2YU8A

Solution structure of the c2h2 type zinc finger (region 648-680) of human zinc finger protein 347
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYKCNECGKVFTQNSHLARHRRVHTGGKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 347
publication title Solution structure of the C2H2 type zinc finger (region 648-680) of human Zinc finger protein 347
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2yu8A01
2LV2A 4R2SA 2LO3A 1A1IA 2M9AA 2NABA 1TF6A 3UK3C 2E72A 2CT1A 2EOQA 2EL5A 2MDGA 1ZR9A 4R2DA 2YTGA 2DMIA 2BB8A 4R2CA 2YSPA 4R2PA 1BBOA 1JK1A 2LT7A 2EMCA 4M9VC 2EPZA 2GHFA 1B69A 3MHHC 1UN6B 4GZNC 2ELYA 2PRTA 2YTNA 2RPCA 2YU8A 1X6HA 2EOJA 2D9HA 4WSGA 5KL2A 1ZU1A 2EL4A 1TF3A 2EM7A 2EN4A 2EN3A 2EOIA 1TN9A 2EOYA 2EMBA 2LCEA 1BB8A 5KL7A 4F6NA 2EL6A 1AAYA 2EMIA 2EQ0A 1RMDA 2EM5A 2EE8A 2MKDA 2YTJA 2EOMA 4R2EA 2YTEA 2EM4A 2EP3A 2YTDA 2ENAA 2EOEA 2EMLA 2GLIA 2JPAA 4FK5C 2EMWA 2WBTA 2EOXA 2EQ3A 2EM8A 5KL5A 2EN2A 2EMAA 2EMXA 3MHSC 1G2FC 1WJPA 1JK2A 1X5WA 2YSOA 2YU5A 2EN1A 2WBUA 1MEYC 1ZAAC 3EPLA 1UBDC 2VRDA 5KL4A 1X3CA 2EORA 2EPUA 4X9JA 2EM0A 2YTFA 2YTPA 2EN6A 1X6EA 2EJ4A 1P47A 1Z1BA 1YSAC 2DLKA 4R2RA 1A1FA 1YUJA 1YUIA 2EPXA 2EPCA 2WCC3 2ELZA 2EM6A 2EM2A 2J7JA 2EQ1A 1X6FA 2DRPA 4R2AA 1F2IG 2JP9A 1DGCA 2R1FA 2EOFA 2HGHA 2EPAA 2CTDA 2ENHA 2EMKA 2EOZA 2EN8A 4IJDA 3EPKA 2EOSA 1LLMC 2EPPA 2YTOA 2YRHA 1A1JA 4F6MA 2DGCA 2EM3A 2RSIA 2CSHA 1A1GA 2EMZA 2EM9A 2WBSA 1A1LA 2I13A 2YRMA 2LVHA 4IS1C 5KL3A 2EMYA 1A1KA 2YTQA 2EMGA 3EPJA 3M99B 2MKNA 2EMFA 3EPHA 1NCSA 1G2DC 5KL6A 2YRKA 4F2JC 1KJKA 2EOHA 2A25A 2ENCA 2YTIA 2EPRA 2ADRA 4R2QA 2EN7A 2EOOA 2EMHA 3VHTB 2DLQA 1A1HA
chains in the Genus database with same CATH superfamily
