2EMXA

Solution structure of the c2h2 type zinc finger (region 273-303) of human zinc finger protein 268
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
44
structure length
44
Chain Sequence
GSSGSSGEKPFGCSCCEKAFSSKSYLLVHQQTHAEEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 268
publication title Solution structure of the C2H2 type zinc finger (region 273-303) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 8
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emxA01
2M9AA 2I13A 1A1JA 1DGCA 1X6FA 3EPLA 2EM3A 2EOZA 2EPAA 1AAYA 2YTDA 2LO3A 5KL6A 2J7JA 2RPCA 1Z1BA 1A1IA 1LLMC 4R2SA 2PRTA 2ELYA 2EOOA 2EPXA 2WBSA 2EMIA 2EM8A 1JK1A 3MHSC 1TN9A 1X5WA 2D9HA 4R2QA 2YRMA 1JK2A 1YUIA 2EM4A 3MHHC 2WBTA 2YTPA 1A1LA 2CTDA 1G2DC 2YU8A 2EMWA 2EOXA 2EMFA 2DLQA 2EM5A 2WCC3 1TF6A 1B69A 2EMHA 2YU5A 1YUJA 2LVHA 4F6MA 2ADRA 4IS1C 2EP3A 2YTOA 4R2CA 2EL6A 2EOHA 5KL7A 2GLIA 2BB8A 3VHTB 4R2EA 3EPJA 1X6HA 2EQ1A 1A1GA 2E72A 1ZU1A 1TF3A 1X3CA 1YSAC 1P47A 1F2IG 2EMZA 2EOJA 2WBUA 2EN3A 5KL2A 4F6NA 2DRPA 2EPPA 2R1FA 4R2RA 2MDGA 2EPUA 4R2PA 2JP9A 1BB8A 2EM2A 1UN6B 2EN7A 2YSOA 2EOEA 2YRHA 2EMXA 5KL3A 2EN4A 2DGCA 2JPAA 1BBOA 2EM0A 4GZNC 1ZR9A 4M9VC 2EPCA 2EMGA 2YTGA 4IJDA 5KL4A 2YSPA 4WSGA 1X6EA 2EOIA 2YTNA 2EMBA 2EORA 3EPHA 1A1HA 2YTQA 3EPKA 2EM6A 2ENHA 2EPZA 2EE8A 1RMDA 2EN6A 4X9JA 2ENAA 2EM7A 2EPRA 2EOMA 4F2JC 2EMKA 1UBDC 2CT1A 2EOSA 2YTIA 2GHFA 2EOYA 1ZAAC 2EOQA 1G2FC 1WJPA 2RSIA 2LT7A 2MKNA 4FK5C 1NCSA 2EQ0A 1A1FA 1MEYC 2YRKA 2HGHA 4R2AA 3M99B 2EL4A 1A1KA 5KL5A 2ENCA 2DLKA 2MKDA 2EM9A 3UK3C 2EL5A 4R2DA 2LV2A 2NABA 2ELZA 2EQ3A 2EMAA 2YTEA 2EOFA 2EJ4A 1KJKA 2EN2A 2EMLA 2YTJA 2CSHA 2A25A 2EMCA 2DMIA 2EMYA 2LCEA 2VRDA 2EN8A 2EN1A 2YTFA
chains in the Genus database with same CATH superfamily
