2EMXA

Solution structure of the c2h2 type zinc finger (region 273-303) of human zinc finger protein 268
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
44
structure length
44
Chain Sequence
GSSGSSGEKPFGCSCCEKAFSSKSYLLVHQQTHAEEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 273-303) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 268
total genus 8
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emxA01
2J7JA 2YTEA 1UBDC 2EL4A 2EL6A 1WJPA 1B69A 1A1HA 2ELZA 2EPUA 5KL7A 4IS1C 2DGCA 3VHTB 2MDGA 2EN2A 2YRKA 5KL6A 2YTQA 2EOIA 1Z1BA 2EN7A 4M9VC 1TF6A 2EMWA 3EPHA 2YTFA 2EOZA 2EQ0A 2D9HA 3UK3C 2BB8A 1G2FC 2YTJA 3MHHC 3M99B 1A1LA 3EPJA 1YSAC 1X6HA 2EM2A 1X5WA 2EN6A 4F6MA 2EN4A 2EOXA 2EQ3A 2RPCA 1G2DC 2EOMA 2GHFA 2YSOA 1P47A 2E72A 2EM8A 1BB8A 2EMXA 2YU8A 5KL4A 2EMBA 2EM7A 2EMGA 2YU5A 2EMLA 2EOSA 1NCSA 1LLMC 2HGHA 2JP9A 2EMZA 2EL5A 1A1JA 4F6NA 5KL5A 1TF3A 2EM9A 2RSIA 4R2SA 2WCC3 1X6FA 2ENAA 2EOHA 1AAYA 2EP3A 2MKDA 2YTPA 2EMYA 2WBUA 1BBOA 2YTOA 2LT7A 2EM3A 2ENHA 2EMIA 1DGCA 1KJKA 2EOQA 1UN6B 2EPCA 1X3CA 1JK2A 2YTDA 2YRHA 2EMFA 2EOYA 2EM0A 2LVHA 2JPAA 1ZU1A 1ZR9A 2EMHA 2EN1A 2LO3A 2YSPA 4R2CA 2ELYA 2YTNA 2EMAA 1A1FA 2EOFA 2R1FA 4WSGA 4R2DA 4R2QA 1X6EA 4FK5C 1F2IG 2EJ4A 2EPRA 2ADRA 2YTIA 5KL3A 1MEYC 5KL2A 2EE8A 3MHSC 2I13A 2EMKA 2EORA 4F2JC 2EM6A 2EPXA 1YUJA 2YTGA 3EPLA 1A1IA 2EMCA 1TN9A 2A25A 4R2RA 2DRPA 2EOOA 2EM5A 1ZAAC 2DMIA 3EPKA 2EPZA 2NABA 2EN3A 2VRDA 2EOEA 2DLKA 2PRTA 1JK1A 4R2AA 2EM4A 2YRMA 2WBTA 2M9AA 2CTDA 1YUIA 4IJDA 2CSHA 2MKNA 2CT1A 4R2PA 2EN8A 2EQ1A 2EPAA 2DLQA 4R2EA 2GLIA 1RMDA 2EOJA 1A1GA 2ENCA 2LCEA 2LV2A 4GZNC 1A1KA 2EPPA 4X9JA 2WBSA
chains in the Genus database with same CATH superfamily