2L2KB 1A1IA 3UK3C 1QNTA 2Q8UA 2CT1A 2M7QA 1PKPA 3HPZA 1JK1A 4DR3E 2EMCA 4F9CB 2EPZA 4M0VA 4BHCA 1T4LB 4MLQA 5KL2A 2V85A 1T38A 4F9BB 1IQOA 2EL4A 4R8OA 4F54A 2EN4A 2EN3A 3THNA 2E5LE 3C4BA 3OTOE 2JOXA 2IHR1 1BB8A 2F4VE 2EMIA 3VYYA 1EH8A 1HR0E 4JV5E 4DV6E 1BBGA 2L33A 4B3SE 2EP3A 2EPKX 2EMLA 4JI3E 2WBTA 2EQ3A 2EM8A 3P1XA 3MHSC 2L3JA 1PDAA 1UHZA 4BS9A 1X5WA 2YSOA 2YU5A 5LMUE 1XMOE 2UXBE 3EPLA 4JI4E 3LLHA 3L00A 2EPUA 4BHBA 1YSAC 2EM0A 2YTFA 1GZ6A 2EJ4A 3ADIA 4RHBB 5FLXC 1AH5A 4X64E 1IQSA 3BIDA 2EPCA 4KWYA 1X47A 2EM2A 4WFTA 4NXNE 2N8XA 2M1SA 3TQMA 3KZZA 2EOFA 2FTXB 2RS7A 2EZ6A 1N33E 4JI2E 2L2MA 2EOSA 1KYQA 2YTOA 4F6MA 4BC9A 2NA2A 2CSHA 2MC6A 5AE3A 3H09A 2I13A 2B3TB 1A1KA 2K4VA 4F9AB 4DV5E 4DV7E 2I9IA 2V83A 4BCAA 3K6QA 2YRKA 1X48A 2EOHA 2ENCA 4BBYA 2YTIA 1XNQE 2EN7A 3KWRA 1WXRA 2ODRD 5BR8E 2EMHA 2L8TA 3VHTB 1X49A 4WXDA 2DLQA 4LF5E 3VYXA 2LO3A 3IWBA 3HXLA 4R2DA 2MDGA 2DMIA 2BB8A 2YSPA 2B9DA 1BBOA 5AC4A 4WSPA 4AQYE 2GHFA 3JAMC 3MHHC 2RSMA 2JVAA 4JI6E 2PRTA 3DF6A 2KOUA 2RPCA 4M30A 2EOJA 2D9HA 4WSGA 2L92A 1ZU1A 1TF3A 2CPNA 5A2QC 2B7TA 2EOYA 2L2NA 4O43A 1XNRE 2NUEA 2LMZA 4LF8E 2EL6A 2JY9A 2EM5A 2VF1A 2MDRA 2LRSA 5CFFE 2EE8A 4LF9E 3C6KA 2LUPB 1HNZE 4J8ZA 2UUCE 2M4IA 4DV3E 4WPYA 4FK5C 2B7VA 2R76A 4YY3E 1WJPA 5IV8B 4ZYGA 2EN1A 2V89A 4DUYE 1ZAAC 5KL4A 4BMJA 4JI0E 2YTPA 4JI5E 1P47A 3RMPA 4R2RA 2LBSB 1YUJA 3ZOQB 5A69A 2LJHA 2WCC3 2ELZA 2EM6A 2J7JA 5LMNE 2EQ1A 4LFBE 2DRPA 2LE2A 2JYAA 1ZBTA 3J7Yp 4GKKE 3VK6A 2EMKA 4DR1E 4HEIA 2V8QB 4Q35B 4ZYEA 3KZYA 4IJDA 5IWAE 4LU9A 2DB2A 1YZ9A 2LTRA 1A1JA 2DGCA 2JOBA 4DR6E 5A6AA 3QG5C 1A1GA 1RQ0A 4RH8A 3HQ1A 2YRMA 4KHPE 4IS1C 5KL3A 2EMYA 1O0WA 3J7AG 2BBGA 3ADLA 2L6MA 3M99B 2EMFA 3EPHA 4I8OA 4TUIA 1G2DC 4F2JC 1WRJA 3JU0A 4X66E 2L3CA 2LTSA 1N3GA 1GTKA 2HC5A 3THOB 2FV4B 4ZYDA 2LV2A 4R2SA 2ODRC 2NABA 3ADJA 2VE7C 3ADGA 2EOQA 1ZR9A 2ZM6E 2LT7A 2HJJA 4O5GA 1UN6B 2ELYA 1FJGE 5DNYA 2YTNA 5LL6R 2YU8A 3MSWA 2RTXA 4DUZE 4LFCE 2EM7A 2EOIA 2EPLX 1T4OA 1YYOA 2LCEA 3EQ1A 5ADZA 3HTXA 3AV0A 4F6NA 1AAYA 5AE2A 1RMDA 1HNXE 3IWCA 2FGGA 2DMYA 2VQFE 2MKDA 1N32E 2YTEA 4DV1E 1FKAE 4Q28A 2ENAA 3IWDA 2HHHE 3BGHA 1N34E 4DR7E 4P7DA 2EMXA 2EMAA 2YT4A 1HNWE 4OOGC 2UXDE 2EORA 1EH7A 5AC5A 2EN6A 1X6EA 1YYWA 1Z1BA 2H36X 2MC5A 2DLKA 4O4KA 1A1FA 1YPNA 4O24A 