2M9AA 1A1JA 2RQLA 1FJGE 4DUYE 2EM3A 2LRSA 5A69A 2YTDA 1T4OA 3J80C 2MC6A 5F3WA 2J7JA 4DV3E 1Z1BA 1A1IA 1LLMC 2ELYA 2V88A 1YZ9A 2WBSA 2EMIA 2E1MA 1TN9A 3MHSC 3IWCA 3ADGA 2D9HA 4R2QA 2NA2A 2EMWA 2DB2A 2LTSA 3LMLA 4OX9E 5DNYA 1TF6A 1HNWE 1T38A 1RQ0A 1B69A 1J5EE 4O24A 4LF7E 2UXBE 2LMZA 4JI5E 1WHQA 2EP3A 3KZZA 2V83A 3L00A 3AUZA 4BHBA 4X66E 1N36E 3VHTB 3EPJA 1N33E 2L6MA 1A1GA 2E72A 1YSAC 2EMZA 2DRPA 4F6NA 5KL2A 1N32E 4O5GA 3J7AG 4LF9E 2EPUA 4MLQA 2VE7C 1EKZA 4P78A 5A6BD 2EOEA 2YRHA 2EMXA 5KL3A 3T1YE 4LFBE 2EPMX 2HC5A 4NXNE 4DV4E 1SFEA 2YSPA 2EPLX 4WSGA 3VYYA 1IQOA 4L8NA 2JR1A 1PDAA 1EH8A 2ENHA 4MLVA 4DR7E 1RMDA 3J7Yp 2UUBE 3FIGA 3HQ1A 2L2MA 1YYOA 3HTXA 3P1XA 1X49A 3IWBA 4BC7A 4NHRA 2EOSA 3JTZA 2EOYA 4JI4E 2LT7A 4FK5C 3LLHA 2EQ0A 2RS6A 1IBKE 3ADIA 2DMYA 4DV1E 2JY9A 2LJUA 2N8XA 5A2QC 4DKKA 3HPSA 1A1KA 3HXLA 4WXDA 3ECRA 2K7IA 2LV2A 2NABA 2FTXB 1J26A 2F4VE 4NXME 2YTJA 2LUQA 1YYWA 5IWAE 2DMIA 1HNZE 5IXMB 2EN1A 4F9BB 2HHHE 2G7HA 2ZM6E 2I13A 1IBME 1PKPA 4BBYA 3F6HA 3QG5C 2LO3A 5FLXC 4X64E 4KHPE 2RPCA 4JI2E 2PRTA 2B9DA 2EOOA 3H09A 1JK1A 5A6BA 1IBLE 1MGTA 4DV2E 4RHBB 4WPYA 2KHXA 1T4LB 1XMOE 3T1HE 2YU8A 5A6JA 2DLQA 2EZ6A 2FGGA 4JYAE 4J8ZA 4LFAE 2EMHA 4F54A 1YUJA 4LFCE 4F6MA 2V87A 2UXDE 4IS1C 3VYXA 4NZVA 2L2KB 2EL6A 5KL7A 5IT9C 1XMQE 4ZYEA 1XNRE 4R03A 4R2EA 4DR3E 1YFHA 1ZU1A 5AC4A 1TF3A 3KZYA 1L4SA 2EN3A 2DIXA 3BBGA 2JP9A 4R2PA 2EPKX 2YT4A 1T4NA 2FV4B 1AH5A 2B7TA 1ZBTA 4HEIA 4BHCA 2JOXA 2UU9E 2DSYA 2EM0A 4DR2E 1SR9A 4M9VC 2M4IA 4DMIA 1QNTA 2EMGA 2YTGA 4F9AB 4JI3E 5KL4A 4GKKE 4LF5E 3JAMC 2EPNA 3TQMA 2K4VA 3DJWA 4LTYA 2YTQA 2L2NA 4X65E 2EN6A 4ZYHA 4X9JA 2BBGA 2EM7A 2EPRA 4Q28A 2EOMA 1NEIA 1N3GA 4M30A 3BF2A 2EOQA 1WJPA 2RSIA 5AC5A 4RH8A 2YWQA 1X48A 4OOGC 2YRKA 2N3GA 2JOBA 2ENCA 2NUEA 1HR0E 2JWOA 2V8QB 4LF6E 4DR1E 3UK3C 1DQ3A 4R2DA 2EQ3A 2EMAA 2EOFA 1KJKA 4AQYE 3C6KA 2L92A 2ODRC 2A25A 2LCEA 4WXCA 1GTKA 3BGHA 5LL6R 4DR6E 4R8OA 2WZOA 1DGCA 3EPLA 4N4RB 2EOZA 2EPOA 1AAYA 2R76A 1X47A 2YZTA 5KL6A 1WXRA 2KOUA 3HPZA 3AV0A 4K0KE 1O0WA 4P7DA 2CPNA 4ZYGA 2EM4A 4GKJE 2HJJA 2YTPA 1IMUA 2CTDA 2RS7A 2EOXA 1YPNA 4BMJA 2EM5A 5ADZA 2L8TA 2VF1A 2WCC3 2NUGA 2LVHA 3C6MA 1T39A 3BIDA 2YTOA 4R2CA 2EOHA 1FKAE 2GLIA 2JXPA 2L33A 2BB8A 