3JTZA

Structure of the arm-type binding domain of hpi integrase
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
SLTDAKIRTLKPSDKPFKVSDSHGLYLLVKPGGSRHWYLKYRISGKESRIALGAYPAISLSDARQQREGIRKMLALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the arm-type binding domains of HPI and HAI7 integrases
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Dna binding protein
molecule keywords Integrase
total genus 20
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2009-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.390 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3jtzA00
3RMPA 3JTZA 3JU0A
chains in the Genus database with same CATH superfamily
3BBGA 2G7HA 4LF9E 3HTXA 4LF5E 2YTNA 3LLHA 4K0KE 2LJHA 2DB2A 1X47A 4P7DA 1A1GA 4B3RE 2MC6A 1LLMC 4DV4E 4R2EA 4WFTA 4LFAE 2UUCE 1SFEA 3J80C 2MKNA 2V86A 1WHQA 2EQ1A 2F8BA 1PJQA 3EPHA 4BBYA 2DLQA 2VQFE 3J7Yp 4F6NA 3T1YE 5A6AA 4JI8E 4M30A 1YUIA 4TUGA 3MHSC 1RQ0A 2L2MA 4AQYE 1PKPA 2V85A 5AE3A 2HJJA 1IBKE 3THNA 2N8XA 4X62E 2YSPA 4FK5C 1NCSA 2EN7A 2LO3A 3DF6A 5TSEA 3T1HE 4O4KA 2YTEA 1A1HA 5ADZA 1SR9A 2EPPA 4F9CB 2WBSA 4GKJE 2V87A 2ODRD 2WBTA 4JI0E 4KHPE 2EOXA 4OOGC 2EM0A 3JTZA 5AASA 1T38A 2RPCA 3EQ1A 1X6FA 2EOMA 1ZAAC 3EPLA 4RHBB 1N36E 2EOQA 2N3GA 2YPNA 1A1IA 2N3HA 2DSYA 1DGCA 3BGHA 1A1JA 5KL5A 4YHHE 3ADJA 1IMUA 1AH5A 2MDGA 3LMLA 2YRMA 2LBSB 3KWRA 3IWDA 1YPNA 2EJ4A 4LFBE 2EM6A 1MGTA 2EORA 5A69A 2EPCA 4X9JA 2BBGA 3DJWA 2EM4A 1IBME 2M4IA 1N32E 2YTOA 2EMXA 4R2PA 1UILA 2JOBA 4JI1E 5AE2A 1T4LB 2EM3A 2DGCA 4DR4E 2UUBE 2EOZA 4WPYA 4LF8E 4R03A 5LMUE 4YY3E 4L8NA 2L2KB 2JXPA 1XNRE 4R8OA 2EOIA 1UHZA 4KZSA 1A1FA 2LTSA 5A2QC 2EN6A 2LUQA 4LFCE 1J26A 2EL5A 2MKDA 3K6QA 1ZU1A 4Q35B 2D9HA 2EN4A 2JY9A 2RS7A 2YTFA 2J7JA 2YRKA 2RS6A 2YTIA 4BMJA 4ZYGA 2M7QA 1EH7A 1N33E 2NUEA 4DR5E 2YTPA 4GZNC 1XNQE 4J8ZA 1IQSA 2DIXA 2L92A 5A6BA 4KWYA 3OTOE 2WBUA 2YRHA 1EH6A 4R2AA 1HNXE 4DUZE 2WCC3 2EMYA 2CPNA 2YU8A 1QU6A 4WXDA 2EOOA 3J7AG 2VE7C 4OX9E 4RH8A 2YTQA 4JYAE 2EN1A 2LT7A 1EKZA 1GZ6A 4M0VA 3MHHC 1F2IG 1FJGE 2EMKA 2DMYA 4R2SA 2EM8A 1X3CA 2K4VA 2EQ3A 