1YUIA 4DV0E 5A6BD 2EPNA 1WHQA 4WX9A 4DR5E 2JP9A 4LF4E 1DGCA 2LJUA 1WHNA 2HGHA 2CTDA 2ENHA 4JYAE 2UXCE 4JI8E 2EOZA 5AASA 4OX9E 2EN8A 2EPPA 1RC7A 1N36E 1DI2A 2EPOA 4WYQB 2RSIA 2JXPA 2RS6A 4K0KE 2EMZA 2WBSA 2LVHA 1MGTA 1I94E 1L4SA 5F3WA 2V86A 5LLQA 2LUQA 4B3RE 1NCSA 1STUA 2YPNA 5KL6A 2A25A 1PJQA 2E1MA 1QU6A 1NEIA 4GKJE 2ADRA 1PJSA 4R2QA 1XMQE 4KZSA 2EWLA 4DR2E 1A1HA 2DSYA 3BBGA 3BF2A 2M9AA 4L8NA 4ZYHA 1TF6A 5A6BA 5T6JA 2E72A 2EL5A 4R2PA 2YTGA 4R2CA 3F6GA 4HTGA 4JI7E 4M9VC 1B69A 5TSEA 4GZNC 2G7HA 2KHXA 4JI1E 3T1HE 3DJWA 4X8WA 4LTYA 2GPIA 1X6HA 1T39A 4DKKA 4LFAE 4YHHE 4TUGA 2EPMX 5IT9C 1TN9A 2EMBA 1ZBQA 4DV4E 5A6KA 4DR4E 1J26A 5KL7A 2UUAE 2EQ0A 1T4NA 1DQ3A 4NZVA 3C6MA 1SR9A 2YTJA 2EOMA 4R2EA 1EH6A 2EM4A 2YTDA 2EOEA 2GLIA 2JPAA 2EMWA 3JTZA 2EOXA 4DV2E 2K7IA 4X65E 5KL5A 5IXMB 2EN2A 1G2FC 4R03A 2NUFA 1JK2A 4B3TE 2N3HA 3LMLA 3AUZA 2WBUA 2JR1A 1MEYC 1UBDC 2VRDA 1GQEA 4BC7A 1EKZA 1X3CA 4B3ME 2YZTA 4X9JA 5A6JA 1PJTA 4NXME 2V87A 2F8BA 4DMIA 2UU9E 2EPXA 2NUGA 1IBME 3T1YE 4NHRA 1X6FA 4R2AA 4L5NC 1F2IG 3OMLA 2R1FA 1YYKA 2EPAA 2KONA 3ECRA 2WZOA 5AE1A 1UILA 4X62E 2UUBE 3FIGA 3EPKA 1SFEA 3HPSA 1LLMC 2YRHA 1IBLE 2JWOA 4LF6E 2EM3A 4M2ZA 2EM9A 4P78A 1A1LA 2V88A 1J5EE 2YWQA 2YTQA 2EMGA 3J80C 3EPJA 2VQEE 2MKNA 3F6HA 4GEQB 1YFHA 4N4RB 1IBKE 4LF7E 2RQLA 1KJKA 2DIXA 2EPRA 4MLVA 2EOOA 4WXCA 3C4TA 1IMUA 3J81C 2N3GA
chains in the Genus database with same CATH topology
2LV2A 4R2SA 2LO3A 1A1IA 2M9AA 2NABA 1TF6A 3UK3C 2E72A 2CT1A 2EOQA 2EL5A 2MDGA 1ZR9A 4R2DA 2YTGA 2DMIA 2BB8A 4R2CA 2YSPA 4R2PA 1BBOA 1JK1A 2LT7A 2EMCA 4M9VC 2EPZA 2GHFA 1B69A 3MHHC 1UN6B 4GZNC 2ELYA 2PRTA 2YTNA 2RPCA 2YU8A 1X6HA 2EOJA 2D9HA 4WSGA 5KL2A 1ZU1A 2EL4A 1TF3A 2EM7A 2EN4A 2EN3A 2EOIA 1TN9A 2EOYA 2EMBA 2LCEA 1BB8A 5KL7A 4F6NA 2EL6A 1AAYA 2EMIA 2EQ0A 1RMDA 2EM5A 2EE8A 2MKDA 2YTJA 2EOMA 4R2EA 2YTEA 2EM4A 2EP3A 2YTDA 2ENAA 2EOEA 2EMLA 2GLIA 2JPAA 4FK5C 2EMWA 2WBTA 2EOXA 2EQ3A 2EM8A 5KL5A 2EN2A 2EMAA 2EMXA 3MHSC 1G2FC 1WJPA 1JK2A 1X5WA 