3C6MA 3K6QA 4O5GA 5IV8B 2JVAA 5KL7A 4NXME 1DQ3A 4DKKA 2MDGA 5FLXC 2NUGA 2EN2A 2YRKA 4NHRA 2E5LE 5AC4A 1TF6A 3VYXA 5A6BD 5AASA 2YTFA 2DB2A 2EQ0A 4LU9A 4X66E 1GTKA 1GQEA 5AC5A 3HPSA 4KZSA 5TSEA 3J81C 1BBGA 3M99B 2UUBE 1X6HA 4NXNE 3KZZA 2YWQA 4MLQA 2EN4A 4DV1E 2RPCA 2V89A 2EM8A 1N34E 4Q28A 2LUPB 2YU5A 2JXPA 2EOSA 1LLMC 4DR2E 2LTSA 1DI2A 2EMZA 2IHR1 1A1JA 1AH5A 1KYQA 1TF3A 2JYAA 2EOHA 4RHBB 1AAYA 2EP3A 3IWCA 4BHCA 4ZYEA 2WBUA 4ZYDA 1EKZA 3BF2A 2ENHA 3T1HE 4F9CB 2DIXA 2EOQA 1N36E 3C4BA 1RC7A 2NA2A 2ZM6E 3HXLA 2RSMA 1FJGE 2I9IA 3HQ1A 2EMFA 4DR7E 2ODRD 2EN1A 5A6KA 2L33A 2YTNA 1T4LB 1A1FA 2EOFA 2R1FA 4R2DA 3LLHA 1F2IG 1QU6A 2EJ4A 4LF8E 2BBGA 4M0VA 3C6KA 4O43A 2EE8A 1YYKA 1X47A 2EMKA 4B3TE 2EPXA 1YUJA 5IWAE 4R8OA 2LRSA 3C4TA 4P78A 2EMCA 5F3WA 4JI0E 1EH8A 2F8BA 3EPKA 2EPZA 2L3CA 2NABA 2EOEA 2DLKA 3RMPA 4JI2E 3BIDA 2CT1A 2KONA 3OMLA 4GEQB 2EPAA 4KWYA 4R2EA 2GLIA 3EQ1A 2L6MA 4R03A 4GKJE 2VF1A 1YFHA 2EL4A 1IQSA 2V8QB 3VHTB 1XNRE 2YTQA 2EOIA 4M9VC 2H36X 2EMWA 4TUIA 3THNA 3F6HA 2JY9A 2L3JA 4B3SE 4AQYE 4ZYGA 4RH8A 4DR1E 1J5EE 1PDAA 1X49A 3KWRA 1IQOA 2JOBA 3MHHC 1YSAC 3EPJA 1XNQE 2EM2A 2UXDE 2VQFE 2L8TA 2V88A 5IT9C 2EOXA 1T4OA 4DV6E 3J80C 1P47A 3AUZA 1EH6A 2EMBA 2EMGA 2HGHA 4YHHE 1NCSA 1XMOE 5KL5A 2CPNA 2EM9A 4R2SA 2V87A 3ADGA 2YZTA 4HEIA 2MKDA 4HTGA 2EMYA 4WFTA 1BBOA 2YTOA 3DJWA 3T1YE 4DV4E 2EMIA 2LMZA 4JI8E 2EPCA 1MGTA 1X3CA 2N3GA 2EPKX 3QG5C 2N3HA 2YTDA 3F6GA 1ZBTA 2MC5A 2EOYA 2EM0A 2LVHA 5A2QC 4I8OA 3IWDA 4TUGA 4JI3E 2DMYA 1X6EA 3JAMC 3HTXA 1MEYC 5KL2A 4DR4E 2EORA 1UILA 4DV0E 3VK6A 3TQMA 5AE2A 1GZ6A 1A1IA 3BGHA 5LMNE 1YPNA 3FIGA 5LL6R 2DMIA 4F54A 3VYYA 5LMUE 2UU9E 5A6JA 1PJQA 1QNTA 2NUEA 2JR1A 2JWOA 4BS9A 2WBTA 4OOGC 4P7DA 2EPOA 2CSHA 2MKNA 2L2MA 4X62E 3J7AG 2L2NA 3KZYA 4R2PA 1HR0E 2L92A 4BCAA 2N8XA 4L5NC 2RS7A 4M2ZA 1A1GA 2LV2A 1WHQA 2J7JA 2EPPA 4DV2E 4DR6E 4LF6E 2VE7C 1PJSA 4ZYHA 1UBDC 2EL6A 3AV0A 1WJPA 1A1HA 2ELZA 1IMUA 2LTRA 3THOB 4WYQB 5KL6A 1PJTA 2EOZA 4DMIA 4WX9A 2D9HA 3L00A 3UK3C 4LFCE 2B7TA 2YTJA 2K4VA 3ECRA 1A1LA 1X5WA 2HJJA 2EN6A 3JU0A 1T38A 1G2DC 2EOMA 1HNXE 2YSOA 2E72A 4JV5E 1IBKE 2VQEE 1BB8A 2EMXA 2EWLA 2YU8A 1HNZE 2NUFA 5KL4A 2M1SA 2FTXB 1J26A 4X64E 2EMLA 2YT4A 2ODRC 2UXCE 2JP9A 2EL5A 2R76A 1YYWA 2LJHA 2RSIA 5BR8E 2WCC3 2L2KB 