1HNWE 4DV2E 5LLQA 3TQMA 2GHFA 3AUZA 3ADIA 4JI5E 4DV7E 3MSWA 2EM5A 1ZR9A 2L2NA 3VK6A 1GQEA 2EMLA 5KL6A 2EPXA 2YSOA 2YU5A 2IHR1 1NEIA 3ZOQB 1PDAA 4JI4E 3VYYA 1XMOE 2JYAA 2LMZA 4DR7E 2EPNA 5LMNE 2K7IA 2NA2A 1PJSA 1A1KA 1ZBTA 2YWQA 1XMQE 2JWOA 1I94E 3C4TA 2DMIA 2YTGA 4L5NC 2R1FA 1G2FC 2R76A 1TF6A 2ODRC 2EPMX 4LU9A 1IQOA 1YSAC 4F9BB 1TN9A 2M9AA 4DV6E 5DNYA 2EPUA 5F3WA 2EMZA 2V88A 1UBDC 2JVAA 1B69A 4WSGA 1WHNA 5AC5A 2RSIA 1N34E 2EMAA 4X8WA 5IT9C 1DQ3A 3THOB 4TUIA 3UK3C 4B3SE 3H09A 4GKKE 2JPAA 1X5WA 3EPKA 1J5EE 2B9DA 2EMWA 1HR0E 2I9IA 4JI3E 4NXME 2EPKX 2E72A 1BBOA 1RMDA 2NUFA 1YFHA 5KL4A 1PJTA 2DLKA 3ECRA 2EE8A 4ZYHA 2V83A 1X6EA 2VF1A 5LL6R 4DR2E 2LUPB 2Q8UA 1G2DC 4DR6E 2EOSA 1WJPA 4X66E 1EH8A 2L3JA 2FV4B 4P78A 1DI2A 2BB8A 1YYKA 2LJUA 4LF4E 1T4OA 2L8TA 5IXMB 2LRSA 2LCEA 3HPZA 4LF7E 4NZVA 2CTDA 1L4SA 2F4VE 4IJDA 2JR1A 3AV0A 4HEIA 2ZM6E 1KYQA 2YTDA 4O43A 2GPIA 4JV5E 4DV1E 3FIGA 1AAYA 2LE2A 3HXLA 2EPOA 2EM7A 4DUYE 3KZZA 4B3TE 1BB8A 1X6HA 2UUAE 2EOJA 2UXCE 2EL4A 4JI7E 4BC7A 2EN2A 1P47A 1WRJA 4BHCA 4NHRA 5KL3A 2PRTA 1T4NA 2KOUA 4F9AB 2CSHA 2EOYA 5KL7A 1Z1BA 2WZOA 4Q28A 2V89A 4R2CA 3RMPA 4DMIA 2UXBE 3BIDA 5T6JA 4DKKA 5AC4A 2EQ0A 2EZ6A 4GEQB 2MDRA 4R2RA 5IWAE 2JOXA 2EMCA 3HQ1A 4WX9A 2V8QB 1YYOA 2YZTA 4BCAA 2HHHE 4F2JC 2E1MA 2EMGA 2A25A 3KZYA 1X48A 1N3GA 3F6HA 1ZBQA 2EMIA 3J81C 2ELYA 4BS9A 4HTGA 3VYXA 5KL2A 2YTJA 3ADGA 4BC9A 4DV3E 1YUJA 2HC5A 4R2DA 2NABA 3M99B 2UU9E 2L33A 4DR1E 2EM2A 1GTKA 3IWBA 1T39A 1RC7A 4N4RB 1MEYC 5FLXC 4R2QA 2EPRA 1JK1A 1WXRA 2FGGA 3C6KA 4MLVA 4WXCA 2KONA 5A6BD 2CT1A 2RQLA 3EPJA 2ENCA 2VRDA 3ADLA 1IBLE 2EP3A 2MC5A 3BF2A 4O5GA 5A6JA 2M1SA 2EOFA 4B3ME 2KHXA 3F6GA 2B7TA 2EM9A 1X49A 2B3TB 4DV5E 1A1LA 1TF3A 4JI6E 3P1XA 2EMFA 2B7VA 4ZYDA 4F54A 3QG5C 2LV2A 1KJKA 1QNTA 2EOHA 2ADRA 2YT4A 2NUGA 4LF6E 2RTXA 4M2ZA 2EPAA 2EMHA 3VHTB 1FKAE 2RSMA 4BHBA 4ZYEA 1YZ9A 5AE1A 2VQEE 4IS1C 2EN3A 2FTXB 2L6MA 2EPLX 4WYQB 5A6KA 5IV8B 5CFFE 2EWLA 3IWCA 4X64E 3HPSA 2L3CA 2ELZA 3C4BA 4MLQA 4DR3E 2EMBA 2JP9A 4NXNE 4JI2E 2ENAA 2UXDE 2E5LE 5BR8E 3JU0A 4I8OA 1YYWA 3OMLA 4O24A 3C6MA 2ENHA 4M9VC 1HNZE 2LTRA 4X65E 2EOEA 2EPZA 2GLIA 2H36X 3L00A 2HGHA 4DV0E 4LTYA 4F6MA 2I13A 2LVHA 2EL6A 1UN6B 2DRPA 1O0WA 2EN8A 4WSPA 3JAMC 1BBGA 1JK2A 1STUA