2YSOA 2YU5A 2EN1A 2WBUA 1MEYC 1ZAAC 3EPLA 1UBDC 2VRDA 5KL4A 1X3CA 2EORA 2EPUA 4X9JA 2EM0A 2YTFA 2YTPA 2EN6A 1X6EA 2EJ4A 1P47A 1Z1BA 1YSAC 2DLKA 4R2RA 1A1FA 1YUJA 1YUIA 2EPXA 2EPCA 2WCC3 2ELZA 2EM6A 2EM2A 2J7JA 2EQ1A 1X6FA 2DRPA 4R2AA 1F2IG 2JP9A 1DGCA 2R1FA 2EOFA 2HGHA 2EPAA 2CTDA 2ENHA 2EMKA 2EOZA 2EN8A 4IJDA 3EPKA 2EOSA 1LLMC 2EPPA 2YTOA 2YRHA 1A1JA 4F6MA 2DGCA 2EM3A 2RSIA 2CSHA 1A1GA 2EMZA 2EM9A 2WBSA 1A1LA 2I13A 2YRMA 2LVHA 4IS1C 5KL3A 2EMYA 1A1KA 2YTQA 2EMGA 3EPJA 3M99B 2MKNA 2EMFA 3EPHA 1NCSA 1G2DC 5KL6A 2YRKA 4F2JC 1KJKA 2EOHA 2A25A 2ENCA 2YTIA 2EPRA 2ADRA 4R2QA 2EN7A 2EOOA 2EMHA 3VHTB 2DLQA 1A1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LV2 A;  4R2S A;  2LO3 A;  1A1I A;  2M9A A;  2NAB A;  1TF6 A;  3UK3 C;  2E72 A;  2CT1 A;  2EOQ A;  2EL5 A;  2MDG A;  1ZR9 A;  4R2D A;  2YTG A;  2DMI A;  2BB8 A;  4R2C A;  2YSP A;  4R2P A;  1BBO A;  1JK1 A;  2LT7 A;  2EMC A;  4M9V C;  2EPZ A;  2GHF A;  1B69 A;  3MHH C;  1UN6 B;  4GZN C;  2ELY A;  2PRT A;  2YTN A;  2RPC A;  2YU8 A;  1X6H A;  2EOJ A;  2D9H A;  4WSG A;  5KL2 A;  1ZU1 A;  2EL4 A;  1TF3 A;  2EM7 A;  2EN4 A;  2EN3 A;  2EOI A;  1TN9 A;  2EOY A;  2EMB A;  2LCE A;  1BB8 A;  5KL7 A;  4F6N A;  2EL6 A;  1AAY A;  2EMI A;  2EQ0 A;  1RMD A;  2EM5 A;  2EE8 A;  2MKD A;  2YTJ A;  2EOM A;  4R2E A;  2YTE A;  2EM4 A;  2EP3 A;  2YTD A;  2ENA A;  2EOE A;  2EML A;  2GLI A;  2JPA A;  4FK5 C;  2EMW A;  2WBT A;  2EOX A;  2EQ3 A;  2EM8 A;  5KL5 A;  2EN2 A;  2EMA A;  2EMX A;  3MHS C;  1G2F C;  1WJP A;  1JK2 A;  1X5W A;  2YSO A;  2YU5 A;  2EN1 A;  2WBU A;  1MEY C;  1ZAA C;  3EPL A;  1UBD C;  2VRD A;  5KL4 A;  1X3C A;  2EOR A;  2EPU A;  4X9J A;  2EM0 A;  2YTF A;  2YTP A;  2EN6 A;  1X6E A;  2EJ4 A;  1P47 A;  1Z1B A;  1YSA C;  2DLK A;  4R2R A;  1A1F A;  1YUJ A;  1YUI A;  2EPX A;  2EPC A;  2WCC 3;  2ELZ A;  2EM6 A;  2EM2 A;  2J7J A;  2EQ1 A;  1X6F A;  2DRP A;  4R2A A;  1F2I G;  2JP9 A;  1DGC A;  2R1F A;  2EOF A;  2HGH A;  2EPA A;  2CTD