4LF7E 2ENAA 3DF6A 2LJUA 1WXRA 1YZ9A 1HNWE 2YTPA 1N33E 3ADIA 1X48A 2F4VE 4OX9E 1O0WA 4NZVA 2LT7A 2EM3A 4LTYA 5CFFE 1DGCA 1KJKA 1UN6B 4LFBE 2B9DA 2B3TB 2YRHA 4LFAE 4YY3E 1ZU1A 1ZR9A 2EMHA 2YSPA 4R2CA 4DV5E 5A6AA 2EMAA 4B3ME 4DV3E 4DUYE 2RS6A 4R2QA 2B7VA 4BHBA 2EPRA 4BMJA 1RQ0A 4BBYA 4MLVA 5ADZA 4F2JC 1T4NA 2EM6A 2Q8UA 2RQLA 4O24A 1ZBQA 5IXMB 2G7HA 4K0KE 3H09A 4R2RA 2EM5A 2EOOA 4WXDA 3IWBA 4JI1E 2FGGA 4JYAE 4Q35B 5T6JA 1UHZA 4BC7A 4X65E 2PRTA 2UXBE 4R2AA 1FKAE 2EM4A 3HPZA 4F9AB 2LBSB 1YUIA 4WXCA 2M7QA 4IJDA 4KHPE 2EN8A 2EQ1A 2DLQA 3JTZA 2ENCA 4DV7E 4GZNC 4X9JA 2DGCA 1N32E 2YTEA 3ADLA 3LMLA 4DUZE 3ADJA 1IBME 2EPMX 1B69A 2EPUA 4IS1C 1IBLE 4J8ZA 4WSPA 2V86A 2EN7A 1Z1BA 3EPHA 4JI5E 2V83A 4O4KA 4WPYA 5A6BA 1L4SA 2BB8A 2YPNA 1G2FC 2E1MA 5DNYA 2LE2A 4F6MA 2EQ3A 1SFEA 2GHFA 2M4IA 1WHNA 4DR5E 5A69A 2K7IA 2EM7A 3OTOE 4F9BB 2JOXA 4BC9A 4L8NA 4F6NA 4B3RE 4JI4E 2RTXA 1X6FA 2V85A 2MDRA 4N4RB 2LUQA 2HC5A 1JK2A 1SR9A 4JI6E 4M30A 1NEIA 2JPAA 1PKPA 2LO3A 3P1XA 3J7Yp 2ELYA 4X8WA 1STUA 4WSGA 2UUCE 2HHHE 3BBGA 5AE3A 4LF9E 3ZOQB 4FK5C 2ADRA 2YTIA 5KL3A 2UUAE 1EH7A 3MHSC 2I13A 4GKKE 1YYOA 2YTGA 3EPLA 2FV4B 1TN9A 2A25A 2DRPA 1WRJA 1N3GA 1ZAAC 4JI7E 2EN3A 2KHXA 2MC6A 2VRDA 2KOUA 2WZOA 1JK1A 2YRMA 2M9AA 2CTDA 2GPIA 4DR3E 5AE1A 4LF5E 1T39A 5LLQA 2EPLX 1I94E 2DSYA 1RMDA 2EPNA 2EOJA 3MSWA 2LCEA 4LF4E 1XMQE 1A1KA 2EZ6A 2WBSA
chains in the Genus database with same CATH topology
2J7JA 2YTEA 1UBDC 2EL4A 2EL6A 1WJPA 1B69A 1A1HA 2ELZA 2EPUA 5KL7A 4IS1C 2DGCA 3VHTB 2MDGA 2EN2A 2YRKA 5KL6A 2YTQA 2EOIA 1Z1BA 2EN7A 4M9VC 1TF6A 2EMWA 3EPHA 2YTFA 2EOZA 2EQ0A 2D9HA 3UK3C 2BB8A 1G2FC 2YTJA 3MHHC 3M99B 1A1LA 3EPJA 1YSAC 1X6HA 2EM2A 1X5WA 2EN6A 4F6MA 2EN4A 2EOXA 2EQ3A 2RPCA 1G2DC 2EOMA 2GHFA 2YSOA 1P47A 2E72A 2EM8A 1BB8A 2EMXA 2YU8A 5KL4A 2EMBA 2EM7A 2EMGA 2YU5A 2EMLA 2EOSA 1NCSA 1LLMC 2HGHA 2JP9A 2EMZA 2EL5A 1A1JA 4F6NA 5KL5A 1TF3A 2EM9A 2RSIA 4R2SA 2WCC3 1X6FA 2ENAA 2EOHA 1AAYA 2EP3A 2MKDA 2YTPA 2EMYA 2WBUA 1BBOA 2YTOA 