chains in the Genus database with same CATH topology
2G7HA 4LF9E 3HTXA 3F6HA 1N34E 1ZBQA 3J81C 4LF5E 3K6QA 3LLHA 4K0KE 4BS9A 2LJHA 2DB2A 1X47A 4P7DA 4X8WA 5IT9C 4B3RE 4JI1E 2MC6A 1DQ3A 4DV4E 4TUIA 2JY9A 4B3SE 3H09A 2RS7A 4WFTA 3VYXA 4LFAE 4GKKE 4BMJA 2RS6A 2UUCE 3ADGA 1J5EE 2M7QA 4BC9A 2B9DA 4DV3E 3J80C 4DR5E 2NUEA 1N33E 2V86A 1WHQA 4J8ZA 2F8BA 1XNQE 1HR0E 2L33A 4DR1E 2DIXA 2L92A 2UU9E 4JI3E 4NXME 3OTOE 4BBYA 2NUFA 2VQFE 3IWBA 1RC7A 3J7Yp 5FLXC 3T1YE 4JI8E 4M30A 4TUGA 1HNXE 1WXRA 2FGGA 4DUZE 2V83A 1RQ0A 1HNWE 2CPNA 2VF1A 5LL6R 2L2MA 4DR2E 2LUPB 4AQYE 2KONA 1PKPA 2V85A 4DR6E 1QU6A 5AE3A 3J7AG 4X66E 2L3JA 2FV4B 2VE7C 1IBKE 4OX9E 4P78A 3ADLA 1DI2A 1IBLE 4X62E 4JYAE 1YYKA 2MC5A 4LF4E 1EKZA 1T4OA 1GZ6A 2L8TA 4M0VA 3DF6A 3T1HE 1J26A 2LRSA 1FJGE 2M1SA 3HPZA 4LF7E 2DMYA 4B3ME 2KHXA 3F6GA 5ADZA 2B7TA 1SR9A 1X49A 2B3TB 4DV5E 4JI6E 4F9CB 2F4VE 2K4VA 3P1XA 2B7VA 2V87A 2JR1A 2ODRD 3AV0A 4F54A 4DV2E 4GKJE 4JI0E 4KHPE 3AUZA 2ZM6E 3ADIA 4OOGC 4JI5E 4DV7E 2YT4A 3MSWA 2NUGA 2L2NA 3JTZA 5AASA 3VK6A 4LF6E 1GQEA 2RTXA 4M2ZA 2IHR1 4JV5E 4DV1E 3ZOQB 1FKAE 1N36E 2N3GA 4JI4E 2RSMA 3FIGA 3VYYA 1YZ9A 2LE2A 5AE1A 2VQEE 3HXLA 1XMOE 2L6MA 2FTXB 4DUYE 2LMZA 2N3HA 2DSYA 4DR7E 4WYQB 4B3TE 4YHHE 3ADJA 5LMNE 2UUAE 5CFFE 2NA2A 2UXCE 4BC7A 4JI7E 2EWLA 3LMLA 2LBSB 3KWRA 3IWCA 4X64E 3IWDA 1ZBTA 3HPSA 1XMQE 2L3CA 4LFBE 2JWOA 3C4BA 4DR3E 1T4NA 2KOUA 4F9AB 4NXNE 4JI2E 1I94E 2UXDE 3C4TA 2WZOA 5BR8E 2E5LE 4Q28A 2V89A 3JU0A 3DJWA 4I8OA 1IBME 1YYWA 4L5NC 3RMPA 3OMLA 2M4IA 4DMIA 1N32E 2UXBE 1UILA 2JOBA 2ODRC 1HNZE 5AE2A 2LTRA 5T6JA 1T4LB 4DKKA 2UUBE 4X65E 4DR4E 4WPYA 4LU9A 4R03A 4LF8E 2EZ6A 4GEQB 5LMUE 2MDRA 4YY3E 4F9BB 5IWAE 2JOXA 2H36X 4L8NA 2L2KB 4DV0E 4LTYA 1XNRE 4DV6E 3HQ1A 4R8OA 5DNYA 5F3WA 2V8QB 1YYOA 2V88A 1O0WA 4WSPA 1UHZA 2JVAA 2YZTA 3JAMC 4KZSA 4BCAA 2HHHE 2LTSA 2E1MA 5A2QC 2LUQA 1STUA 4LFCE 1X48A 1WHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RMP A;  3JTZ A;  3JU0 A; 