A;  2ENH A;  2EMK A;  2EOZ A;  2EN8 A;  4IJD A;  3EPK A;  2EOS A;  1LLM C;  2EPP A;  2YTO A;  2YRH A;  1A1J A;  4F6M A;  2DGC A;  2EM3 A;  2RSI A;  2CSH A;  1A1G A;  2EMZ A;  2EM9 A;  2WBS A;  1A1L A;  2I13 A;  2YRM A;  2LVH A;  4IS1 C;  5KL3 A;  2EMY A;  1A1K A;  2YTQ A;  2EMG A;  3EPJ A;  3M99 B;  2MKN A;  2EMF A;  3EPH A;  1NCS A;  1G2D C;  5KL6 A;  2YRK A;  4F2J C;  1KJK A;  2EOH A;  2A25 A;  2ENC A;  2YTI A;  2EPR A;  2ADR A;  4R2Q A;  2EN7 A;  2EOO A;  2EMH A;  3VHT B;  2DLQ A;  1A1H A; 
#chains in the Genus database with same CATH topology
 2L2K B;  1A1I A;  3UK3 C;  1QNT A;  2Q8U A;  2CT1 A;  2M7Q A;  1PKP A;  3HPZ A;  1JK1 A;  4DR3 E;  2EMC A;  4F9C B;  2EPZ A;  4M0V A;  4BHC A;  1T4L B;  4MLQ A;  5KL2 A;  2V85 A;  1T38 A;  4F9B B;  1IQO A;  2EL4 A;  4R8O A;  4F54 A;  2EN4 A;  2EN3 A;  3THN A;  2E5L E;  3C4B A;  3OTO E;  2JOX A;  2IHR 1;  1BB8 A;  2F4V E;  2EMI A;  3VYY A;  1EH8 A;  1HR0 E;  4JV5 E;  4DV6 E;  1BBG A;  2L33 A;  4B3S E;  2EP3 A;  2EPK X;  2EML A;  4JI3 E;  2WBT A;  2EQ3 A;  2EM8 A;  3P1X A;  3MHS C;  2L3J A;  1PDA A;  1UHZ A;  4BS9 A;  1X5W A;  2YSO A;  2YU5 A;  5LMU E;  1XMO E;  2UXB E;  3EPL A;  4JI4 E;  3LLH A;  3L00 A;  2EPU A;  4BHB A;  1YSA C;  2EM0 A;  2YTF A;  1GZ6 A;  2EJ4 A;  3ADI A;  4RHB B;  5FLX C;  1AH5 A;  4X64 E;  1IQS A;  3BID A;  2EPC A;  4KWY A;  1X47 A;  2EM2 A;  4WFT A;  4NXN E;  2N8X A;  2M1S A;  3TQM A;  3KZZ A;  2EOF A;  2FTX B;  2RS7 A;  2EZ6 A;  1N33 E;  4JI2 E;  2L2M A;  2EOS A;  1KYQ A;  2YTO A;  4F6M A;  4BC9 A;  2NA2 A;  2CSH A;  2MC6 A;  5AE3 A;  3H09 A;  2I13 A;  2B3T B;  1A1K A;  2K4V A;  4F9A B;  4DV5 E;  4DV7 E;  2I9I A;  2V83 A;  4BCA A;  3K6Q A;  2YRK A;  1X48 A;  2EOH A;  2ENC A;  4BBY A;  2YTI A;  1XNQ E;  2EN7 A;  3KWR A;  1WXR A;  2ODR D;  5BR8 E;  2EMH A;  2L8T A;  3VHT B;  1X49 A;  4WXD A;  2DLQ A;  4LF5 E;  3VYX A;  2LO3 A;  3IWB A;  3HXL A;  4R2D A;  2MDG A;  2DMI A;  2BB8 A;  2YSP A;  2B9D A;  1BBO A;  