KWY A;  2EJ4 A;  2EPC A;  1O0W A;  1YSA C;  4LF4 E;  4F2J C;  2WZO A;  1GZ6 A;  1FJG E;  2EMC A;  1B69 A;  4JI3 E;  4F6M A;  2R76 A;  4F6N A;  1G2D C;  1T39 A;  1A1J A;  2JY9 A;  2LV2 A;  2EN7 A;  4DV7 E;  4LF5 E;  4B3R E;  5A6J A;  3HPS A;  3DF6 A;  2L92 A;  2V89 A;  4DV4 E;  1A1I A;  4JI2 E;  4K0K E;  2ENC A;  4MLQ A;  1PJT A;  3VK6 A;  2EM0 A;  2LMZ A;  2DB2 A;  4JI7 E;  4JV5 E;  1IMU A;  4DR1 E;  5AC5 A;  2DSY A;  2M9A A;  4WXD A;  2I13 A;  2EMA A;  1ZR9 A;  2EPO A;  2VE7 C;  2EM8 A;  4GZN C;  2RPC A;  3LML A;  4JYA E;  3VHT B;  4LF7 E;  2EMF A;  3HXL A;  1YZ9 A;  1HNZ E; 
#chains in the Genus database with same CATH homology
 2CT1 A;  2JP9 A;  3UK3 C;  1TF3 A;  3MHH C;  2R1F A;  2E72 A;  2EL5 A;  2EOE A;  2NAB A;  2EM5 A;  1YUJ A;  1AAY A;  4R2A A;  2YTN A;  1X6F A;  2CSH A;  2EMK A;  4R2E A;  1G2F C;  2EN3 A;  5KL6 A;  2YSP A;  2YU5 A;  2ENH A;  2EN2 A;  2EPZ A;  1MEY C;  3MHS C;  5KL7 A;  2ELY A;  2EOX A;  2YSO A;  2EMX A;  1A1G A;  1X6H A;  2EOH A;  2EM6 A;  2EOQ A;  2BB8 A;  2VRD A;  2YTG A;  2EL4 A;  1P47 A;  4IJD A;  2EQ3 A;  2EML A;  2YTF A;  1X6E A;  2EN8 A;  4R2R A;  1BB8 A;  2EN1 A;  2YRM A;  2YTI A;  1Z1B A;  1UN6 B;  2EMI A;  2A25 A;  1JK1 A;  2EPU A;  5KL5 A;  2DGC A;  2YRH A;  2GLI A;  2MKN A;  2EN6 A;  1BBO A;  4R2Q A;  1NCS A;  2LT7 A;  2EPP A;  2EPR A;  1YUI A;  4X9J A;  2EOR A;  1WJP A;  1JK2 A;  2JPA A;  1KJK A;  4R2D A;  2EN4 A;  1X3C A;  2GHF A;  2YRK A;  2EMZ A;  2DLQ A;  2EOZ A;  2RSI A;  4IS1 C;  4M9V C;  2D9H A;  2YTO A;  2WCC 3;  2YTJ A;  2DLK A;  2WBU A;  1A1L A;  2EMW A;  2ADR A;  1DGC A;  1A1F A;  2EMG A;  4WSG A;  3M99 B;  2J7J A;  2YTE A;  2EM7 A;  1LLM C;  4R2P A;  3EPK A;  1F2I G;  3EPH A;  2EJ4 A;  2EPC A;  1YSA C;  4R2S A;  4F2J C;  2EOO A;  5KL3 A;  2EMC A;  2MKD A;  2EOM A;  2EMB A;  1B69 A;  4F6M A;  2CTD A;  4R2C A;  2LVH A;  2EOS A;  2ENA A;  4F6N A;  1UBD C;  2EOF A;  1G2D C;  2EL6 A;  2EP3 A;  2LCE A;  2YTQ A;  2EMH A;  2EM9 A;  5KL2 A;  1A1J A;  2LV2 A;  2EN7 A;  2PRT A;  2DMI A;  2ELZ A;  2EQ0 A;  5KL4 A;  2EE8 A;  2DRP A;  1A1I A;  2ENC A;  2EOI A;  2WBS A;  1TF6 A;  2EOJ A;  2EM0 A;  2MDG A;  1ZAA C;  2EPX A;  1A1K A;  2M9A A;  1A1H A;  2I13 A;  2WBT A;  2EMA A;  2EM2 A;  4FK5 C;  3EPL A;  2EQ1 A;  1TN9 A;  1ZR9 A;  2EMY A;  2YU8 A;  3EPJ A;  2EPA A;  2LO3 A;  1RMD A;  2EM8 A;  4GZN C;  2RPC A;  2YTD A;  2HGH A;  2YTP A;  2EM3 A;  3VHT B;  2EM4 A;  2EMF A;  1ZU1 A;  1X5W A;  2EOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...