2LT7A 2EM3A 2ENHA 2EMIA 1DGCA 1KJKA 2EOQA 1UN6B 2EPCA 1X3CA 1JK2A 2YTDA 2YRHA 2EMFA 2EOYA 2EM0A 2LVHA 2JPAA 1ZU1A 1ZR9A 2EMHA 2EN1A 2LO3A 2YSPA 4R2CA 2ELYA 2YTNA 2EMAA 1A1FA 2EOFA 2R1FA 4WSGA 4R2DA 4R2QA 1X6EA 4FK5C 1F2IG 2EJ4A 2EPRA 2ADRA 2YTIA 5KL3A 1MEYC 5KL2A 2EE8A 3MHSC 2I13A 2EMKA 2EORA 4F2JC 2EM6A 2EPXA 1YUJA 2YTGA 3EPLA 1A1IA 2EMCA 1TN9A 2A25A 4R2RA 2DRPA 2EOOA 2EM5A 1ZAAC 2DMIA 3EPKA 2EPZA 2NABA 2EN3A 2VRDA 2EOEA 2DLKA 2PRTA 1JK1A 4R2AA 2EM4A 2YRMA 2WBTA 2M9AA 2CTDA 1YUIA 4IJDA 2CSHA 2MKNA 2CT1A 4R2PA 2EN8A 2EQ1A 2EPAA 2DLQA 4R2EA 2GLIA 1RMDA 2EOJA 1A1GA 2ENCA 2LCEA 2LV2A 4GZNC 1A1KA 2EPPA 4X9JA 2WBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J7J A;  2YTE A;  1UBD C;  2EL4 A;  2EL6 A;  1WJP A;  1B69 A;  1A1H A;  2ELZ A;  2EPU A;  5KL7 A;  4IS1 C;  2DGC A;  3VHT B;  2MDG A;  2EN2 A;  2YRK A;  5KL6 A;  2YTQ A;  2EOI A;  1Z1B A;  2EN7 A;  4M9V C;  1TF6 A;  2EMW A;  3EPH A;  2YTF A;  2EOZ A;  2EQ0 A;  2D9H A;  3UK3 C;  2BB8 A;  1G2F C;  2YTJ A;  3MHH C;  3M99 B;  1A1L A;  3EPJ A;  1YSA C;  1X6H A;  2EM2 A;  1X5W A;  2EN6 A;  4F6M A;  2EN4 A;  2EOX A;  2EQ3 A;  2RPC A;  1G2D C;  2EOM A;  2GHF A;  2YSO A;  1P47 A;  2E72 A;  2EM8 A;  1BB8 A;  2EMX A;  2YU8 A;  5KL4 A;  2EMB A;  2EM7 A;  2EMG A;  2YU5 A;  2EML A;  2EOS A;  1NCS A;  1LLM C;  2HGH A;  2JP9 A;  2EMZ A;  2EL5 A;  1A1J A;  4F6N A;  5KL5 A;  1TF3 A;  2EM9 A;  2RSI A;  4R2S A;  2WCC 3;  1X6F A;  2ENA A;  2EOH A;  1AAY A;  2EP3 A;  2MKD A;  2YTP A;  2EMY A;  2WBU A;  1BBO A;  2YTO A;  2LT7 A;  2EM3 A;  2ENH A;  2EMI A;  1DGC A;  1KJK A;  2EOQ A;  1UN6 B;  2EPC A;  1X3C A;  1JK2 A;  2YTD A;  2YRH A;  2EMF A;  2EOY A;  2EM0 A;  2LVH A;  2JPA A;  1ZU1 A;  1ZR9 A;  2EMH A;  2EN1 A;  2LO3 A;  2YSP A;  4R2C A;  2ELY A;  2YTN A;  2EMA A;  1A1F A;  2EOF A;  2R1F A;  4WSG A;  4R2D A;  4R2Q A;  1X6E A;  4FK5 C;  1F2I G;  2EJ4 A;  2EPR A;  2ADR A;  2YTI A;  5KL3 A;  1MEY C;  5KL2 A;  2EE8 A;  3MHS C;  2I13 A;  2EMK