5AC4 A;  4WSP A;  4AQY E;  2GHF A;  3JAM C;  3MHH C;  2RSM A;  2JVA A;  4JI6 E;  2PRT A;  3DF6 A;  2KOU A;  2RPC A;  4M30 A;  2EOJ A;  2D9H A;  4WSG A;  2L92 A;  1ZU1 A;  1TF3 A;  2CPN A;  5A2Q C;  2B7T A;  2EOY A;  2L2N A;  4O43 A;  1XNR E;  2NUE A;  2LMZ A;  4LF8 E;  2EL6 A;  2JY9 A;  2EM5 A;  2VF1 A;  2MDR A;  2LRS A;  5CFF E;  2EE8 A;  4LF9 E;  3C6K A;  2LUP B;  1HNZ E;  4J8Z A;  2UUC E;  2M4I A;  4DV3 E;  4WPY A;  4FK5 C;  2B7V A;  2R76 A;  4YY3 E;  1WJP A;  5IV8 B;  4ZYG A;  2EN1 A;  2V89 A;  4DUY E;  1ZAA C;  5KL4 A;  4BMJ A;  4JI0 E;  2YTP A;  4JI5 E;  1P47 A;  3RMP A;  4R2R A;  2LBS B;  1YUJ A;  3ZOQ B;  5A69 A;  2LJH A;  2WCC 3;  2ELZ A;  2EM6 A;  2J7J A;  5LMN E;  2EQ1 A;  4LFB E;  2DRP A;  2LE2 A;  2JYA A;  1ZBT A;  3J7Y p;  4GKK E;  3VK6 A;  2EMK A;  4DR1 E;  4HEI A;  2V8Q B;  4Q35 B;  4ZYE A;  3KZY A;  4IJD A;  5IWA E;  4LU9 A;  2DB2 A;  1YZ9 A;  2LTR A;  1A1J A;  2DGC A;  2JOB A;  4DR6 E;  5A6A A;  3QG5 C;  1A1G A;  1RQ0 A;  4RH8 A;  3HQ1 A;  2YRM A;  4KHP E;  4IS1 C;  5KL3 A;  2EMY A;  1O0W A;  3J7A G;  2BBG A;  3ADL A;  2L6M A;  3M99 B;  2EMF A;  3EPH A;  4I8O A;  4TUI A;  1G2D C;  4F2J C;  1WRJ A;  3JU0 A;  4X66 E;  2L3C A;  2LTS A;  1N3G A;  1GTK A;  2HC5 A;  3THO B;  2FV4 B;  4ZYD A;  2LV2 A;  4R2S A;  2ODR C;  2NAB A;  3ADJ A;  2VE7 C;  3ADG A;  2EOQ A;  1ZR9 A;  2ZM6 E;  2LT7 A;  2HJJ A;  4O5G A;  1UN6 B;  2ELY A;  1FJG E;  5DNY A;  2YTN A;  5LL6 R;  2YU8 A;  3MSW A;  2RTX A;  4DUZ E;  4LFC E;  2EM7 A;  2EOI A;  2EPL X;  1T4O A;  1YYO A;  2LCE A;  3EQ1 A;  5ADZ A;  3HTX A;  3AV0 A;  4F6N A;  1AAY A;  5AE2 A;  1RMD A;  1HNX E;  3IWC A;  2FGG A;  2DMY A;  2VQF E;  2MKD A;  1N32 E;  2YTE A;  4DV1 E;  1FKA E;  4Q28 A;  2ENA A;  3IWD A;  2HHH E;  3BGH A;  1N34 E;  4DR7 E;  4P7D A;  2EMX A;  2EMA A;  2YT4 A;  1HNW E;  4OOG C;  2UXD E;  2EOR A;  1EH7 A;  5AC5 A;  2EN6 A;  1X6E A;  1YYW A;  1Z1B A;  2H36 X;  2MC5 A;  2DLK A;  4O4K A;  1A1F A;  1YPN A;  4O24 