3JTZA

Structure of the arm-type binding domain of hpi integrase
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
SLTDAKIRTLKPSDKPFKVSDSHGLYLLVKPGGSRHWYLKYRISGKESRIALGAYPAISLSDARQQREGIRKMLALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Structures of the arm-type binding domains of HPI and HAI7 integrases
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Dna binding protein
total genus 20
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2009-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.390 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3jtzA00
3JU0A 3JTZA 3RMPA
chains in the Genus database with same CATH superfamily
2EOMA 3J7Yp 2K7IA 5LL6R 2LO3A 5LMUE 4B3RE 2F4VE 2YZTA 3HQ1A 3THOB 3UK3C 3BGHA 2JOXA 3F6GA 2ENHA 4ZYHA 5DNYA 2EN6A 2YWQA 1X49A 2R76A 4DR3E 2VRDA 2LTSA 3IWDA 1YZ9A 4L8NA 4WPYA 4B3TE 2EPAA 3M99B 2YT4A 1MEYC 2UUAE 3L00A 4TUIA 1N3GA 2BBGA 2EMFA 5KL7A 2MDRA 2VQEE 4LFAE 1X47A 1WRJA 4KHPE 1A1KA 2HGHA 4F9AB 4ZYGA 1JK2A 2EPPA 4DV0E 2KONA 4WSPA 4WXCA 3VYYA 4N4RB 1IQOA 3ADLA 2ENCA 2EPXA 5A6KA 4MLQA 1KJKA 1BBGA 2DIXA 4O43A 1IBLE 2EMGA 5AE3A 2DB2A 2EOQA 2ADRA 2Q8UA 2DRPA 2RTXA 1X3CA 4DV4E 4LF4E 3KWRA 2EM0A 1SFEA 3FIGA 2LJUA 2DLQA 2EPMX 3MHSC 4DR1E 5A6BD 5KL5A 1JK1A 2RQLA 3EQ1A 2V83A 2EE8A 4RHBB 2WCC3 2JY9A 1A1FA 4LF6E 3P1XA 4KZSA 1UBDC 2LE2A 2CTDA 1NCSA 1GTKA 2RPCA 4LF7E 2EQ0A 1T4OA 2EM5A 2EM6A 2KHXA 3EPHA 5IWAE 2EM8A 4JI8E 1A1LA 1DQ3A 2WBSA 2H36X 2YPNA 5BR8E 3H09A 5LMNE 4LF9E 2M4IA 2LCEA 5A6AA 5FLXC 1YUIA 2UXCE 1X48A 3C6MA 1NEIA 5TSEA 4TUGA 1TF6A 2DMIA 4BS9A 4X9JA 2G7HA 4FK5C 4R2QA 4L5NC 4DKKA 2GPIA 3OTOE 4LFBE 1STUA 2EP3A 5AE2A 3BF2A 4YHHE 2YTOA 4M30A 1ZAAC 1IQSA 4P78A 2D9HA 5LLQA 2MKNA 2EN1A 4DV5E 4JYAE 2EPZA 1N34E 4DR6E 4R03A 2EMKA 1PJQA 2LBSB 4B3ME 1GZ6A 4R2SA 2EPCA 2YTQA 2NUGA 4JV5E 2L2MA 2MDGA 1FJGE 2EWLA 2HC5A 2YTPA 4R2RA 2EPOA 3ADIA 1HNXE 4OOGC 1PKPA 4O4KA 5A69A 4KWYA 5F3WA 2VF1A 2L6MA 4NXNE 1XMOE 2DSYA 1HNZE 4NXME 2A25A 2EOSA 2LVHA 4F9BB 5KL2A 1XMQE 2LRSA 3MSWA 2EN7A 1O0WA 2EMIA 2WBTA 1AH5A 2L3CA 4LF5E 1N33E 1ZBTA 3C6KA 1ZR9A 