4KWYA 1X6HA 2KONA 4DR5E 2EQ1A 1QU6A 4M0VA 1I94E 2IHR1 3J81C 3C4TA 2EOJA 2I9IA 2WBUA 2EPPA 2R1FA 1BB8A 5AE1A 4YHHE 2EN7A 2YSOA 2Q8UA 3JU0A 1RC7A 4DUZE 2L3CA 2EN4A 4F9CB 4M2ZA 1BBOA 1ZR9A 2EPCA 4IJDA 4TUGA 2EOIA 4DV6E 2ODRD 2EMBA 2EORA 1A1HA 4LF4E 2MDRA 3EPKA 2EM6A 3THNA 4LF8E 2ENAA 3DF6A 3ADJA 2V89A 5LLQA 2LUPB 2MC5A 2B7VA 5BR8E 3C4BA 1PJQA 4F2JC 3VK6A 1UBDC 2CT1A 5CFFE 2GHFA 2L3JA 1ZAAC 5LMUE 2JYAA 2NUFA 2MKNA 1NCSA 4O4KA 2M1SA 4R2AA 3M99B 1KYQA 4X8WA 5KL5A 2DLKA 2EM9A 2EWLA 4JI7E 2EMLA 2CSHA 4TUIA 2VRDA 3THOB 4WYQB 2EN8A 1PJTA 4WSPA 4KZSA 2VQEE 3EQ1A 4B3ME 3OMLA 2V85A 1X6FA 5A6AA 2UXCE 2EPAA 5T6JA 4BCAA 4R2SA 4L5NC 4JI8E 1DI2A 3ZOQB 2EPXA 2EM8A 4B3RE 1X5WA 4HTGA 1JK2A 2YRMA 4BC9A 1YUIA 3MHHC 2WBTA 1STUA 1BBGA 4I8OA 1A1LA 4JI0E 4DV7E 1G2DC 2EMFA 2N3HA 3RMPA 4ZYDA 4JV5E 2VQFE 4JI1E 4YY3E 2LTRA 2YU5A 4Q35B 1PJSA 2F8BA 2ADRA 4X62E 2H36X 4BS9A 1X3CA 1P47A 1F2IG 4B3TE 2RSMA 1XNQE 4R2RA 2MDGA 2EM2A 5IV8B 1UHZA 1UN6B 3ADLA 4LU9A 1EH7A 3IWDA 2DGCA 2JPAA 1HNXE 4GZNC 4JI6E 1GZ6A 1IQSA 1X6EA 2LE2A 2YTNA 3EPHA 3K6QA 1GQEA 4DR4E 2EPZA 2EE8A 4WX9A 2JVAA 2LBSB 5LMNE 1EH6A 2UUCE 2E5LE 2YPNA 2EMKA 2V86A 3F6GA 2YTIA 1N34E 1G2FC 2RTXA 1UILA 1A1FA 1MEYC 2HGHA 1YYKA 4WFTA 4DV0E 3KWRA 5TSEA 2EL4A 5AASA 2MKDA 5AE2A 4O43A 2EL5A 2GPIA 2ELZA 4B3SE 2YTEA 2UUAE 1ZBQA 2EJ4A 2EN2A 5AE3A 1WHNA 2M7QA 5A6KA 2EMCA 1WRJA 2EMYA 4DV5E 4GEQB 2YTFA 2B3TB 3OTOE 2LJHA 3MSWA
chains in the Genus database with same CATH topology
2M9AA 2I13A 1A1JA 1DGCA 1X6FA 3EPLA 2EM3A 2EOZA 2EPAA 1AAYA 2YTDA 2LO3A 5KL6A 2J7JA 2RPCA 1Z1BA 1A1IA 1LLMC 4R2SA 2PRTA 2ELYA 2EOOA 2EPXA 2WBSA 2EMIA 2EM8A 1JK1A 3MHSC 1TN9A 1X5WA 2D9HA 4R2QA 2YRMA 1JK2A 1YUIA 2EM4A 3MHHC 2WBTA 2YTPA 1A1LA 2CTDA 1G2DC 2YU8A 2EMWA 2EOXA 2EMFA 2DLQA 2EM5A 2WCC3 1TF6A 1B69A 2EMHA 2YU5A 1YUJA 2LVHA 4F6MA 2ADRA 4IS1C 2EP3A 2YTOA 4R2CA 2EL6A 2EOHA 5KL7A 2GLIA 2BB8A 3VHTB 4R2EA 3EPJA 1X6HA 2EQ1A 1A1GA 2E72A 1ZU1A 1TF3A 1X3CA 1YSAC 1P47A 1F2IG 2EMZA 2EOJA 2WBUA 2EN3A 5KL2A 