#chains in the Genus database with same CATH topology
 3BBG A;  2G7H A;  4LF9 E;  3HTX A;  4LF5 E;  2YTN A;  3LLH A;  4K0K E;  2LJH A;  2DB2 A;  1X47 A;  4P7D A;  1A1G A;  4B3R E;  2MC6 A;  1LLM C;  4DV4 E;  4R2E A;  4WFT A;  4LFA E;  2UUC E;  1SFE A;  3J80 C;  2MKN A;  2V86 A;  1WHQ A;  2EQ1 A;  2F8B A;  1PJQ A;  3EPH A;  4BBY A;  2DLQ A;  2VQF E;  3J7Y p;  4F6N A;  3T1Y E;  5A6A A;  4JI8 E;  4M30 A;  1YUI A;  4TUG A;  3MHS C;  1RQ0 A;  2L2M A;  4AQY E;  1PKP A;  2V85 A;  5AE3 A;  2HJJ A;  1IBK E;  3THN A;  2N8X A;  4X62 E;  2YSP A;  4FK5 C;  1NCS A;  2EN7 A;  2LO3 A;  3DF6 A;  5TSE A;  3T1H E;  4O4K A;  2YTE A;  1A1H A;  5ADZ A;  1SR9 A;  2EPP A;  4F9C B;  2WBS A;  4GKJ E;  2V87 A;  2ODR D;  2WBT A;  4JI0 E;  4KHP E;  2EOX A;  4OOG C;  2EM0 A;  3JTZ A;  5AAS A;  1T38 A;  2RPC A;  3EQ1 A;  1X6F A;  2EOM A;  1ZAA C;  3EPL A;  4RHB B;  1N36 E;  2EOQ A;  2N3G A;  2YPN A;  1A1I A;  2N3H A;  2DSY A;  1DGC A;  3BGH A;  1A1J A;  5KL5 A;  4YHH E;  3ADJ A;  1IMU A;  1AH5 A;  2MDG A;  3LML A;  2YRM A;  2LBS B;  3KWR A;  3IWD A;  1YPN A;  2EJ4 A;  4LFB E;  2EM6 A;  1MGT A;  2EOR A;  5A69 A;  2EPC A;  4X9J A;  2BBG A;  3DJW A;  2EM4 A;  1IBM E;  2M4I A;  1N32 E;  2YTO A;  2EMX A;  4R2P A;  1UIL A;  2JOB A;  4JI1 E;  5AE2 A;  1T4L B;  2EM3 A;  2DGC A;  4DR4 E;  2UUB E;  2EOZ A;  4WPY A;  4LF8 E;  4R03 A;  5LMU E;  4YY3 E;  4L8N A;  2L2K B;  2JXP A;  1XNR E;  4R8O A;  2EOI A;  1UHZ A;  4KZS A;  1A1F A;  2LTS A;  5A2Q C;  2EN6 A;  2LUQ A;  4LFC E;  1J26 A;  2EL5 A;  2MKD A;  3K6Q A;  1ZU1 A;  4Q35 B;  2D9H A;  2EN4 A;  2JY9 A;  2RS7 A;  2YTF A;  2J7J A;  2YRK A;  2RS6 A;  2YTI A;  4BMJ A;  4ZYG A;  2M7Q A;  1EH7 A;  1N33 E;  2NUE A;  4DR5 E;  2YTP A;  4GZN C;  1XNQ E;  4J8Z A;  1IQS A;  2DIX A;  2L92 A;  5A6B A;  4KWY A;  3OTO E;  2WBU A;  2YRH A;  1EH6 A;  4R2A A;  1HNX E;  4DUZ E;  2WCC 3;  2EMY A;  2CPN A;  2YU8 A;  1QU6 A;  4WXD A;  2EOO A;  3J7A G;  2VE7 C;  4OX9 E;  4RH8 A;  2YTQ A;  4JYA E;  2EN1 A;  2LT7 A;  1EKZ A;  1GZ6 A;  4M0V A;  3MHH C;  1F2I G;  1FJG E;  