1YYWA 4R2DA 1YPNA 1EKZA 2HHHE 1X6EA 4DV2E 1B69A 2EOOA 4MLVA 2E5LE 2ELZA 4DUYE 4J8ZA 3EPLA 3TQMA 4ZYEA 2EMHA 2M1SA 5IXMB 2N3HA 4IS1C 4F6NA 3VK6A 1EH7A 2V89A 1XNRE 4M9VC 2LT7A 2YU8A 5IV8B 2LV2A 2EMBA 2ZM6E 4F6MA 1G2DC 3LMLA 2FGGA 3T1HE 2ODRC 3C4TA 4M2ZA 2R1FA 3AV0A 1TF3A 2YTGA 4JI1E 2YSPA 2EOFA 4AQYE 1I94E 1A1HA 3T1YE 1T4LB 1BB8A 4BBYA 4R2PA 5T6JA 4NHRA 2L8TA 2EORA 1J5EE 5AE1A 1UILA 2B7TA 2YTNA 1PJSA 3KZYA 5CFFE 4DV3E 4M0VA 2L3JA 3K6QA 2M7QA 4X66E 4JI4E 4GKJE 2EMLA 2I9IA 4LFCE 2EN8A 4WSGA 3J80C 4BMJA 2EMCA 2JP9A 4WFTA 2L92A 3IWCA 1J26A 1ZU1A 2YTEA 2EMAA 4BC9A 2EN4A 1UHZA 2UXDE 3VYXA 2NUFA 2MC5A 2EPNA 2EM4A 4DUZE 1P47A 4YY3E 4F54A 2YTJA 1LLMC 2L2KB 2I13A 1QNTA 2F8BA 3C4BA 4OX9E 1T4NA 2CPNA 1YUJA 4LF8E 3QG5C 1T38A 2EPRA 2EOZA 5AC5A 4X62E 4GEQB 4R2CA 2UUCE 3IWBA 1A1GA 2LUPB 2JVAA 2K4VA 2DGCA 2V88A 4X64E 5IT9C 2MKDA 4BHBA 2YSOA 2YTFA 2RSMA 5KL6A 3ECRA 2N8XA 1UN6B 4K0KE 1EH8A 1SR9A 2JPAA 3JTZA 4R2AA 2IHR1 2ELYA 1YYKA 2YRMA 5A6JA 2RS6A 1PJTA 2E72A 2WZOA 2VQFE 2LMZA 2NABA 4Q35B 4R8OA 4P7DA 3J81C 4NZVA 1FKAE 1XNQE 2EPUA 4B3SE 2EPLX 4R2EA 1Z1BA 3HPSA 4HTGA 3RMPA 5A2QC 1A1JA 2V85A 1A1IA 5AASA 1N36E 2EPKX 4WYQB 4HEIA 3KZZA 2NA2A 4JI0E 2V8QB 2EMWA 2JOBA 4IJDA 5AC4A 1N32E 3ZOQB 4BHCA 3AUZA 4O5GA 2EL5A 4DR2E 1KYQA 2EJ4A 2EL4A 4X8WA 2CSHA 1HR0E 2YRHA 2UXBE 4WXDA 3LLHA 4BCAA 1WJPA 2GLIA 2B3TB 2EOHA 4WX9A 1RMDA 4GKKE 4GZNC 3HPZA 2LUQA 3J7AG 2YU5A 3DJWA 4JI3E 2V86A 2MC6A 2UU9E 1IBKE 2JWOA 4BC7A 1BBOA 1MGTA 4DR5E 3BBGA 3THNA 4DR4E 2KOUA 2UUBE 1WHQA 3HXLA 4DV7E 3JAMC 2EL6A 2YRKA 2EMYA 2FV4B 4DV1E 2EM3A 1YSAC 2EN3A 1WHNA 2EMZA 4RH8A 1L4SA 2EQ3A 2EOYA 5KL4A 2ENAA 1X5WA 2B9DA 1F2IG 2GHFA 1DI2A 4DR7E 3F6HA 2J7JA 2JXPA 3HTXA 3JU0A 4O24A 2HJJA 1RC7A 2M9AA 3ADJA 2EM9A 2YTDA 1X6HA 2EQ1A 3BIDA 1IBME 2E1MA 1X6FA 1PDAA 3VHTB 2PRTA 2EOEA 4ZYDA 1HNWE 4Q28A 4DV6E 4LTYA 2CT1A 2DLKA 5A6BA 2EZ6A 4I8OA 5ADZA 4F2JC 2B7VA 3ADGA 2EOXA 2L2NA 4JI5E 5KL3A 3MHHC 2YTIA 2NUEA 2RS7A 1EH6A 2JYAA 1YYOA 2LTRA 1AAYA 2WBUA 3OMLA 1TN9A 4JI7E 2FTXB 2DMYA 1IMUA 2L33A 2ODRD 1T39A 2EOIA 1G2FC 2N3GA 1GQEA 2BB8A 4JI6E 3EPKA 3EPJA 2EM2A 2JR1A 2EOJA 2V87A 2EM7A 4F9CB 1WXRA 1RQ0A 1YFHA 4DMIA 4JI2E 2EN2A 3DF6A 1ZBQA 2RSIA 4LU9A 2VE7C 1QU6A 1DGCA 4X65E 2LJHA 2EMXA