4F6NA 2DRPA 2EPPA 2R1FA 4R2RA 2MDGA 2EPUA 4R2PA 2JP9A 1BB8A 2EM2A 1UN6B 2EN7A 2YSOA 2EOEA 2YRHA 2EMXA 5KL3A 2EN4A 2DGCA 2JPAA 1BBOA 2EM0A 4GZNC 1ZR9A 4M9VC 2EPCA 2EMGA 2YTGA 4IJDA 5KL4A 2YSPA 4WSGA 1X6EA 2EOIA 2YTNA 2EMBA 2EORA 3EPHA 1A1HA 2YTQA 3EPKA 2EM6A 2ENHA 2EPZA 2EE8A 1RMDA 2EN6A 4X9JA 2ENAA 2EM7A 2EPRA 2EOMA 4F2JC 2EMKA 1UBDC 2CT1A 2EOSA 2YTIA 2GHFA 2EOYA 1ZAAC 2EOQA 1G2FC 1WJPA 2RSIA 2LT7A 2MKNA 4FK5C 1NCSA 2EQ0A 1A1FA 1MEYC 2YRKA 2HGHA 4R2AA 3M99B 2EL4A 1A1KA 5KL5A 2ENCA 2DLKA 2MKDA 2EM9A 3UK3C 2EL5A 4R2DA 2LV2A 2NABA 2ELZA 2EQ3A 2EMAA 2YTEA 2EOFA 2EJ4A 1KJKA 2EN2A 2EMLA 2YTJA 2CSHA 2A25A 2EMCA 2DMIA 2EMYA 2LCEA 2VRDA 2EN8A 2EN1A 2YTFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M9A A;  2I13 A;  1A1J A;  1DGC A;  1X6F A;  3EPL A;  2EM3 A;  2EOZ A;  2EPA A;  1AAY A;  2YTD A;  2LO3 A;  5KL6 A;  2J7J A;  2RPC A;  1Z1B A;  1A1I A;  1LLM C;  4R2S A;  2PRT A;  2ELY A;  2EOO A;  2EPX A;  2WBS A;  2EMI A;  2EM8 A;  1JK1 A;  3MHS C;  1TN9 A;  1X5W A;  2D9H A;  4R2Q A;  2YRM A;  1JK2 A;  1YUI A;  2EM4 A;  3MHH C;  2WBT A;  2YTP A;  1A1L A;  2CTD A;  1G2D C;  2YU8 A;  2EMW A;  2EOX A;  2EMF A;  2DLQ A;  2EM5 A;  2WCC 3;  1TF6 A;  1B69 A;  2EMH A;  2YU5 A;  1YUJ A;  2LVH A;  4F6M A;  2ADR A;  4IS1 C;  2EP3 A;  2YTO A;  4R2C A;  2EL6 A;  2EOH A;  5KL7 A;  2GLI A;  2BB8 A;  3VHT B;  4R2E A;  3EPJ A;  1X6H A;  2EQ1 A;  1A1G A;  2E72 A;  1ZU1 A;  1TF3 A;  1X3C A;  1YSA C;  1P47 A;  1F2I G;  2EMZ A;  2EOJ A;  2WBU A;  2EN3 A;  5KL2 A;  4F6N A;  2DRP A;  2EPP A;  2R1F A;  4R2R A;  2MDG A;  2EPU A;  4R2P A;  2JP9 A;  1BB8 A;  2EM2 A;  1UN6 B;  2EN7 A;  2YSO A;  2EOE A;  2YRH A;  2EMX A;  5KL3 A;  2EN4 A;  2DGC A;  2JPA A;  1BBO A;  2EM0 A;  4GZN C;  1ZR9 A;  4M9V C;  2EPC A;  2EMG A;  2YTG A;  4IJD A;  5KL4 A;  2YSP A;  4WSG A;  1X6E A;  2EOI A;  2YTN A;  2EMB A;  2EOR A;  3EPH A;  1A1H A;  2YTQ A;  3EPK A;  2EM6 A;  2ENH A;  2EPZ A;  2EE8 A;  1RMD A;  2EN6 A;  4X9J A;  2ENA A;  