A;  2EOR A;  4F2J C;  2EM6 A;  2EPX A;  1YUJ A;  2YTG A;  3EPL A;  1A1I A;  2EMC A;  1TN9 A;  2A25 A;  4R2R A;  2DRP A;  2EOO A;  2EM5 A;  1ZAA C;  2DMI A;  3EPK A;  2EPZ A;  2NAB A;  2EN3 A;  2VRD A;  2EOE A;  2DLK A;  2PRT A;  1JK1 A;  4R2A A;  2EM4 A;  2YRM A;  2WBT A;  2M9A A;  2CTD A;  1YUI A;  4IJD A;  2CSH A;  2MKN A;  2CT1 A;  4R2P A;  2EN8 A;  2EQ1 A;  2EPA A;  2DLQ A;  4R2E A;  2GLI A;  1RMD A;  2EOJ A;  1A1G A;  2ENC A;  2LCE A;  2LV2 A;  4GZN C;  1A1K A;  2EPP A;  4X9J A;  2WBS A; 
#chains in the Genus database with same CATH topology
 3C6M A;  3K6Q A;  4O5G A;  5IV8 B;  2JVA A;  5KL7 A;  4NXM E;  1DQ3 A;  4DKK A;  2MDG A;  5FLX C;  2NUG A;  2EN2 A;  2YRK A;  4NHR A;  2E5L E;  5AC4 A;  1TF6 A;  3VYX A;  5A6B D;  5AAS A;  2YTF A;  2DB2 A;  2EQ0 A;  4LU9 A;  4X66 E;  1GTK A;  1GQE A;  5AC5 A;  3HPS A;  4KZS A;  5TSE A;  3J81 C;  1BBG A;  3M99 B;  2UUB E;  1X6H A;  4NXN E;  3KZZ A;  2YWQ A;  4MLQ A;  2EN4 A;  4DV1 E;  2RPC A;  2V89 A;  2EM8 A;  1N34 E;  4Q28 A;  2LUP B;  2YU5 A;  2JXP A;  2EOS A;  1LLM C;  4DR2 E;  2LTS A;  1DI2 A;  2EMZ A;  2IHR 1;  1A1J A;  1AH5 A;  1KYQ A;  1TF3 A;  2JYA A;  2EOH A;  4RHB B;  1AAY A;  2EP3 A;  3IWC A;  4BHC A;  4ZYE A;  2WBU A;  4ZYD A;  1EKZ A;  3BF2 A;  2ENH A;  3T1H E;  4F9C B;  2DIX A;  2EOQ A;  1N36 E;  3C4B A;  1RC7 A;  2NA2 A;  2ZM6 E;  3HXL A;  2RSM A;  1FJG E;  2I9I A;  3HQ1 A;  2EMF A;  4DR7 E;  2ODR D;  2EN1 A;  5A6K A;  2L33 A;  2YTN A;  1T4L B;  1A1F A;  2EOF A;  2R1F A;  4R2D A;  3LLH A;  1F2I G;  1QU6 A;  2EJ4 A;  4LF8 E;  2BBG A;  4M0V A;  3C6K A;  4O43 A;  2EE8 A;  1YYK A;  1X47 A;  2EMK A;  4B3T E;  2EPX A;  1YUJ A;  5IWA E;  4R8O A;  2LRS A;  3C4T A;  4P78 A;  2EMC A;  5F3W A;  4JI0 E;  1EH8 A;  2F8B A;  3EPK A;  2EPZ A;  2L3C A;  2NAB A;  2EOE A;  2DLK A;  3RMP A;  4JI2 E;  3BID A;  2CT1 A;  2KON A;  3OML A;  4GEQ B;  2EPA A;  4KWY A;  4R2E A;  2GLI A;  3EQ1 A;  2L6M A;  4R03 A;  4GKJ E;  2VF1 A;  1YFH A;  