chains in the Genus database with same CATH topology
2UU9E 1IBKE 5AE2A 4BMJA 4YHHE 4M30A 3J7Yp 2JWOA 5LL6R 4WFTA 4BC7A 5LMUE 4B3RE 2F4VE 2L92A 2YZTA 4P78A 3HQ1A 4DR5E 3IWCA 3F6GA 2JOXA 1J26A 5DNYA 4DR3E 1X49A 2KOUA 4BC9A 4DV5E 1UHZA 1WHQA 3HXLA 2UUBE 4DR4E 4JYAE 2UXDE 4DV7E 2NUFA 2MC5A 3VYXA 1N34E 3JAMC 2LTSA 4DR6E 3IWDA 4R03A 4DUZE 4L8NA 1YZ9A 4WPYA 4B3TE 2LBSB 4YY3E 4B3ME 1GZ6A 2YT4A 4F54A 2FV4B 4DV1E 2UUAE 2L2KB 2NUGA 4JV5E 2F8BA 4TUIA 2L2MA 1FJGE 2EWLA 2MDRA 2VQEE 1WHNA 4LFAE 1X47A 3C4BA 4OX9E 3ADIA 1T4NA 2CPNA 1HNXE 4KHPE 4F9AB 4OOGC 1PKPA 4LF8E 2B9DA 5F3WA 4DV0E 2VF1A 1DI2A 2KONA 4WSPA 4X62E 2L6MA 4NXNE 4DR7E 3F6HA 1XMOE 4GEQB 3VYYA 2DSYA 1HNZE 2UUCE 3IWBA 4NXME 2LUPB 2JVAA 3HTXA 2K4VA 3JU0A 3ADLA 2V88A 4X64E 5IT9C 1RC7A 3ADJA 4F9BB 1IBME 1XMQE 2DIXA 2LRSA 2RSMA 1IBLE 3MSWA 1O0WA 2E1MA 5AE3A 2L3CA 4K0KE 4LF5E 2DB2A 1SR9A 1N33E 1YYKA 3JTZA 1ZBTA 2IHR1 1YYWA 1EKZA 2RS6A 2RTXA 2WZOA 2VQFE 4DV4E 1HNWE 2LMZA 4LF4E 3KWRA 4Q28A 4R8OA 3FIGA 4P7DA 3J81C 4DV2E 4DV6E 4LTYA 4DR1E 1FKAE 1XNQE 2E5LE 2EZ6A 4DUYE 4I8OA 4J8ZA 5ADZA 4B3SE 2B7VA 3ADGA 2V83A 4LFCE 2JY9A 2L2NA 4JI5E 2M1SA 3HPSA 3RMPA 5A2QC 4LF6E 2N3HA 3VK6A 2V85A 3P1XA 4KZSA 2NUEA 2RS7A 5AASA 2V89A 2LE2A 1N36E 1YYOA 1XNRE 2LTRA 4WYQB 4LF7E 1T4OA 3OMLA 2KHXA 2NA2A 4JI7E 4JI0E 2ZM6E 2FTXB 2V8QB 2DMYA 5IWAE 3LMLA 2FGGA 2L33A 2ODRD 3T1HE 4GKKE 4JI8E 2ODRC 3C4TA 4M2ZA 2JOBA 2N3GA 3AV0A 4JI1E 1N32E 1DQ3A 3ZOQB 1GQEA 2H36X 4AQYE 1I94E 3T1YE 4JI6E 3AUZA 5BR8E 3H09A 1T4LB 5LMNE 4BBYA 4LF9E 4DR2E 2M4IA 5T6JA 2JR1A 2V87A 4X8WA 5FLXC 2L8TA 4F9CB 2UXCE 1WXRA 1RQ0A 1HR0E 1X48A 1J5EE 5AE1A 2UXBE 4DMIA 4TUGA 3LLHA 4DV3E 4JI2E 4BCAA 1UILA 1ZBQA 2B3TB 2B7TA 3DF6A 4BS9A 4LU9A 2G7HA 2VE7C 5CFFE 1QU6A 4M0VA 4L5NC 3K6QA 2M7QA 4DKKA 4X66E 4X65E 2L3JA 3OTOE 4JI4E 4GKJE 3J7AG 3HPZA 2LUQA 4LFBE 1STUA 2LJHA 2V86A 3DJWA 4JI3E 2MC6A 3J80C 2HHHE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JU0 A;  3JTZ A;  3RMP A; 