2EMK A;  2DMY A;  4R2S A;  2EM8 A;  1X3C A;  2K4V A;  2EQ3 A;  1HNW E;  4DV2 E;  5LLQ A;  3TQM A;  2GHF A;  3AUZ A;  3ADI A;  4JI5 E;  4DV7 E;  3MSW A;  2EM5 A;  1ZR9 A;  2L2N A;  3VK6 A;  1GQE A;  2EML A;  5KL6 A;  2EPX A;  2YSO A;  2YU5 A;  2IHR 1;  1NEI A;  3ZOQ B;  1PDA A;  4JI4 E;  3VYY A;  1XMO E;  2JYA A;  2LMZ A;  4DR7 E;  2EPN A;  5LMN E;  2K7I A;  2NA2 A;  1PJS A;  1A1K A;  1ZBT A;  2YWQ A;  1XMQ E;  2JWO A;  1I94 E;  3C4T A;  2DMI A;  2YTG A;  4L5N C;  2R1F A;  1G2F C;  2R76 A;  1TF6 A;  2ODR C;  2EPM X;  4LU9 A;  1IQO A;  1YSA C;  4F9B B;  1TN9 A;  2M9A A;  4DV6 E;  5DNY A;  2EPU A;  5F3W A;  2EMZ A;  2V88 A;  1UBD C;  2JVA A;  1B69 A;  4WSG A;  1WHN A;  5AC5 A;  2RSI A;  1N34 E;  2EMA A;  4X8W A;  5IT9 C;  1DQ3 A;  3THO B;  4TUI A;  3UK3 C;  4B3S E;  3H09 A;  4GKK E;  2JPA A;  1X5W A;  3EPK A;  1J5E E;  2B9D A;  2EMW A;  1HR0 E;  2I9I A;  4JI3 E;  4NXM E;  2EPK X;  2E72 A;  1BBO A;  1RMD A;  2NUF A;  1YFH A;  5KL4 A;  1PJT A;  2DLK A;  3ECR A;  2EE8 A;  4ZYH A;  2V83 A;  1X6E A;  2VF1 A;  5LL6 R;  4DR2 E;  2LUP B;  2Q8U A;  1G2D C;  4DR6 E;  2EOS A;  1WJP A;  4X66 E;  1EH8 A;  2L3J A;  2FV4 B;  4P78 A;  1DI2 A;  2BB8 A;  1YYK A;  2LJU A;  4LF4 E;  1T4O A;  2L8T A;  5IXM B;  2LRS A;  2LCE A;  3HPZ A;  4LF7 E;  4NZV A;  2CTD A;  1L4S A;  2F4V E;  4IJD A;  2JR1 A;  3AV0 A;  4HEI A;  2ZM6 E;  1KYQ A;  2YTD A;  4O43 A;  2GPI A;  4JV5 E;  4DV1 E;  3FIG A;  1AAY A;  2LE2 A;  3HXL A;  2EPO A;  2EM7 A;  4DUY E;  3KZZ A;  4B3T E;  1BB8 A;  1X6H A;  2UUA E;  2EOJ A;  2UXC E;  2EL4 A;  4JI7 E;  4BC7 A;  2EN2 A;  1P47 A;  1WRJ A;  4BHC A;  4NHR A;  5KL3 A;  2PRT A;  1T4N A;  2KOU A;  4F9A B;  2CSH A;  2EOY A;  5KL7 A;  1Z1B A;  2WZO A;  4Q28 A;  2V89 A;  4R2C A;  3RMP A;  4DMI A;  2UXB E;  3BID A;  5T6J A;  4DKK A;  5AC4 A;  2EQ0 A;  2EZ6 A;  4GEQ B;  2MDR A;  4R2R A;  5IWA E;  2JOX A;  2EMC A;  3HQ1 A;  4WX9 A;  2V8Q B;  1YYO A;  2YZT A;  4BCA A;  2HHH E;  4F2J C;  2E1M A;  2EMG A;  2A25 A;  3KZY A;  1X48 A;  1N3G A;  3F6H A;  1ZBQ A;  2EMI A;  3J81 C;  2ELY A;  4BS9 