2EM7 A;  2EPR A;  2EOM A;  4F2J C;  2EMK A;  1UBD C;  2CT1 A;  2EOS A;  2YTI A;  2GHF A;  2EOY A;  1ZAA C;  2EOQ A;  1G2F C;  1WJP A;  2RSI A;  2LT7 A;  2MKN A;  4FK5 C;  1NCS A;  2EQ0 A;  1A1F A;  1MEY C;  2YRK A;  2HGH A;  4R2A A;  3M99 B;  2EL4 A;  1A1K A;  5KL5 A;  2ENC A;  2DLK A;  2MKD A;  2EM9 A;  3UK3 C;  2EL5 A;  4R2D A;  2LV2 A;  2NAB A;  2ELZ A;  2EQ3 A;  2EMA A;  2YTE A;  2EOF A;  2EJ4 A;  1KJK A;  2EN2 A;  2EML A;  2YTJ A;  2CSH A;  2A25 A;  2EMC A;  2DMI A;  2EMY A;  2LCE A;  2VRD A;  2EN8 A;  2EN1 A;  2YTF A; 
#chains in the Genus database with same CATH topology
 2M9A A;  1A1J A;  2RQL A;  1FJG E;  4DUY E;  2EM3 A;  2LRS A;  5A69 A;  2YTD A;  1T4O A;  3J80 C;  2MC6 A;  5F3W A;  2J7J A;  4DV3 E;  1Z1B A;  1A1I A;  1LLM C;  2ELY A;  2V88 A;  1YZ9 A;  2WBS A;  2EMI A;  2E1M A;  1TN9 A;  3MHS C;  3IWC A;  3ADG A;  2D9H A;  4R2Q A;  2NA2 A;  2EMW A;  2DB2 A;  2LTS A;  3LML A;  4OX9 E;  5DNY A;  1TF6 A;  1HNW E;  1T38 A;  1RQ0 A;  1B69 A;  1J5E E;  4O24 A;  4LF7 E;  2UXB E;  2LMZ A;  4JI5 E;  1WHQ A;  2EP3 A;  3KZZ A;  2V83 A;  3L00 A;  3AUZ A;  4BHB A;  4X66 E;  1N36 E;  3VHT B;  3EPJ A;  1N33 E;  2L6M A;  1A1G A;  2E72 A;  1YSA C;  2EMZ A;  2DRP A;  4F6N A;  5KL2 A;  1N32 E;  4O5G A;  3J7A G;  4LF9 E;  2EPU A;  4MLQ A;  2VE7 C;  1EKZ A;  4P78 A;  5A6B D;  2EOE A;  2YRH A;  2EMX A;  5KL3 A;  3T1Y E;  4LFB E;  2EPM X;  2HC5 A;  4NXN E;  4DV4 E;  1SFE A;  2YSP A;  2EPL X;  4WSG A;  3VYY A;  1IQO A;  4L8N A;  2JR1 A;  1PDA A;  1EH8 A;  2ENH A;  4MLV A;  4DR7 E;  1RMD A;  3J7Y p;  2UUB E;  3FIG A;  3HQ1 A;  2L2M A;  1YYO A;  3HTX A;  3P1X A;  1X49 A;  3IWB A;  4BC7 A;  4NHR A;  2EOS A;  3JTZ A;  2EOY A;  4JI4 E;  2LT7 A;  4FK5 C;  3LLH A;  2EQ0 A;  2RS6 A;  1IBK E;  3ADI A;  2DMY A;  4DV1 E;  2JY9 A;  2LJU A;  2N8X A;  5A2Q C;  4DKK A;  3HPS A;  1A1K A;  3HXL A;  4WXD A;  3ECR A;  2K7I A;  2LV2 A;  2NAB A;  2FTX B;  1J26 A;  2F4V E;  4NXM E;  2YTJ A;  2LUQ A;  1YYW A;  5IWA