#chains in the Genus database with same CATH topology
 2EOM A;  3J7Y p;  2K7I A;  5LL6 R;  2LO3 A;  5LMU E;  4B3R E;  2F4V E;  2YZT A;  3HQ1 A;  3THO B;  3UK3 C;  3BGH A;  2JOX A;  3F6G A;  2ENH A;  4ZYH A;  5DNY A;  2EN6 A;  2YWQ A;  1X49 A;  2R76 A;  4DR3 E;  2VRD A;  2LTS A;  3IWD A;  1YZ9 A;  4L8N A;  4WPY A;  4B3T E;  2EPA A;  3M99 B;  2YT4 A;  1MEY C;  2UUA E;  3L00 A;  4TUI A;  1N3G A;  2BBG A;  2EMF A;  5KL7 A;  2MDR A;  2VQE E;  4LFA E;  1X47 A;  1WRJ A;  4KHP E;  1A1K A;  2HGH A;  4F9A B;  4ZYG A;  1JK2 A;  2EPP A;  4DV0 E;  2KON A;  4WSP A;  4WXC A;  3VYY A;  4N4R B;  1IQO A;  3ADL A;  2ENC A;  2EPX A;  5A6K A;  4MLQ A;  1KJK A;  1BBG A;  2DIX A;  4O43 A;  1IBL E;  2EMG A;  5AE3 A;  2DB2 A;  2EOQ A;  2ADR A;  2Q8U A;  2DRP A;  2RTX A;  1X3C A;  4DV4 E;  4LF4 E;  3KWR A;  2EM0 A;  1SFE A;  3FIG A;  2LJU A;  2DLQ A;  2EPM X;  3MHS C;  4DR1 E;  5A6B D;  5KL5 A;  1JK1 A;  2RQL A;  3EQ1 A;  2V83 A;  2EE8 A;  4RHB B;  2WCC 3;  2JY9 A;  1A1F A;  4LF6 E;  3P1X A;  4KZS A;  1UBD C;  2LE2 A;  2CTD A;  1NCS A;  1GTK A;  2RPC A;  4LF7 E;  2EQ0 A;  1T4O A;  2EM5 A;  2EM6 A;  2KHX A;  3EPH A;  5IWA E;  2EM8 A;  4JI8 E;  1A1L A;  1DQ3 A;  2WBS A;  2H36 X;  2YPN A;  5BR8 E;  3H09 A;  5LMN E;  4LF9 E;  2M4I A;  2LCE A;  5A6A A;  5FLX C;  1YUI A;  2UXC E;  1X48 A;  3C6M A;  1NEI A;  5TSE A;  4TUG A;  1TF6 A;  2DMI A;  4BS9 A;  4X9J A;  2G7H A;  4FK5 C;  4R2Q A;  4L5N C;  4DKK A;  2GPI A;  3OTO E;  4LFB E;  1STU A;  2EP3 A;  5AE2 A;  3BF2 A;  4YHH E;  2YTO A;  4M30 A;  1ZAA C;  1IQS A;  4P78 A;  2D9H A;  5LLQ A;  2MKN A;  2EN1 A;  4DV5 E;  4JYA E;  2EPZ A;  1N34 E;  4DR6 E;  4R03 A;  2EMK A;  1PJQ A;  2LBS B;  4B3M E;  1GZ6 A;  4R2S A;  2EPC A;  2YTQ A;  2NUG A;  4JV5 E;  2L2M A;  2MDG A;  1FJG E;  2EWL A;  2HC5 A;  2YTP A;  4R2R A;  2EPO A;  3ADI A;  1HNX E;  4OOG C;  1PKP A;  4O4K A;  5A69 A;  4KWY A;  5F3W A;  2VF1 A;  2L6M A;  4NXN E;  1XMO E;  2DSY A;  1HNZ E;  4NXM E;  2A25 A;  2EOS A;  2LVH A;  4F9B B;  5KL2 A;  1XMQ E;  2LRS A;  3MSW A;  2EN7 A;  1O0W A;  2EMI