3JTZA

Structure of the arm-type binding domain of hpi integrase
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
SLTDAKIRTLKPSDKPFKVSDSHGLYLLVKPGGSRHWYLKYRISGKESRIALGAYPAISLSDARQQREGIRKMLALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Integrase
publication title Structures of the arm-type binding domains of HPI and HAI7 integrases
pubmed doi rcsb
source organism Yersinia pestis
total genus 20
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2009-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.390 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3jtzA00
3JTZA 3RMPA 3JU0A
chains in the Genus database with same CATH superfamily
3EPLA 2EM5A 2EPXA 3KZZA 4DR3E 5IV8B 4MLQA 1IBLE 5TSEA 2GPIA 2RSMA 4IS1C 2EN4A 1YSAC 4R2AA 2LBSB 3IWBA 4WFTA 5AC4A 4WYQB 1SR9A 2EN7A 2HC5A 2HHHE 2EOJA 1YPNA 4TUGA 1ZBTA 1YYOA 2M7QA 1IBKE 2EPKX 3EPHA 2L3CA 5A69A 3HPZA 4JI5E 2EQ1A 4GKJE 4X64E 1EH6A 2RPCA 4LF5E 2KONA 3ECRA 3VHTB 4WXDA 2F8BA 3BGHA 2EPMX 4WSGA 2V86A 2YTNA 3JTZA 2EPAA 4NZVA 1YYWA 2JWOA 2KOUA 2YU5A 1WHQA 4X66E 3THOB 3KWRA 1STUA 4NHRA 1WXRA 2EM0A 2ENAA 2EOOA 4KZSA 4DR5E 3VYYA 4F9CB 2EZ6A 1A1JA 1I94E 2YTEA 1RQ0A 2YTPA 3HPSA 1KJKA 1T39A 2YRMA 5F3WA 4LU9A 2UUBE 1J26A 3VK6A 1AH5A 3IWDA 3FIGA 4Q28A 1UHZA 4BC9A 1J5EE 4LF8E 2LE2A 2EMHA 5IWAE 2YRHA 2DRPA 1UBDC 1X49A 1MEYC 1YZ9A 1O0WA 5IXMB 2CSHA 2RQLA 4BC7A 3C4TA 2EM8A 2A25A 5A6BD 2JVAA 5A6KA 2VRDA 4DV4E 4R2EA 1IMUA 4R8OA 2EWLA 2EQ0A 2EPZA 2JY9A 4KHPE 4R2RA 4R2SA 2EMYA 2DB2A 1X6HA 2EPLX 4DMIA 1SFEA 4DR1E 2EMFA 4K0KE 3J80C 4B3ME 4I8OA 2LUPB 2EPOA 4WPYA 1GZ6A 2EM7A 2DMIA 3OTOE 1N34E 2M9AA 1EKZA 2YSPA 4DUYE 2WBSA 1X6EA 4BHCA 2EOHA 4HEIA 2JP9A 2ELYA 2BBGA 2ELZA 2RTXA 4Q35B 2NA2A 2JOXA 2EOIA 4GKKE 4F54A 5FLXC 2UXBE 4TUIA 2LTRA 3MSWA 2UXCE 4R2DA 2YTFA 2K4VA 1X6FA 2N3GA 1YUIA 1DGCA 1T38A 3MHHC 3TQMA 4IJDA 3LLHA 2FGGA 2EM3A 3J81C 1IQOA 4BBYA 2EN3A 2LCEA 4DV1E 5ADZA 2YPNA 2RS7A 4LFBE 5T6JA 2V85A 2F4VE 1A1IA 2EQ3A 5KL3A 4YHHE 1N33E 1FJGE 2VF1A 2EOXA 1ZU1A 2YTOA 4HTGA 1LLMC 1G2DC 4P7DA 3ADJA 2LV2A 1F2IG 2EM6A 4JI0E 5A6AA 2ENCA 3T1HE 