A;  1YUI A;  4DV0 E;  5A6B D;  2EPN A;  1WHQ A;  4WX9 A;  4DR5 E;  2JP9 A;  4LF4 E;  1DGC A;  2LJU A;  1WHN A;  2HGH A;  2CTD A;  2ENH A;  4JYA E;  2UXC E;  4JI8 E;  2EOZ A;  5AAS A;  4OX9 E;  2EN8 A;  2EPP A;  1RC7 A;  1N36 E;  1DI2 A;  2EPO A;  4WYQ B;  2RSI A;  2JXP A;  2RS6 A;  4K0K E;  2EMZ A;  2WBS A;  2LVH A;  1MGT A;  1I94 E;  1L4S A;  5F3W A;  2V86 A;  5LLQ A;  2LUQ A;  4B3R E;  1NCS A;  1STU A;  2YPN A;  5KL6 A;  2A25 A;  1PJQ A;  2E1M A;  1QU6 A;  1NEI A;  4GKJ E;  2ADR A;  1PJS A;  4R2Q A;  1XMQ E;  4KZS A;  2EWL A;  4DR2 E;  1A1H A;  2DSY A;  3BBG A;  3BF2 A;  2M9A A;  4L8N A;  4ZYH A;  1TF6 A;  5A6B A;  5T6J A;  2E72 A;  2EL5 A;  4R2P A;  2YTG A;  4R2C A;  3F6G A;  4HTG A;  4JI7 E;  4M9V C;  1B69 A;  5TSE A;  4GZN C;  2G7H A;  2KHX A;  4JI1 E;  3T1H E;  3DJW A;  4X8W A;  4LTY A;  2GPI A;  1X6H A;  1T39 A;  4DKK A;  4LFA E;  4YHH E;  4TUG A;  2EPM X;  5IT9 C;  1TN9 A;  2EMB A;  1ZBQ A;  4DV4 E;  5A6K A;  4DR4 E;  1J26 A;  5KL7 A;  2UUA E;  2EQ0 A;  1T4N A;  1DQ3 A;  4NZV A;  3C6M A;  1SR9 A;  2YTJ A;  2EOM A;  4R2E A;  1EH6 A;  2EM4 A;  2YTD A;  2EOE A;  2GLI A;  2JPA A;  2EMW A;  3JTZ A;  2EOX A;  4DV2 E;  2K7I A;  4X65 E;  5KL5 A;  5IXM B;  2EN2 A;  1G2F C;  4R03 A;  2NUF A;  1JK2 A;  4B3T E;  2N3H A;  3LML A;  3AUZ A;  2WBU A;  2JR1 A;  1MEY C;  1UBD C;  2VRD A;  1GQE A;  4BC7 A;  1EKZ A;  1X3C A;  4B3M E;  2YZT A;  4X9J A;  5A6J A;  1PJT A;  4NXM E;  2V87 A;  2F8B A;  4DMI A;  2UU9 E;  2EPX A;  2NUG A;  1IBM E;  3T1Y E;  4NHR A;  1X6F A;  4R2A A;  4L5N C;  1F2I G;  3OML A;  2R1F A;  1YYK A;  2EPA A;  2KON A;  3ECR A;  2WZO A;  5AE1 A;  1UIL A;  4X62 E;  2UUB E;  3FIG A;  3EPK A;  1SFE A;  3HPS A;  1LLM C;  2YRH A;  1IBL E;  2JWO A;  4LF6 E;  2EM3 A;  4M2Z A;  2EM9 A;  4P78 A;  1A1L A;  2V88 A;  1J5E E;  2YWQ A;  2YTQ A;  2EMG A;  3J80 C;  3EPJ A;  2VQE E;  2MKN A;  3F6H A;  4GEQ B;  1YFH A;  4N4R B;  1IBK E;  4LF7 E;  2RQL A;  1KJK A;  2DIX A;  2EPR A;  4MLV A;  2EOO A;  4WXC A;  3C4T A;  1IMU A;  3J81 C;  2N3G A; 