A;  2WBT A;  1AH5 A;  2L3C A;  4LF5 E;  1N33 E;  1ZBT A;  3C6K A;  1ZR9 A;  1YYW A;  4R2D A;  1YPN A;  1EKZ A;  2HHH E;  1X6E A;  4DV2 E;  1B69 A;  2EOO A;  4MLV A;  2E5L E;  2ELZ A;  4DUY E;  4J8Z A;  3EPL A;  3TQM A;  4ZYE A;  2EMH A;  2M1S A;  5IXM B;  2N3H A;  4IS1 C;  4F6N A;  3VK6 A;  1EH7 A;  2V89 A;  1XNR E;  4M9V C;  2LT7 A;  2YU8 A;  5IV8 B;  2LV2 A;  2EMB A;  2ZM6 E;  4F6M A;  1G2D C;  3LML A;  2FGG A;  3T1H E;  2ODR C;  3C4T A;  4M2Z A;  2R1F A;  3AV0 A;  1TF3 A;  2YTG A;  4JI1 E;  2YSP A;  2EOF A;  4AQY E;  1I94 E;  1A1H A;  3T1Y E;  1T4L B;  1BB8 A;  4BBY A;  4R2P A;  5T6J A;  4NHR A;  2L8T A;  2EOR A;  1J5E E;  5AE1 A;  1UIL A;  2B7T A;  2YTN A;  1PJS A;  3KZY A;  5CFF E;  4DV3 E;  4M0V A;  2L3J A;  3K6Q A;  2M7Q A;  4X66 E;  4JI4 E;  4GKJ E;  2EML A;  2I9I A;  4LFC E;  2EN8 A;  4WSG A;  3J80 C;  4BMJ A;  2EMC A;  2JP9 A;  4WFT A;  2L92 A;  3IWC A;  1J26 A;  1ZU1 A;  2YTE A;  2EMA A;  4BC9 A;  2EN4 A;  1UHZ A;  2UXD E;  3VYX A;  2NUF A;  2MC5 A;  2EPN A;  2EM4 A;  4DUZ E;  1P47 A;  4YY3 E;  4F54 A;  2YTJ A;  1LLM C;  2L2K B;  2I13 A;  1QNT A;  2F8B A;  3C4B A;  4OX9 E;  1T4N A;  2CPN A;  1YUJ A;  4LF8 E;  3QG5 C;  1T38 A;  2EPR A;  2EOZ A;  5AC5 A;  4X62 E;  4GEQ B;  4R2C A;  2UUC E;  3IWB A;  1A1G A;  2LUP B;  2JVA A;  2K4V A;  2DGC A;  2V88 A;  4X64 E;  5IT9 C;  2MKD A;  4BHB A;  2YSO A;  2YTF A;  2RSM A;  5KL6 A;  3ECR A;  2N8X A;  1UN6 B;  4K0K E;  1EH8 A;  1SR9 A;  2JPA A;  3JTZ A;  4R2A A;  2IHR 1;  2ELY A;  1YYK A;  2YRM A;  5A6J A;  2RS6 A;  1PJT A;  2E72 A;  2WZO A;  2VQF E;  2LMZ A;  2NAB A;  4Q35 B;  4R8O A;  4P7D A;  3J81 C;  4NZV A;  1FKA E;  1XNQ E;  2EPU A;  4B3S E;  2EPL X;  4R2E A;  1Z1B A;  3HPS A;  4HTG A;  3RMP A;  5A2Q C;  1A1J A;  2V85 A;  1A1I A;  5AAS A;  1N36 E;  2EPK X;  4WYQ B;  4HEI A;  3KZZ A;  2NA2 A;  4JI0 E;  2V8Q B;  2EMW A;  2JOB A;  4IJD A;  5AC4 A;  1N32 E;  3ZOQ B;  4BHC A;  3AUZ A;  4O5G A;  2EL5 A;  4DR2 E;  1KYQ A;  2EJ4 A;  2EL4 A;  4X8W A;  2CSH A;  1HR0 E;  2YRH A;  2UXB E;  4WXD A;  3LLH A;  4BCA A;  1WJP A;  