E;  2DMI A;  1HNZ E;  5IXM B;  2EN1 A;  4F9B B;  2HHH E;  2G7H A;  2ZM6 E;  2I13 A;  1IBM E;  1PKP A;  4BBY A;  3F6H A;  3QG5 C;  2LO3 A;  5FLX C;  4X64 E;  4KHP E;  2RPC A;  4JI2 E;  2PRT A;  2B9D A;  2EOO A;  3H09 A;  1JK1 A;  5A6B A;  1IBL E;  1MGT A;  4DV2 E;  4RHB B;  4WPY A;  2KHX A;  1T4L B;  1XMO E;  3T1H E;  2YU8 A;  5A6J A;  2DLQ A;  2EZ6 A;  2FGG A;  4JYA E;  4J8Z A;  4LFA E;  2EMH A;  4F54 A;  1YUJ A;  4LFC E;  4F6M A;  2V87 A;  2UXD E;  4IS1 C;  3VYX A;  4NZV A;  2L2K B;  2EL6 A;  5KL7 A;  5IT9 C;  1XMQ E;  4ZYE A;  1XNR E;  4R03 A;  4R2E A;  4DR3 E;  1YFH A;  1ZU1 A;  5AC4 A;  1TF3 A;  3KZY A;  1L4S A;  2EN3 A;  2DIX A;  3BBG A;  2JP9 A;  4R2P A;  2EPK X;  2YT4 A;  1T4N A;  2FV4 B;  1AH5 A;  2B7T A;  1ZBT A;  4HEI A;  4BHC A;  2JOX A;  2UU9 E;  2DSY A;  2EM0 A;  4DR2 E;  1SR9 A;  4M9V C;  2M4I A;  4DMI A;  1QNT A;  2EMG A;  2YTG A;  4F9A B;  4JI3 E;  5KL4 A;  4GKK E;  4LF5 E;  3JAM C;  2EPN A;  3TQM A;  2K4V A;  3DJW A;  4LTY A;  2YTQ A;  2L2N A;  4X65 E;  2EN6 A;  4ZYH A;  4X9J A;  2BBG A;  2EM7 A;  2EPR A;  4Q28 A;  2EOM A;  1NEI A;  1N3G A;  4M30 A;  3BF2 A;  2EOQ A;  1WJP A;  2RSI A;  5AC5 A;  4RH8 A;  2YWQ A;  1X48 A;  4OOG C;  2YRK A;  2N3G A;  2JOB A;  2ENC A;  2NUE A;  1HR0 E;  2JWO A;  2V8Q B;  4LF6 E;  4DR1 E;  3UK3 C;  1DQ3 A;  4R2D A;  2EQ3 A;  2EMA A;  2EOF A;  1KJK A;  4AQY E;  3C6K A;  2L92 A;  2ODR C;  2A25 A;  2LCE A;  4WXC A;  1GTK A;  3BGH A;  5LL6 R;  4DR6 E;  4R8O A;  2WZO A;  1DGC A;  3EPL A;  4N4R B;  2EOZ A;  2EPO A;  1AAY A;  2R76 A;  1X47 A;  2YZT A;  5KL6 A;  1WXR A;  2KOU A;  3HPZ A;  3AV0 A;  4K0K E;  1O0W A;  4P7D A;  2CPN A;  4ZYG A;  2EM4 A;  4GKJ E;  2HJJ A;  2YTP A;  1IMU A;  2CTD A;  2RS7 A;  2EOX A;  1YPN A;  4BMJ A;  2EM5 A;  5ADZ A;  2L8T A;  2VF1 A;  2WCC 3;  2NUG A;  2LVH A;  3C6M A;  1T39 A;  3BID A;  2YTO A;  4R2C A;  2EOH A;  1FKA E;  2GLI A;  2JXP A;  2L33 A;  2BB8 A;  4KWY A;  1X6H A;  2KON A;  4DR5 E;  2EQ1 A;  1QU6 A;  