2EL4 A;  1IQS A;  2V8Q B;  3VHT B;  1XNR E;  2YTQ A;  2EOI A;  4M9V C;  2H36 X;  2EMW A;  4TUI A;  3THN A;  3F6H A;  2JY9 A;  2L3J A;  4B3S E;  4AQY E;  4ZYG A;  4RH8 A;  4DR1 E;  1J5E E;  1PDA A;  1X49 A;  3KWR A;  1IQO A;  2JOB A;  3MHH C;  1YSA C;  3EPJ A;  1XNQ E;  2EM2 A;  2UXD E;  2VQF E;  2L8T A;  2V88 A;  5IT9 C;  2EOX A;  1T4O A;  4DV6 E;  3J80 C;  1P47 A;  3AUZ A;  1EH6 A;  2EMB A;  2EMG A;  2HGH A;  4YHH E;  1NCS A;  1XMO E;  5KL5 A;  2CPN A;  2EM9 A;  4R2S A;  2V87 A;  3ADG A;  2YZT A;  4HEI A;  2MKD A;  4HTG A;  2EMY A;  4WFT A;  1BBO A;  2YTO A;  3DJW A;  3T1Y E;  4DV4 E;  2EMI A;  2LMZ A;  4JI8 E;  2EPC A;  1MGT A;  1X3C A;  2N3G A;  2EPK X;  3QG5 C;  2N3H A;  2YTD A;  3F6G A;  1ZBT A;  2MC5 A;  2EOY A;  2EM0 A;  2LVH A;  5A2Q C;  4I8O A;  3IWD A;  4TUG A;  4JI3 E;  2DMY A;  1X6E A;  3JAM C;  3HTX A;  1MEY C;  5KL2 A;  4DR4 E;  2EOR A;  1UIL A;  4DV0 E;  3VK6 A;  3TQM A;  5AE2 A;  1GZ6 A;  1A1I A;  3BGH A;  5LMN E;  1YPN A;  3FIG A;  5LL6 R;  2DMI A;  4F54 A;  3VYY A;  5LMU E;  2UU9 E;  5A6J A;  1PJQ A;  1QNT A;  2NUE A;  2JR1 A;  2JWO A;  4BS9 A;  2WBT A;  4OOG C;  4P7D A;  2EPO A;  2CSH A;  2MKN A;  2L2M A;  4X62 E;  3J7A G;  2L2N A;  3KZY A;  4R2P A;  1HR0 E;  2L92 A;  4BCA A;  2N8X A;  4L5N C;  2RS7 A;  4M2Z A;  1A1G A;  2LV2 A;  1WHQ A;  2J7J A;  2EPP A;  4DV2 E;  4DR6 E;  4LF6 E;  2VE7 C;  1PJS A;  4ZYH A;  1UBD C;  2EL6 A;  3AV0 A;  1WJP A;  1A1H A;  2ELZ A;  1IMU A;  2LTR A;  3THO B;  4WYQ B;  5KL6 A;  1PJT A;  2EOZ A;  4DMI A;  4WX9 A;  2D9H A;  3L00 A;  3UK3 C;  4LFC E;  2B7T A;  2YTJ A;  2K4V A;  3ECR A;  1A1L A;  1X5W A;  2HJJ A;  2EN6 A;  3JU0 A;  1T38 A;  1G2D C;  2EOM A;  1HNX E;  2YSO A;  2E72 A;  4JV5 E;  1IBK E;  2VQE E;  1BB8 A;  2EMX A;  2EWL A;  2YU8 A;  1HNZ E;  2NUF A;  5KL4 A;  2M1S A;  2FTX B;  1J26 A;  4X64 E;  2EML A;  2YT4 A;  2ODR C;  2UXC E;  2JP9 A;  2EL5 A;  2R76 A;  1YYW A;  2LJH A;  2RSI A;  5BR8 E;  2WCC 3;  2L2K B;  4LF7 