2I9IA 4LFAE 1PJQA 4RH8A 5IT9C 2L8TA 3HQ1A 1ZR9A 2Q8UA 1YFHA 2EMXA 3BF2A 2MDGA 4O43A 1Z1BA 2YZTA 2L2NA 2YTQA 5AASA 1PDAA 1N3GA 4YY3E 2MC6A 5AE2A 2NABA 4GEQB 2ENHA 2DMYA 4F6NA 2YRKA 2MDRA 4F9BB 3DF6A 5LLQA 4M9VC 2EL4A 1X5WA 2EMCA 2JR1A 4ZYGA 4GZNC 4R2CA 2EN1A 4P78A 3OMLA 2J7JA 5KL4A 4DV6E 2L2KB 2EE8A 2EOEA 1PJTA 2EOQA 2EMAA 3F6GA 1X3CA 2YTGA 5A6JA 2JPAA 4WXCA 1QNTA 2LRSA 2NUGA 4DV3E 1BB8A 2LUQA 4DV5E 2WBTA 4WX9A 4LF7E 4LTYA 1NEIA 1DQ3A 3HTXA 2EOMA 2JOBA 2EP3A 4DR6E 1AAYA 1P47A 1EH7A 1TN9A 4JI3E 1MGTA 2HJJA 2LVHA 5CFFE 4ZYEA 2EM9A 5KL2A 3AUZA 5KL5A 1JK1A 2YWQA 2EMBA 2VQEE 2LT7A 2B7TA 3P1XA 5KL7A 3QG5C 4J8ZA 1X47A 2ODRC 2N3HA 2EPPA 3M99B 4DV2E 1EH8A 4DV7E 1JK2A 2E5LE 2L2MA 3F6HA 2ODRD 2MKNA 2FTXB 2NUEA 3KZYA 3C4BA 4DR4E 2EMWA 2VQFE 1ZBQA 1IBME 5AE3A 2LJHA 3BIDA 4RHBB 4JI7E 2IHR1 1XMQE 3IWCA 4ZYHA 4B3RE 2MC5A 2M1SA 2EORA 4DV0E 2KHXA 2L3JA 1A1KA 1B69A 2EJ4A 3VYXA 1A1GA 2WCC3 4JI1E 1BBOA 2D9HA 2R1FA 2B9DA 2MKDA 2FV4B 4X65E 2EMGA 4L5NC 1YYKA 1NCSA 4KWYA 2BB8A 4JI8E 1TF6A 4LF6E 2ZM6E 2E1MA 2EPCA 1GTKA 1PJSA 2L6MA 2M4IA 1KYQA 2H36X 1L4SA 1G2FC 1UN6B 3C6KA 1N36E 3J7AG 2LJUA 1FKAE 1YUJA 2V83A 2EMKA 1XMOE 2GLIA 1HR0E 2L92A 4X62E 3T1YE 1XNRE 4B3SE 2EPRA 4DKKA 4O24A 2B3TB 2EN6A 4N4RB 4BMJA 2UXDE 4O4KA 4JI2E 2YTJA 4M30A 2L33A 4O5GA 2YTIA 3BBGA 1HNXE 3C6MA 1PKPA 1T4LB 4BCAA 2EOFA 2UU9E 4NXME 2GHFA 1A1FA 1T4OA 4AQYE 1RC7A 2EPNA 4M0VA 1IQSA 4DR2E 2UUAE 4M2ZA 4LFCE 1WHNA 5LMUE 3LMLA 4ZYDA 1A1LA 2EN8A 5DNYA 1WRJA 4FK5C 2EMLA 1X48A 2WBUA 5LMNE 3JAMC 4X9JA 1TF3A 3JU0A 1BBGA 1A1HA 2EM4A 3EPJA 3RMPA 5BR8E 2ADRA 3ADGA 2I13A 2V89A 2EOYA 2CPNA 4LF9E 4F2JC 1ZAAC 3THNA 1DI2A 2R76A 5KL6A 2EL5A 3J7Yp 4OOGC 5AC5A 2RS6A 1UILA 2UUCE 1WJPA 4BS9A 4DUZE 5LL6R 4WSPA 2EL6A 4LF4E 2CTDA 4JV5E 3H09A 3K6QA 4L8NA 4R03A 2N8XA 2HGHA 2NUFA 4X8WA 5AE1A 2DIXA 2WZOA 2EN2A 2LTSA 1T4NA 4B3TE 3AV0A 3HXLA 2EPUA 3MHSC 3UK3C 4JYAE 2JXPA 4F6MA 2V88A 2EMZA 1GQEA 2DGCA 2EMIA 2YTDA 2YT4A 4DR7E 3DJWA 2B7VA 1HNWE 3L00A 2EM2A 2G7HA 1RMDA 2LMZA 2YSOA 5A2QC 4F9AB 4R2QA 4JI6E 4MLVA 2LO3A 2YU8A 4JI4E 2K7IA 2CT1A 2EOSA 2VE7C 2E72A 3ADIA 2JYAA 2DSYA 5A6BA 3ADLA 2EOZA 4BHBA 1N32E 2V87A 4R2PA 1QU6A 4NXNE 3ZOQB 2DLKA 2PRTA 1XNQE 1HNZE 2V8QB 2RSIA 4OX9E 3EPKA 3EQ1A 2DLQA