A;  4HTG A;  3VYX A;  5KL2 A;  2YTJ A;  3ADG A;  4BC9 A;  4DV3 E;  1YUJ A;  2HC5 A;  4R2D A;  2NAB A;  3M99 B;  2UU9 E;  2L33 A;  4DR1 E;  2EM2 A;  1GTK A;  3IWB A;  1T39 A;  1RC7 A;  4N4R B;  1MEY C;  5FLX C;  4R2Q A;  2EPR A;  1JK1 A;  1WXR A;  2FGG A;  3C6K A;  4MLV A;  4WXC A;  2KON A;  5A6B D;  2CT1 A;  2RQL A;  3EPJ A;  2ENC A;  2VRD A;  3ADL A;  1IBL E;  2EP3 A;  2MC5 A;  3BF2 A;  4O5G A;  5A6J A;  2M1S A;  2EOF A;  4B3M E;  2KHX A;  3F6G A;  2B7T A;  2EM9 A;  1X49 A;  2B3T B;  4DV5 E;  1A1L A;  1TF3 A;  4JI6 E;  3P1X A;  2EMF A;  2B7V A;  4ZYD A;  4F54 A;  3QG5 C;  2LV2 A;  1KJK A;  1QNT A;  2EOH A;  2ADR A;  2YT4 A;  2NUG A;  4LF6 E;  2RTX A;  4M2Z A;  2EPA A;  2EMH A;  3VHT B;  1FKA E;  2RSM A;  4BHB A;  4ZYE A;  1YZ9 A;  5AE1 A;  2VQE E;  4IS1 C;  2EN3 A;  2FTX B;  2L6M A;  2EPL X;  4WYQ B;  5A6K A;  5IV8 B;  5CFF E;  2EWL A;  3IWC A;  4X64 E;  3HPS A;  2L3C A;  2ELZ A;  3C4B A;  4MLQ A;  4DR3 E;  2EMB A;  2JP9 A;  4NXN E;  4JI2 E;  2ENA A;  2UXD E;  2E5L E;  5BR8 E;  3JU0 A;  4I8O A;  1YYW A;  3OML A;  4O24 A;  3C6M A;  2ENH A;  4M9V C;  1HNZ E;  2LTR A;  4X65 E;  2EOE A;  2EPZ A;  2GLI A;  2H36 X;  3L00 A;  2HGH A;  4DV0 E;  4LTY A;  4F6M A;  2I13 A;  2LVH A;  2EL6 A;  1UN6 B;  2DRP A;  1O0W A;  2EN8 A;  4WSP A;  3JAM C;  1BBG A;  1JK2 A;  1STU A; 
#chains in the Genus database with same CATH homology
 2G7H A;  4LF9 E;  3HTX A;  3F6H A;  1N34 E;  1ZBQ A;  3J81 C;  4LF5 E;  3K6Q A;  3LLH A;  4K0K E;  4BS9 A;  2LJH A;  2DB2 A;  1X47 A;  4P7D A;  4X8W A;  5IT9 C;  4B3R E;  4JI1 E;  2MC6 A;  1DQ3 A;  4DV4 E;  4TUI A;  2JY9 A;  4B3S E;  3H09 A;  2RS7 A;  4WFT A;  3VYX A;  4LFA E;  4GKK E;  4BMJ A;  2RS6 A;  2UUC E;  3ADG A;  1J5E E;  2M7Q A;  4BC9 A;  2B9D A;  4DV3 E;  3J80 C;  4DR5 E;  2NUE A;  1N33 E;  2V86 A;  1WHQ A;  4J8Z A;  2F8B A;  1XNQ E;  1HR0 E;  2L33 A;  4DR1 E;  2DIX A;  2L92 A;  2UU9 E;  4JI3 E;  4NXM E;  3OTO E;  4BBY A;  2NUF A;  2VQF E;  3IWB A;  1RC7 A;  3J7Y p;  5FLX C;  3T1Y E;  4JI8 E;  4M30 A;  4TUG A;  1HNX E;  1WXR A;  2FGG A;  4DUZ E;  