4M0V A;  1I94 E;  2IHR 1;  3J81 C;  3C4T A;  2EOJ A;  2I9I A;  2WBU A;  2EPP A;  2R1F A;  1BB8 A;  5AE1 A;  4YHH E;  2EN7 A;  2YSO A;  2Q8U A;  3JU0 A;  1RC7 A;  4DUZ E;  2L3C A;  2EN4 A;  4F9C B;  4M2Z A;  1BBO A;  1ZR9 A;  2EPC A;  4IJD A;  4TUG A;  2EOI A;  4DV6 E;  2ODR D;  2EMB A;  2EOR A;  1A1H A;  4LF4 E;  2MDR A;  3EPK A;  2EM6 A;  3THN A;  4LF8 E;  2ENA A;  3DF6 A;  3ADJ A;  2V89 A;  5LLQ A;  2LUP B;  2MC5 A;  2B7V A;  5BR8 E;  3C4B A;  1PJQ A;  4F2J C;  3VK6 A;  1UBD C;  2CT1 A;  5CFF E;  2GHF A;  2L3J A;  1ZAA C;  5LMU E;  2JYA A;  2NUF A;  2MKN A;  1NCS A;  4O4K A;  2M1S A;  4R2A A;  3M99 B;  1KYQ A;  4X8W A;  5KL5 A;  2DLK A;  2EM9 A;  2EWL A;  4JI7 E;  2EML A;  2CSH A;  4TUI A;  2VRD A;  3THO B;  4WYQ B;  2EN8 A;  1PJT A;  4WSP A;  4KZS A;  2VQE E;  3EQ1 A;  4B3M E;  3OML A;  2V85 A;  1X6F A;  5A6A A;  2UXC E;  2EPA A;  5T6J A;  4BCA A;  4R2S A;  4L5N C;  4JI8 E;  1DI2 A;  3ZOQ B;  2EPX A;  2EM8 A;  4B3R E;  1X5W A;  4HTG A;  1JK2 A;  2YRM A;  4BC9 A;  1YUI A;  3MHH C;  2WBT A;  1STU A;  1BBG A;  4I8O A;  1A1L A;  4JI0 E;  4DV7 E;  1G2D C;  2EMF A;  2N3H A;  3RMP A;  4ZYD A;  4JV5 E;  2VQF E;  4JI1 E;  4YY3 E;  2LTR A;  2YU5 A;  4Q35 B;  1PJS A;  2F8B A;  2ADR A;  4X62 E;  2H36 X;  4BS9 A;  1X3C A;  1P47 A;  1F2I G;  4B3T E;  2RSM A;  1XNQ E;  4R2R A;  2MDG A;  2EM2 A;  5IV8 B;  1UHZ A;  1UN6 B;  3ADL A;  4LU9 A;  1EH7 A;  3IWD A;  2DGC A;  2JPA A;  1HNX E;  4GZN C;  4JI6 E;  1GZ6 A;  1IQS A;  1X6E A;  2LE2 A;  2YTN A;  3EPH A;  3K6Q A;  1GQE A;  4DR4 E;  2EPZ A;  2EE8 A;  4WX9 A;  2JVA A;  2LBS B;  5LMN E;  1EH6 A;  2UUC E;  2E5L E;  2YPN A;  2EMK A;  2V86 A;  3F6G A;  2YTI A;  1N34 E;  1G2F C;  2RTX A;  1UIL A;  1A1F A;  1MEY C;  2HGH A;  1YYK A;  4WFT A;  4DV0 E;  3KWR A;  5TSE A;  2EL4 A;  5AAS A;  2MKD A;  5AE2 A;  4O43 A;  2EL5 A;  2GPI A;  2ELZ A;  4B3S E;  2YTE A;  2UUA E;  1ZBQ A;  2EJ4 A;  2EN2 A;  5AE3 A;  1WHN A;  2M7Q A;  5A6K A;  2EMC A;  1WRJ A;  2EMY A;  4DV5 E;  4GEQ B;  2YTF A;  2B3T B;  3OTO E;  2LJH A;  3MSW A; 