chains in the Genus database with same CATH topology
3HTXA 2DB2A 4DMIA 4DR1E 1HNXE 4K0KE 3J80C 1PKPA 4B3ME 4DR3E 4I8OA 2JOBA 1T4LB 4BCAA 2LUPB 4WPYA 1GZ6A 4DR6E 2UU9E 1IBLE 4NXME 3OTOE 2RSMA 4JI3E 1N34E 1T4OA 4AQYE 2LBSB 1RC7A 3IWBA 1EKZA 4M0VA 4WFTA 4DUYE 4DR2E 5CFFE 2UUAE 4M2ZA 4LFCE 4WYQB 1WHNA 5LMUE 1SR9A 3AUZA 3LMLA 2RTXA 2HHHE 2NA2A 5DNYA 2VQEE 4TUGA 1ZBTA 1X48A 2B7TA 2JOXA 3P1XA 2M7QA 4F54A 5LMNE 1YYOA 4GKKE 3JAMC 1IBKE 5FLXC 2UXBE 4J8ZA 1X47A 4TUIA 2LTRA 3JU0A 2ODRC 3MSWA 3HPZA 2L3CA 2N3HA 2UXCE 4JI5E 3RMPA 2K4VA 4DV2E 5BR8E 4GKJE 4X64E 2N3GA 3ADGA 4DV7E 2E5LE 2L2MA 3F6HA 4LF5E 2KONA 2ODRD 2V89A 2F8BA 2CPNA 2FTXB 3LLHA 4LF9E 3C4BA 2FGGA 2NUEA 4DR4E 1DI2A 2V86A 3J81C 3JTZA 4BBYA 3J7Yp 4OOGC 1YYWA 2VQFE 2JWOA 4DV1E 2RS6A 1ZBQA 5ADZA 1UILA 2KOUA 2LJHA 5AE3A 1IBME 2UUCE 4JI7E 2IHR1 4BS9A 4DUZE 3IWCA 1WHQA 5LL6R 2MC5A 4X66E 2M1SA 4WSPA 1XMQE 4B3RE 2RS7A 4LFBE 4DV0E 3KWRA 4LF4E 2KHXA 5T6JA 2L3JA 4JV5E 2V85A 3H09A 3K6QA 4L8NA 2F4VE 1STUA 4R03A 3VYXA 4YHHE 1N33E 1WXRA 1FJGE 2VF1A 4KZSA 2NUFA 4DR5E 4JI1E 4X8WA 4P7DA 5AE1A 3VYYA 3ADJA 2B9DA 2DIXA 2WZOA 4JI0E 4F9CB 2EZ6A 2FV4B 4X65E 3T1HE 2LTSA 1T4NA 4B3TE 3AV0A 3HXLA 1I94E 1RQ0A 4JYAE 4LFAE 4L5NC 5IT9C 2L8TA 3HPSA 3HQ1A 1YYKA 2V88A 4JI8E 1GQEA 4LF6E 5F3WA 2ZM6E 4LU9A 2UUBE 2E1MA 2YZTA 1J26A 2L2NA 3VK6A 5AASA 2L6MA 3IWDA 2YT4A 4DR7E 4YY3E 2MC6A 3FIGA 2M4IA 3DJWA 2H36X 2B7VA 4Q28A 5AE2A 1UHZA 4GEQB 4BC9A 2DMYA 1J5EE 4LF8E 1HNWE 2G7HA 5A2QC 2MDRA 2LMZA 4F9BB 3DF6A 2LE2A 4F9AB 4JI6E 5IWAE 1N36E 3J7AG 1X49A 1YZ9A 2JR1A 4JI4E 1O0WA 1FKAE 2VE7C 4P78A 3OMLA 2V83A 4DV6E 2L2KB 3ADIA 2DSYA 4BC7A 3C4TA 3ADLA 1XMOE 1HR0E 2L92A 4X62E 3T1YE 1XNRE 2JVAA 3F6GA 4B3SE 1N32E 2V87A 2NUGA 2LRSA 1QU6A 4DKKA 4NXNE 4DV3E 4DV4E 2B3TB 3ZOQB 2LUQA 4BMJA 2UXDE 4R8OA 2EWLA 4DV5E 4JI2E 1XNQE 1HNZE 2V8QB 2JY9A 4OX9E 4LF7E 4KHPE 4M30A 2L33A 4LTYA 1DQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JTZ A;  3RMP A;  3JU0 A; 