2GLI A;  2B3T B;  2EOH A;  4WX9 A;  1RMD A;  4GKK E;  4GZN C;  3HPZ A;  2LUQ A;  3J7A G;  2YU5 A;  3DJW A;  4JI3 E;  2V86 A;  2MC6 A;  2UU9 E;  1IBK E;  2JWO A;  4BC7 A;  1BBO A;  1MGT A;  4DR5 E;  3BBG A;  3THN A;  4DR4 E;  2KOU A;  2UUB E;  1WHQ A;  3HXL A;  4DV7 E;  3JAM C;  2EL6 A;  2YRK A;  2EMY A;  2FV4 B;  4DV1 E;  2EM3 A;  1YSA C;  2EN3 A;  1WHN A;  2EMZ A;  4RH8 A;  1L4S A;  2EQ3 A;  2EOY A;  5KL4 A;  2ENA A;  1X5W A;  2B9D A;  1F2I G;  2GHF A;  1DI2 A;  4DR7 E;  3F6H A;  2J7J A;  2JXP A;  3HTX A;  3JU0 A;  4O24 A;  2HJJ A;  1RC7 A;  2M9A A;  3ADJ A;  2EM9 A;  2YTD A;  1X6H A;  2EQ1 A;  3BID A;  1IBM E;  2E1M A;  1X6F A;  1PDA A;  3VHT B;  2PRT A;  2EOE A;  4ZYD A;  1HNW E;  4Q28 A;  4DV6 E;  4LTY A;  2CT1 A;  2DLK A;  5A6B A;  2EZ6 A;  4I8O A;  5ADZ A;  4F2J C;  2B7V A;  3ADG A;  2EOX A;  2L2N A;  4JI5 E;  5KL3 A;  3MHH C;  2YTI A;  2NUE A;  2RS7 A;  1EH6 A;  2JYA A;  1YYO A;  2LTR A;  1AAY A;  2WBU A;  3OML A;  1TN9 A;  4JI7 E;  2FTX B;  2DMY A;  1IMU A;  2L33 A;  2ODR D;  1T39 A;  2EOI A;  1G2F C;  2N3G A;  1GQE A;  2BB8 A;  4JI6 E;  3EPK A;  3EPJ A;  2EM2 A;  2JR1 A;  2EOJ A;  2V87 A;  2EM7 A;  4F9C B;  1WXR A;  1RQ0 A;  1YFH A;  4DMI A;  4JI2 E;  2EN2 A;  3DF6 A;  1ZBQ A;  2RSI A;  4LU9 A;  2VE7 C;  1QU6 A;  1DGC A;  4X65 E;  2LJH A;  2EMX A; 
#chains in the Genus database with same CATH homology
 2UU9 E;  1IBK E;  5AE2 A;  4BMJ A;  4YHH E;  4M30 A;  3J7Y p;  2JWO A;  5LL6 R;  4WFT A;  4BC7 A;  5LMU E;  4B3R E;  2F4V E;  2L92 A;  2YZT A;  4P78 A;  3HQ1 A;  4DR5 E;  3IWC A;  3F6G A;  2JOX A;  1J26 A;  5DNY A;  4DR3 E;  1X49 A;  2KOU A;  4BC9 A;  4DV5 E;  1UHZ A;  1WHQ A;  3HXL A;  2UUB E;  4DR4 E;  4JYA E;  2UXD E;  4DV7 E;  2NUF A;  2MC5 A;  3VYX A;  1N34 E;  3JAM C;  2LTS A;  4DR6 E;  3IWD A;  4R03 A;  4DUZ E;  4L8N A;  1YZ9 A;  4WPY A;  4B3T E;  2LBS B;  4YY3 E;  4B3M E;  1GZ6 A;  2YT4 A;  4F54 A;  2FV4 B;  4DV1 E;  2UUA E;  2L2K B;  2NUG A;  4JV5 E;  2F8B A;  4TUI A;  2L2M A;  1FJG E;  2EWL A;  2MDR A;  2VQE E;  1WHN A;  4LFA E;  1X47 A;  3C4B A;  4OX9 