#chains in the Genus database with same CATH homology
 2M9A A;  2I13 A;  1A1J A;  1DGC A;  1X6F A;  3EPL A;  2EM3 A;  2EOZ A;  2EPA A;  1AAY A;  2YTD A;  2LO3 A;  5KL6 A;  2J7J A;  2RPC A;  1Z1B A;  1A1I A;  1LLM C;  4R2S A;  2PRT A;  2ELY A;  2EOO A;  2EPX A;  2WBS A;  2EMI A;  2EM8 A;  1JK1 A;  3MHS C;  1TN9 A;  1X5W A;  2D9H A;  4R2Q A;  2YRM A;  1JK2 A;  1YUI A;  2EM4 A;  3MHH C;  2WBT A;  2YTP A;  1A1L A;  2CTD A;  1G2D C;  2YU8 A;  2EMW A;  2EOX A;  2EMF A;  2DLQ A;  2EM5 A;  2WCC 3;  1TF6 A;  1B69 A;  2EMH A;  2YU5 A;  1YUJ A;  2LVH A;  4F6M A;  2ADR A;  4IS1 C;  2EP3 A;  2YTO A;  4R2C A;  2EL6 A;  2EOH A;  5KL7 A;  2GLI A;  2BB8 A;  3VHT B;  4R2E A;  3EPJ A;  1X6H A;  2EQ1 A;  1A1G A;  2E72 A;  1ZU1 A;  1TF3 A;  1X3C A;  1YSA C;  1P47 A;  1F2I G;  2EMZ A;  2EOJ A;  2WBU A;  2EN3 A;  5KL2 A;  4F6N A;  2DRP A;  2EPP A;  2R1F A;  4R2R A;  2MDG A;  2EPU A;  4R2P A;  2JP9 A;  1BB8 A;  2EM2 A;  1UN6 B;  2EN7 A;  2YSO A;  2EOE A;  2YRH A;  2EMX A;  5KL3 A;  2EN4 A;  2DGC A;  2JPA A;  1BBO A;  2EM0 A;  4GZN C;  1ZR9 A;  4M9V C;  2EPC A;  2EMG A;  2YTG A;  4IJD A;  5KL4 A;  2YSP A;  4WSG A;  1X6E A;  2EOI A;  2YTN A;  2EMB A;  2EOR A;  3EPH A;  1A1H A;  2YTQ A;  3EPK A;  2EM6 A;  2ENH A;  2EPZ A;  2EE8 A;  1RMD A;  2EN6 A;  4X9J A;  2ENA A;  2EM7 A;  2EPR A;  2EOM A;  4F2J C;  2EMK A;  1UBD C;  2CT1 A;  2EOS A;  2YTI A;  2GHF A;  2EOY A;  1ZAA C;  2EOQ A;  1G2F C;  1WJP A;  2RSI A;  2LT7 A;  2MKN A;  4FK5 C;  1NCS A;  2EQ0 A;  1A1F A;  1MEY C;  2YRK A;  2HGH A;  4R2A A;  3M99 B;  2EL4 A;  1A1K A;  5KL5 A;  2ENC A;  2DLK A;  2MKD A;  2EM9 A;  3UK3 C;  2EL5 A;  4R2D A;  2LV2 A;  2NAB A;  2ELZ A;  2EQ3 A;  2EMA A;  2YTE A;  2EOF A;  2EJ4 A;  1KJK A;  2EN2 A;  2EML A;  2YTJ A;  2CSH A;  2A25 A;  2EMC A;  2DMI A;  2EMY A;  2LCE A;  2VRD A;  2EN8 A;  2EN1 A;  2YTF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...