#chains in the Genus database with same CATH topology
 3EPL A;  2EM5 A;  2EPX A;  3KZZ A;  4DR3 E;  5IV8 B;  4MLQ A;  1IBL E;  5TSE A;  2GPI A;  2RSM A;  4IS1 C;  2EN4 A;  1YSA C;  4R2A A;  2LBS B;  3IWB A;  4WFT A;  5AC4 A;  4WYQ B;  1SR9 A;  2EN7 A;  2HC5 A;  2HHH E;  2EOJ A;  1YPN A;  4TUG A;  1ZBT A;  1YYO A;  2M7Q A;  1IBK E;  2EPK X;  3EPH A;  2L3C A;  5A69 A;  3HPZ A;  4JI5 E;  2EQ1 A;  4GKJ E;  4X64 E;  1EH6 A;  2RPC A;  4LF5 E;  2KON A;  3ECR A;  3VHT B;  4WXD A;  2F8B A;  3BGH A;  2EPM X;  4WSG A;  2V86 A;  2YTN A;  3JTZ A;  2EPA A;  4NZV A;  1YYW A;  2JWO A;  2KOU A;  2YU5 A;  1WHQ A;  4X66 E;  3THO B;  3KWR A;  1STU A;  4NHR A;  1WXR A;  2EM0 A;  2ENA A;  2EOO A;  4KZS A;  4DR5 E;  3VYY A;  4F9C B;  2EZ6 A;  1A1J A;  1I94 E;  2YTE A;  1RQ0 A;  2YTP A;  3HPS A;  1KJK A;  1T39 A;  2YRM A;  5F3W A;  4LU9 A;  2UUB E;  1J26 A;  3VK6 A;  1AH5 A;  3IWD A;  3FIG A;  4Q28 A;  1UHZ A;  4BC9 A;  1J5E E;  4LF8 E;  2LE2 A;  2EMH A;  5IWA E;  2YRH A;  2DRP A;  1UBD C;  1X49 A;  1MEY C;  1YZ9 A;  1O0W A;  5IXM B;  2CSH A;  2RQL A;  4BC7 A;  3C4T A;  2EM8 A;  2A25 A;  5A6B D;  2JVA A;  5A6K A;  2VRD A;  4DV4 E;  4R2E A;  1IMU A;  4R8O A;  2EWL A;  2EQ0 A;  2EPZ A;  2JY9 A;  4KHP E;  4R2R A;  4R2S A;  2EMY A;  2DB2 A;  1X6H A;  2EPL X;  4DMI A;  1SFE A;  4DR1 E;  2EMF A;  4K0K E;  3J80 C;  4B3M E;  4I8O A;  2LUP B;  2EPO A;  4WPY A;  1GZ6 A;  2EM7 A;  2DMI A;  3OTO E;  1N34 E;  2M9A A;  1EKZ A;  2YSP A;  4DUY E;  2WBS A;  1X6E A;  4BHC A;  2EOH A;  4HEI A;  2JP9 A;  2ELY A;  2BBG A;  2ELZ A;  2RTX A;  4Q35 B;  2NA2 A;  2JOX A;  2EOI A;  4GKK E;  4F54 A;  5FLX C;  2UXB E;  4TUI A;  2LTR A;  3MSW A;  2UXC E;  4R2D A;  2YTF A;  2K4V A;  1X6F A;  2N3G A;  1YUI A;  1DGC A;  1T38 A;  3MHH C;  3TQM A;  4IJD A;  3LLH A;  2FGG A;  2EM3 A;  3J81 C;  1IQO A;  4BBY A;  2EN3 A;  2LCE A;  4DV1 E;  5ADZ A;  2YPN A;  2RS7 A;  4LFB E;  5T6J A;  2V85 A;  2F4V E;  1A1I A;  2EQ3 A;  5KL3 A;  4YHH E;  1N33 E;  1FJG E;  2VF1 A;  2EOX A;  1ZU1 A;  2YTO A;  4HTG A;  1LLM C;  1G2D C;  4P7D