E;  3ADI A;  1T4N A;  2CPN A;  1HNX E;  4KHP E;  4F9A B;  4OOG C;  1PKP A;  4LF8 E;  2B9D A;  5F3W A;  4DV0 E;  2VF1 A;  1DI2 A;  2KON A;  4WSP A;  4X62 E;  2L6M A;  4NXN E;  4DR7 E;  3F6H A;  1XMO E;  4GEQ B;  3VYY A;  2DSY A;  1HNZ E;  2UUC E;  3IWB A;  4NXM E;  2LUP B;  2JVA A;  3HTX A;  2K4V A;  3JU0 A;  3ADL A;  2V88 A;  4X64 E;  5IT9 C;  1RC7 A;  3ADJ A;  4F9B B;  1IBM E;  1XMQ E;  2DIX A;  2LRS A;  2RSM A;  1IBL E;  3MSW A;  1O0W A;  2E1M A;  5AE3 A;  2L3C A;  4K0K E;  4LF5 E;  2DB2 A;  1SR9 A;  1N33 E;  1YYK A;  3JTZ A;  1ZBT A;  2IHR 1;  1YYW A;  1EKZ A;  2RS6 A;  2RTX A;  2WZO A;  2VQF E;  4DV4 E;  1HNW E;  2LMZ A;  4LF4 E;  3KWR A;  4Q28 A;  4R8O A;  3FIG A;  4P7D A;  3J81 C;  4DV2 E;  4DV6 E;  4LTY A;  4DR1 E;  1FKA E;  1XNQ E;  2E5L E;  2EZ6 A;  4DUY E;  4I8O A;  4J8Z A;  5ADZ A;  4B3S E;  2B7V A;  3ADG A;  2V83 A;  4LFC E;  2JY9 A;  2L2N A;  4JI5 E;  2M1S A;  3HPS A;  3RMP A;  5A2Q C;  4LF6 E;  2N3H A;  3VK6 A;  2V85 A;  3P1X A;  4KZS A;  2NUE A;  2RS7 A;  5AAS A;  2V89 A;  2LE2 A;  1N36 E;  1YYO A;  1XNR E;  2LTR A;  4WYQ B;  4LF7 E;  1T4O A;  3OML A;  2KHX A;  2NA2 A;  4JI7 E;  4JI0 E;  2ZM6 E;  2FTX B;  2V8Q B;  2DMY A;  5IWA E;  3LML A;  2FGG A;  2L33 A;  2ODR D;  3T1H E;  4GKK E;  4JI8 E;  2ODR C;  3C4T A;  4M2Z A;  2JOB A;  2N3G A;  3AV0 A;  4JI1 E;  1N32 E;  1DQ3 A;  3ZOQ B;  1GQE A;  2H36 X;  4AQY E;  1I94 E;  3T1Y E;  4JI6 E;  3AUZ A;  5BR8 E;  3H09 A;  1T4L B;  5LMN E;  4BBY A;  4LF9 E;  4DR2 E;  2M4I A;  5T6J A;  2JR1 A;  2V87 A;  4X8W A;  5FLX C;  2L8T A;  4F9C B;  2UXC E;  1WXR A;  1RQ0 A;  1HR0 E;  1X48 A;  1J5E E;  5AE1 A;  2UXB E;  4DMI A;  4TUG A;  3LLH A;  4DV3 E;  4JI2 E;  4BCA A;  1UIL A;  1ZBQ A;  2B3T B;  2B7T A;  3DF6 A;  4BS9 A;  4LU9 A;  2G7H A;  2VE7 C;  5CFF E;  1QU6 A;  4M0V A;  4L5N C;  3K6Q A;  2M7Q A;  4DKK A;  4X66 E;  4X65 E;  2L3J A;  3OTO E;  4JI4 E;  4GKJ E;  3J7A G;  3HPZ A;  2LUQ A;  4LFB E;  1STU A;  2LJH A;  2V86 A;  3DJW A;  4JI3 E;  2MC6 A;  3J80 C;  2HHH E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...