#chains in the Genus database with same CATH homology
 2LV2 A;  4R2S A;  2LO3 A;  1A1I A;  2M9A A;  2NAB A;  1TF6 A;  3UK3 C;  2E72 A;  2CT1 A;  2EOQ A;  2EL5 A;  2MDG A;  1ZR9 A;  4R2D A;  2YTG A;  2DMI A;  2BB8 A;  4R2C A;  2YSP A;  4R2P A;  1BBO A;  1JK1 A;  2LT7 A;  2EMC A;  4M9V C;  2EPZ A;  2GHF A;  1B69 A;  3MHH C;  1UN6 B;  4GZN C;  2ELY A;  2PRT A;  2YTN A;  2RPC A;  2YU8 A;  1X6H A;  2EOJ A;  2D9H A;  4WSG A;  5KL2 A;  1ZU1 A;  2EL4 A;  1TF3 A;  2EM7 A;  2EN4 A;  2EN3 A;  2EOI A;  1TN9 A;  2EOY A;  2EMB A;  2LCE A;  1BB8 A;  5KL7 A;  4F6N A;  2EL6 A;  1AAY A;  2EMI A;  2EQ0 A;  1RMD A;  2EM5 A;  2EE8 A;  2MKD A;  2YTJ A;  2EOM A;  4R2E A;  2YTE A;  2EM4 A;  2EP3 A;  2YTD A;  2ENA A;  2EOE A;  2EML A;  2GLI A;  2JPA A;  4FK5 C;  2EMW A;  2WBT A;  2EOX A;  2EQ3 A;  2EM8 A;  5KL5 A;  2EN2 A;  2EMA A;  2EMX A;  3MHS C;  1G2F C;  1WJP A;  1JK2 A;  1X5W A;  2YSO A;  2YU5 A;  2EN1 A;  2WBU A;  1MEY C;  1ZAA C;  3EPL A;  1UBD C;  2VRD A;  5KL4 A;  1X3C A;  2EOR A;  2EPU A;  4X9J A;  2EM0 A;  2YTF A;  2YTP A;  2EN6 A;  1X6E A;  2EJ4 A;  1P47 A;  1Z1B A;  1YSA C;  2DLK A;  4R2R A;  1A1F A;  1YUJ A;  1YUI A;  2EPX A;  2EPC A;  2WCC 3;  2ELZ A;  2EM6 A;  2EM2 A;  2J7J A;  2EQ1 A;  1X6F A;  2DRP A;  4R2A A;  1F2I G;  2JP9 A;  1DGC A;  2R1F A;  2EOF A;  2HGH A;  2EPA A;  2CTD A;  2ENH A;  2EMK A;  2EOZ A;  2EN8 A;  4IJD A;  3EPK A;  2EOS A;  1LLM C;  2EPP A;  2YTO A;  2YRH A;  1A1J A;  4F6M A;  2DGC A;  2EM3 A;  2RSI A;  2CSH A;  1A1G A;  2EMZ A;  2EM9 A;  2WBS A;  1A1L A;  2I13 A;  2YRM A;  2LVH A;  4IS1 C;  5KL3 A;  2EMY A;  1A1K A;  2YTQ A;  2EMG A;  3EPJ A;  3M99 B;  2MKN A;  2EMF A;  3EPH A;  1NCS A;  1G2D C;  5KL6 A;  2YRK A;  4F2J C;  1KJK A;  2EOH A;  2A25 A;  2ENC A;  2YTI A;  2EPR A;  2ADR A;  4R2Q A;  2EN7 A;  2EOO A;  2EMH A;  3VHT B;  2DLQ A;  1A1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...