E;  2ENA A;  3DF6 A;  2LJU A;  1WXR A;  1YZ9 A;  1HNW E;  2YTP A;  1N33 E;  3ADI A;  1X48 A;  2F4V E;  4OX9 E;  1O0W A;  4NZV A;  2LT7 A;  2EM3 A;  4LTY A;  5CFF E;  1DGC A;  1KJK A;  1UN6 B;  4LFB E;  2B9D A;  2B3T B;  2YRH A;  4LFA E;  4YY3 E;  1ZU1 A;  1ZR9 A;  2EMH A;  2YSP A;  4R2C A;  4DV5 E;  5A6A A;  2EMA A;  4B3M E;  4DV3 E;  4DUY E;  2RS6 A;  4R2Q A;  2B7V A;  4BHB A;  2EPR A;  4BMJ A;  1RQ0 A;  4BBY A;  4MLV A;  5ADZ A;  4F2J C;  1T4N A;  2EM6 A;  2Q8U A;  2RQL A;  4O24 A;  1ZBQ A;  5IXM B;  2G7H A;  4K0K E;  3H09 A;  4R2R A;  2EM5 A;  2EOO A;  4WXD A;  3IWB A;  4JI1 E;  2FGG A;  4JYA E;  4Q35 B;  5T6J A;  1UHZ A;  4BC7 A;  4X65 E;  2PRT A;  2UXB E;  4R2A A;  1FKA E;  2EM4 A;  3HPZ A;  4F9A B;  2LBS B;  1YUI A;  4WXC A;  2M7Q A;  4IJD A;  4KHP E;  2EN8 A;  2EQ1 A;  2DLQ A;  3JTZ A;  2ENC A;  4DV7 E;  4GZN C;  4X9J A;  2DGC A;  1N32 E;  2YTE A;  3ADL A;  3LML A;  4DUZ E;  3ADJ A;  1IBM E;  2EPM X;  1B69 A;  2EPU A;  4IS1 C;  1IBL E;  4J8Z A;  4WSP A;  2V86 A;  2EN7 A;  1Z1B A;  3EPH A;  4JI5 E;  2V83 A;  4O4K A;  4WPY A;  5A6B A;  1L4S A;  2BB8 A;  2YPN A;  1G2F C;  2E1M A;  5DNY A;  2LE2 A;  4F6M A;  2EQ3 A;  1SFE A;  2GHF A;  2M4I A;  1WHN A;  4DR5 E;  5A69 A;  2K7I A;  2EM7 A;  3OTO E;  4F9B B;  2JOX A;  4BC9 A;  4L8N A;  4F6N A;  4B3R E;  4JI4 E;  2RTX A;  1X6F A;  2V85 A;  2MDR A;  4N4R B;  2LUQ A;  2HC5 A;  1JK2 A;  1SR9 A;  4JI6 E;  4M30 A;  1NEI A;  2JPA A;  1PKP A;  2LO3 A;  3P1X A;  3J7Y p;  2ELY A;  4X8W A;  1STU A;  4WSG A;  2UUC E;  2HHH E;  3BBG A;  5AE3 A;  4LF9 E;  3ZOQ B;  4FK5 C;  2ADR A;  2YTI A;  5KL3 A;  2UUA E;  1EH7 A;  3MHS C;  2I13 A;  4GKK E;  1YYO A;  2YTG A;  3EPL A;  2FV4 B;  1TN9 A;  2A25 A;  2DRP A;  1WRJ A;  1N3G A;  1ZAA C;  4JI7 E;  2EN3 A;  2KHX A;  2MC6 A;  2VRD A;  2KOU A;  2WZO A;  1JK1 A;  2YRM A;  2M9A A;  2CTD A;  2GPI A;  4DR3 E;  5AE1 A;  4LF5 E;  1T39 A;  5LLQ A;  2EPL X;  1I94 E;  2DSY A;  1RMD A;  2EPN A;  2EOJ A;  3MSW A;  2LCE A;  4LF4 E;  1XMQ E;  1A1K A;  2EZ6 A;  2WBS A; 