A;  3ADJ A;  2LV2 A;  1F2I G;  2EM6 A;  4JI0 E;  5A6A A;  2ENC A;  3T1H E;  2I9I A;  4LFA E;  1PJQ A;  4RH8 A;  5IT9 C;  2L8T A;  3HQ1 A;  1ZR9 A;  2Q8U A;  1YFH A;  2EMX A;  3BF2 A;  2MDG A;  4O43 A;  1Z1B A;  2YZT A;  2L2N A;  2YTQ A;  5AAS A;  1PDA A;  1N3G A;  4YY3 E;  2MC6 A;  5AE2 A;  2NAB A;  4GEQ B;  2ENH A;  2DMY A;  4F6N A;  2YRK A;  2MDR A;  4F9B B;  3DF6 A;  5LLQ A;  4M9V C;  2EL4 A;  1X5W A;  2EMC A;  2JR1 A;  4ZYG A;  4GZN C;  4R2C A;  2EN1 A;  4P78 A;  3OML A;  2J7J A;  5KL4 A;  4DV6 E;  2L2K B;  2EE8 A;  2EOE A;  1PJT A;  2EOQ A;  2EMA A;  3F6G A;  1X3C A;  2YTG A;  5A6J A;  2JPA A;  4WXC A;  1QNT A;  2LRS A;  2NUG A;  4DV3 E;  1BB8 A;  2LUQ A;  4DV5 E;  2WBT A;  4WX9 A;  4LF7 E;  4LTY A;  1NEI A;  1DQ3 A;  3HTX A;  2EOM A;  2JOB A;  2EP3 A;  4DR6 E;  1AAY A;  1P47 A;  1EH7 A;  1TN9 A;  4JI3 E;  1MGT A;  2HJJ A;  2LVH A;  5CFF E;  4ZYE A;  2EM9 A;  5KL2 A;  3AUZ A;  5KL5 A;  1JK1 A;  2YWQ A;  2EMB A;  2VQE E;  2LT7 A;  2B7T A;  3P1X A;  5KL7 A;  3QG5 C;  4J8Z A;  1X47 A;  2ODR C;  2N3H A;  2EPP A;  3M99 B;  4DV2 E;  1EH8 A;  4DV7 E;  1JK2 A;  2E5L E;  2L2M A;  3F6H A;  2ODR D;  2MKN A;  2FTX B;  2NUE A;  3KZY A;  3C4B A;  4DR4 E;  2EMW A;  2VQF E;  1ZBQ A;  1IBM E;  5AE3 A;  2LJH A;  3BID A;  4RHB B;  4JI7 E;  2IHR 1;  1XMQ E;  3IWC A;  4ZYH A;  4B3R E;  2MC5 A;  2M1S A;  2EOR A;  4DV0 E;  2KHX A;  2L3J A;  1A1K A;  1B69 A;  2EJ4 A;  3VYX A;  1A1G A;  2WCC 3;  4JI1 E;  1BBO A;  2D9H A;  2R1F A;  2B9D A;  2MKD A;  2FV4 B;  4X65 E;  2EMG A;  4L5N C;  1YYK A;  1NCS A;  4KWY A;  2BB8 A;  4JI8 E;  1TF6 A;  4LF6 E;  2ZM6 E;  2E1M A;  2EPC A;  1GTK A;  1PJS A;  2L6M A;  2M4I A;  1KYQ A;  2H36 X;  1L4S A;  1G2F C;  1UN6 B;  3C6K A;  1N36 E;  3J7A G;  2LJU A;  1FKA E;  1YUJ A;  2V83 A;  2EMK A;  1XMO E;  2GLI A;  1HR0 E;  2L92 A;  4X62 E;  3T1Y E;  1XNR E;  4B3S E;  2EPR A;  4DKK A;  4O24 A;  2B3T B;  2EN6 A;  4N4R B;  4BMJ A;  2UXD E;  4O4K A;  4JI2 E;  2YTJ A;  4M30 A;  2L33 A;  4O5G A;  2YTI A;  3BBG A;  1HNX E;  3C6M A;  1PKP A;  1T4L B;  4BCA A;  2EOF