2V83 A;  1RQ0 A;  1HNW E;  2CPN A;  2VF1 A;  5LL6 R;  2L2M A;  4DR2 E;  2LUP B;  4AQY E;  2KON A;  1PKP A;  2V85 A;  4DR6 E;  1QU6 A;  5AE3 A;  3J7A G;  4X66 E;  2L3J A;  2FV4 B;  2VE7 C;  1IBK E;  4OX9 E;  4P78 A;  3ADL A;  1DI2 A;  1IBL E;  4X62 E;  4JYA E;  1YYK A;  2MC5 A;  4LF4 E;  1EKZ A;  1T4O A;  1GZ6 A;  2L8T A;  4M0V A;  3DF6 A;  3T1H E;  1J26 A;  2LRS A;  1FJG E;  2M1S A;  3HPZ A;  4LF7 E;  2DMY A;  4B3M E;  2KHX A;  3F6G A;  5ADZ A;  2B7T A;  1SR9 A;  1X49 A;  2B3T B;  4DV5 E;  4JI6 E;  4F9C B;  2F4V E;  2K4V A;  3P1X A;  2B7V A;  2V87 A;  2JR1 A;  2ODR D;  3AV0 A;  4F54 A;  4DV2 E;  4GKJ E;  4JI0 E;  4KHP E;  3AUZ A;  2ZM6 E;  3ADI A;  4OOG C;  4JI5 E;  4DV7 E;  2YT4 A;  3MSW A;  2NUG A;  2L2N A;  3JTZ A;  5AAS A;  3VK6 A;  4LF6 E;  1GQE A;  2RTX A;  4M2Z A;  2IHR 1;  4JV5 E;  4DV1 E;  3ZOQ B;  1FKA E;  1N36 E;  2N3G A;  4JI4 E;  2RSM A;  3FIG A;  3VYY A;  1YZ9 A;  2LE2 A;  5AE1 A;  2VQE E;  3HXL A;  1XMO E;  2L6M A;  2FTX B;  4DUY E;  2LMZ A;  2N3H A;  2DSY A;  4DR7 E;  4WYQ B;  4B3T E;  4YHH E;  3ADJ A;  5LMN E;  2UUA E;  5CFF E;  2NA2 A;  2UXC E;  4BC7 A;  4JI7 E;  2EWL A;  3LML A;  2LBS B;  3KWR A;  3IWC A;  4X64 E;  3IWD A;  1ZBT A;  3HPS A;  1XMQ E;  2L3C A;  4LFB E;  2JWO A;  3C4B A;  4DR3 E;  1T4N A;  2KOU A;  4F9A B;  4NXN E;  4JI2 E;  1I94 E;  2UXD E;  3C4T A;  2WZO A;  5BR8 E;  2E5L E;  4Q28 A;  2V89 A;  3JU0 A;  3DJW A;  4I8O A;  1IBM E;  1YYW A;  4L5N C;  3RMP A;  3OML A;  2M4I A;  4DMI A;  1N32 E;  2UXB E;  1UIL A;  2JOB A;  2ODR C;  1HNZ E;  5AE2 A;  2LTR A;  5T6J A;  1T4L B;  4DKK A;  2UUB E;  4X65 E;  4DR4 E;  4WPY A;  4LU9 A;  4R03 A;  4LF8 E;  2EZ6 A;  4GEQ B;  5LMU E;  2MDR A;  4YY3 E;  4F9B B;  5IWA E;  2JOX A;  2H36 X;  4L8N A;  2L2K B;  4DV0 E;  4LTY A;  1XNR E;  4DV6 E;  3HQ1 A;  4R8O A;  5DNY A;  5F3W A;  2V8Q B;  1YYO A;  2V88 A;  1O0W A;  4WSP A;  1UHZ A;  2JVA A;  2YZT A;  3JAM C;  4KZS A;  4BCA A;  2HHH E;  2LTS A;  2E1M A;  5A2Q C;  2LUQ A;  1STU A;  4LFC E;  1X48 A;  1WHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...