#chains in the Genus database with same CATH homology
 2J7J A;  2YTE A;  1UBD C;  2EL4 A;  2EL6 A;  1WJP A;  1B69 A;  1A1H A;  2ELZ A;  2EPU A;  5KL7 A;  4IS1 C;  2DGC A;  3VHT B;  2MDG A;  2EN2 A;  2YRK A;  5KL6 A;  2YTQ A;  2EOI A;  1Z1B A;  2EN7 A;  4M9V C;  1TF6 A;  2EMW A;  3EPH A;  2YTF A;  2EOZ A;  2EQ0 A;  2D9H A;  3UK3 C;  2BB8 A;  1G2F C;  2YTJ A;  3MHH C;  3M99 B;  1A1L A;  3EPJ A;  1YSA C;  1X6H A;  2EM2 A;  1X5W A;  2EN6 A;  4F6M A;  2EN4 A;  2EOX A;  2EQ3 A;  2RPC A;  1G2D C;  2EOM A;  2GHF A;  2YSO A;  1P47 A;  2E72 A;  2EM8 A;  1BB8 A;  2EMX A;  2YU8 A;  5KL4 A;  2EMB A;  2EM7 A;  2EMG A;  2YU5 A;  2EML A;  2EOS A;  1NCS A;  1LLM C;  2HGH A;  2JP9 A;  2EMZ A;  2EL5 A;  1A1J A;  4F6N A;  5KL5 A;  1TF3 A;  2EM9 A;  2RSI A;  4R2S A;  2WCC 3;  1X6F A;  2ENA A;  2EOH A;  1AAY A;  2EP3 A;  2MKD A;  2YTP A;  2EMY A;  2WBU A;  1BBO A;  2YTO A;  2LT7 A;  2EM3 A;  2ENH A;  2EMI A;  1DGC A;  1KJK A;  2EOQ A;  1UN6 B;  2EPC A;  1X3C A;  1JK2 A;  2YTD A;  2YRH A;  2EMF A;  2EOY A;  2EM0 A;  2LVH A;  2JPA A;  1ZU1 A;  1ZR9 A;  2EMH A;  2EN1 A;  2LO3 A;  2YSP A;  4R2C A;  2ELY A;  2YTN A;  2EMA A;  1A1F A;  2EOF A;  2R1F A;  4WSG A;  4R2D A;  4R2Q A;  1X6E A;  4FK5 C;  1F2I G;  2EJ4 A;  2EPR A;  2ADR A;  2YTI A;  5KL3 A;  1MEY C;  5KL2 A;  2EE8 A;  3MHS C;  2I13 A;  2EMK A;  2EOR A;  4F2J C;  2EM6 A;  2EPX A;  1YUJ A;  2YTG A;  3EPL A;  1A1I A;  2EMC A;  1TN9 A;  2A25 A;  4R2R A;  2DRP A;  2EOO A;  2EM5 A;  1ZAA C;  2DMI A;  3EPK A;  2EPZ A;  2NAB A;  2EN3 A;  2VRD A;  2EOE A;  2DLK A;  2PRT A;  1JK1 A;  4R2A A;  2EM4 A;  2YRM A;  2WBT A;  2M9A A;  2CTD A;  1YUI A;  4IJD A;  2CSH A;  2MKN A;  2CT1 A;  4R2P A;  2EN8 A;  2EQ1 A;  2EPA A;  2DLQ A;  4R2E A;  2GLI A;  1RMD A;  2EOJ A;  1A1G A;  2ENC A;  2LCE A;  2LV2 A;  4GZN C;  1A1K A;  2EPP A;  4X9J A;  2WBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...