A;  2UU9 E;  4NXM E;  2GHF A;  1A1F A;  1T4O A;  4AQY E;  1RC7 A;  2EPN A;  4M0V A;  1IQS A;  4DR2 E;  2UUA E;  4M2Z A;  4LFC E;  1WHN A;  5LMU E;  3LML A;  4ZYD A;  1A1L A;  2EN8 A;  5DNY A;  1WRJ A;  4FK5 C;  2EML A;  1X48 A;  2WBU A;  5LMN E;  3JAM C;  4X9J A;  1TF3 A;  3JU0 A;  1BBG A;  1A1H A;  2EM4 A;  3EPJ A;  3RMP A;  5BR8 E;  2ADR A;  3ADG A;  2I13 A;  2V89 A;  2EOY A;  2CPN A;  4LF9 E;  4F2J C;  1ZAA C;  3THN A;  1DI2 A;  2R76 A;  5KL6 A;  2EL5 A;  3J7Y p;  4OOG C;  5AC5 A;  2RS6 A;  1UIL A;  2UUC E;  1WJP A;  4BS9 A;  4DUZ E;  5LL6 R;  4WSP A;  2EL6 A;  4LF4 E;  2CTD A;  4JV5 E;  3H09 A;  3K6Q A;  4L8N A;  4R03 A;  2N8X A;  2HGH A;  2NUF A;  4X8W A;  5AE1 A;  2DIX A;  2WZO A;  2EN2 A;  2LTS A;  1T4N A;  4B3T E;  3AV0 A;  3HXL A;  2EPU A;  3MHS C;  3UK3 C;  4JYA E;  2JXP A;  4F6M A;  2V88 A;  2EMZ A;  1GQE A;  2DGC A;  2EMI A;  2YTD A;  2YT4 A;  4DR7 E;  3DJW A;  2B7V A;  1HNW E;  3L00 A;  2EM2 A;  2G7H A;  1RMD A;  2LMZ A;  2YSO A;  5A2Q C;  4F9A B;  4R2Q A;  4JI6 E;  4MLV A;  2LO3 A;  2YU8 A;  4JI4 E;  2K7I A;  2CT1 A;  2EOS A;  2VE7 C;  2E72 A;  3ADI A;  2JYA A;  2DSY A;  5A6B A;  3ADL A;  2EOZ A;  4BHB A;  1N32 E;  2V87 A;  4R2P A;  1QU6 A;  4NXN E;  3ZOQ B;  2DLK A;  2PRT A;  1XNQ E;  1HNZ E;  2V8Q B;  2RSI A;  4OX9 E;  3EPK A;  3EQ1 A;  2DLQ A; 
#chains in the Genus database with same CATH homology
 3HTX A;  2DB2 A;  4DMI A;  4DR1 E;  1HNX E;  4K0K E;  3J80 C;  1PKP A;  4B3M E;  4DR3 E;  4I8O A;  2JOB A;  1T4L B;  4BCA A;  2LUP B;  4WPY A;  1GZ6 A;  4DR6 E;  2UU9 E;  1IBL E;  4NXM E;  3OTO E;  2RSM A;  4JI3 E;  1N34 E;  1T4O A;  4AQY E;  2LBS B;  1RC7 A;  3IWB A;  1EKZ A;  4M0V A;  4WFT A;  4DUY E;  4DR2 E;  5CFF E;  2UUA E;  4M2Z A;  4LFC E;  4WYQ B;  1WHN A;  5LMU E;  1SR9 A;  3AUZ A;  3LML A;  2RTX A;  2HHH E;  2NA2 A;  5DNY A;  2VQE E;  4TUG A;  1ZBT A;  1X48 A;  2B7T A;  2JOX A;  3P1X A;  2M7Q A;  4F54 A;  5LMN E;  1YYO A;  4GKK E;  3JAM C;  1IBK E;  5FLX C;  2UXB E;  4J8Z A;  1X47 A;  4TUI A;  2LTR A;  3JU0 A;  2ODR C;  3MSW A;  3HPZ A;  2L3C A;  2N3H A;  2UXC E;  4JI5 E;  3RMP A;  2K4V A;  4DV2 E;  5BR8 E;  4GKJ E;  4X64 E;  2N3G A;  3ADG A;  4DV7 E;  2E5L E;  2L2M A;  3F6H A;  4LF5 E;  2KON A;  2ODR D;  2V89 A;  2F8B A;  2CPN A;  2FTX B;  3LLH A;  4LF9 E;  3C4B A;  2FGG A;  2NUE A;  4DR4 E;  1DI2 A;  2V86 A;  3J81 C;  3JTZ A;  4BBY A;  3J7Y p;  4OOG C;  1YYW A;  2VQF E;  2JWO A;  4DV1 E;  2RS6 A;  1ZBQ A;  5ADZ A;  1UIL A;  2KOU A;  2LJH A;  5AE3 A;  1IBM E;  2UUC E;  4JI7 E;  2IHR 1;  4BS9 A;  4DUZ E;  3IWC A;  1WHQ A;  5LL6 R;  2MC5 A;  4X66 E;  2M1S A;  4WSP A;  1XMQ E;  4B3R E;  2RS7 A;  4LFB E;  4DV0 E;  3KWR A;  4LF4 E;  2KHX A;  5T6J A;  2L3J A;  4JV5 E;  2V85 A;  3H09 A;  3K6Q A;  4L8N A;  2F4V E;  1STU A;  4R03 A;  3VYX A;  4YHH E;  1N33 E;  1WXR A;  1FJG E;  2VF1 A;  4KZS A;  2NUF A;  4DR5 E;  4JI1 E;  4X8W A;  4P7D A;  5AE1 A;  3VYY A;  3ADJ A;  2B9D A;  2DIX A;  2WZO A;  4JI0 E;  4F9C B;  2EZ6 A;  2FV4 B;  4X65 E;  3T1H E;  2LTS A;  1T4N A;  4B3T E;  3AV0 A;  3HXL A;  1I94 E;  1RQ0 A;  4JYA E;  4LFA E;  4L5N C;  5IT9 C;  2L8T A;  3HPS A;  3HQ1 A;  1YYK A;  2V88 A;  4JI8 E;  1GQE A;  4LF6 E;  5F3W A;  2ZM6 E;  4LU9 A;  2UUB E;  2E1M A;  2YZT A;  1J26 A;  2L2N A;  3VK6 A;  5AAS A;  2L6M A;  3IWD A;  2YT4 A;  4DR7 E;  4YY3 E;  2MC6 A;  3FIG A;  2M4I A;  3DJW A;  2H36 X;  2B7V A;  4Q28 A;  5AE2 A;  1UHZ A;  4GEQ B;  4BC9 A;  2DMY A;  1J5E E;  4LF8 E;  1HNW E;  2G7H A;  5A2Q C;  2MDR A;  2LMZ A;  4F9B B;  3DF6 A;  2LE2 A;  4F9A B;  4JI6 E;  5IWA E;  1N36 E;  3J7A G;  1X49 A;  1YZ9 A;  2JR1 A;  4JI4 E;  1O0W A;  1FKA E;  2VE7 C;  4P78 A;  3OML A;  2V83 A;  4DV6 E;  2L2K B;  3ADI A;  2DSY A;  4BC7 A;  3C4T A;  3ADL A;  1XMO E;  1HR0 E;  2L92 A;  4X62 E;  3T1Y E;  1XNR E;  2JVA A;  3F6G A;  4B3S E;  1N32 E;  2V87 A;  2NUG A;  2LRS A;  1QU6 A;  4DKK A;  4NXN E;  4DV3 E;  4DV4 E;  2B3T B;  3ZOQ B;  2LUQ A;  4BMJ A;  2UXD E;  4R8O A;  2EWL A;  4DV5 E;  4JI2 E;  1XNQ E;  1HNZ E;  2V8Q B;  2JY9 A;  4OX9 E;  4LF7 E;  4KHP E;  4M30 A;  2L33 A;  4LTY A;  1DQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...