3JTZA

Structure of the arm-type binding domain of hpi integrase
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
b'SLTDAKIRTLKPSDKPFKVSDSHGLYLLVKPGGSRHWYLKYRISGKESRIALGAYPAISLSDARQQREGIRKMLALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Structures of the arm-type binding domains of HPI and HAI7 integrases
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Dna binding protein
total genus 20
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2009-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.390 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3jtzA00
3JTZA 3RMPA 3JU0A
chains in the Genus database with same CATH superfamily
2BB8A 4DV3E 4LFAE 2LMZA 2MKNA 1YFHA 4DR4E 2EL4A 2EM2A 4WYQB 4B3SE 2LT7A 2EWLA 2K7IA 3MHHC 2EMWA 3AV0A 4R2QA 2HJJA 2NA2A 2EOFA 4WPYA 4DMIA 4ZYGA 4WXCA 3C6KA 4P78A 5CFFE 2V85A 2EMIA 3H09A 4JI1E 4DR5E 1WJPA 2DLKA 3P1XA 2EE8A 2EM4A 1N34E 1ZU1A 4ZYDA 2GHFA 1YSAC 4DKKA 4JI5E 3LLHA 2EQ1A 2NABA 2CTDA 1STUA 2K4VA 5A6BA 2UXCE 4F9CB 5KL7A 4M2ZA 2DIXA 2EMBA 4X62E 5LL6R 2L8TA 4O43A 1FKAE 5BR8E 3EPKA 4MLVA 1DGCA 5A6AA 2EMKA 3VK6A 2GLIA 2UUAE 3LMLA 1PJTA 1EH6A 1MGTA 1N36E 2MKDA 4JI0E 2DMIA 2CSHA 4JI8E 4KWYA 5KL3A 3BIDA 1A1FA 2JWOA 3J81C 2KOUA 1EH8A 4L8NA 4DR3E 1XNRE 3M99B 3JAMC 5AE2A 1TF3A 2EPMX 1UHZA 1LLMC 4O24A 1EH7A 3BGHA 2L2MA 3MSWA 3QG5C 2VRDA 2BBGA 2EOHA 2VQEE 1IQOA 2JY9A 3J80C 4B3ME 2EM6A 4IJDA 2V88A 1YPNA 2UXDE 2LE2A 3VYYA 2UUBE 3F6GA 3TQMA 3ADIA 5FLXC 4F2JC 2EMGA 1T39A 2L3CA 4JI7E 2ENAA 2ZM6E 4LFBE 2EOOA 1T38A 1YUIA 2V89A 4KZSA 1BB8A 2EMFA 4N4RB 4ZYHA 4BHCA 1T4NA 3J7Yp 2E72A 5IXMB 2EL6A 1TN9A 4X9JA 1SFEA 3ADJA 2EMXA 2FTXB 1KJKA 4LF5E 1PDAA 2EMAA 2LCEA 2EM9A 2EP3A 1G2DC 2G7HA 3IWCA 1IBME 4HTGA 2LBSB 4J8ZA 2JOXA 4R03A 3ADGA 2DMYA 4FK5C 4GKKE 1GQEA 2EORA 4R2SA 4GEQB 2LO3A 3ZOQB 1X49A 2LJUA 2NUGA 1IBKE 4DV5E 1IQSA 1WHQA 2YPNA 1YYWA 2EPOA 2JYAA 1WXRA 4GZNC 2LTRA 2EMHA 3IWDA 2EMZA 4DV1E 4NXME 3KZYA 5KL2A 1RMDA 2D9HA 2DLQA 2EPPA 1F2IG 1WHNA 1NEIA 2EZ6A 2EOEA 2MDGA 4IS1C 2EPNA 5TSEA 3HXLA 2EQ3A 1HNXE 2UU9E 5A2QC 2EM8A 4NHRA 4M0VA 1A1IA 4R2EA 4LF8E 4B3RE 2LTSA 4O5GA 4YY3E 5A6BD 4BBYA 5KL4A 1IBLE 2YTGA 3J7AG 4WFTA 3RMPA 4WX9A 2PRTA 2JOBA 4X8WA 4DV2E 4LF7E 5A69A 4I8OA 2RPCA 4TUIA 3IWBA 4LFCE 1RQ0A 2EM3A 2LUPB 2JPAA 2DB2A 2M4IA 1QNTA 1ZR9A 4JV5E 3UK3C 3F6HA 2R76A 5DNYA 2IHR1 4DR2E 4M30A 1X47A 1X6EA 2EOJA 2RQLA 4DV7E 2ELYA 3VYXA 2EPUA 3T1YE 2EOIA 4WSGA 2EMCA 5T6JA 5A6KA 1HNWE 2YTQA 4O4KA 2V8QB 2EN4A 1N3GA 1YUJA 1X48A 2LVHA 3EPJA 3EPLA 1X6FA 2JR1A 4HEIA 2EN1A 4LU9A 2FGGA 3OMLA 2RS7A 3EPHA 2N3HA 3ADLA 1ZBQA 4F6NA 2YRKA 4JI2E 3HQ1A 2YT4A 2EM7A 1X6HA 2YRHA 2EOYA 2WBSA 2E5LE 2EM5A 2YZTA 2CT1A 1N32E 2EPRA 2WBTA 2I13A 4F6MA 4WSPA 1JK2A 4LTYA 1O0WA 2VQFE 4DR7E 1I94E 2UXBE 2R1FA 5LMNE 1TF6A 2WBUA 2B7VA 5KL6A 4OX9E 2EQ0A 1PKPA 2EPLX 3JTZA 5AE1A 4DR1E 4BCAA 3K6QA 1MEYC 5AASA 2JP9A 2EMYA 1KYQA 2EOQA 4JYAE 2KHXA 4R2CA 1A1HA 2HC5A 2Q8UA 4ZYEA 4OOGC 4LF4E 1B69A 3KZZA 4R2AA 2RSIA 2FV4B 4R2RA 2ODRD 2JXPA 4TUGA 2L6MA 2A25A 2CPNA 2YRMA 1BBGA 1J26A 2YTNA 2B7TA 5F3WA 4JI6E 1A1GA 1NCSA 1UBDC 4BC7A 2V86A 2M9AA 2EN3A 3OTOE 4JI4E 2I9IA 1PJQA 4M9VC 2EL5A 2LJHA 1Z1BA 2L2NA 2YTOA 4DUZE 4B3TE 2RS6A 2E1MA 1A1JA 1T4LB 2B9DA 4WXDA 5AC5A 5A6JA 2YWQA 2RTXA 3KWRA 4MLQA 1DI2A 1PJSA 4BMJA 2J7JA 4P7DA 4AQYE 2YTIA 4K0KE 1FJGE 1JK1A 3C4BA 2LV2A 2EMLA 5ADZA 2ENHA 5AC4A 1EKZA 2DSYA 2RSMA 2L33A 2L92A 2L3JA 1IMUA 1J5EE 2LUQA 4R2PA 1RC7A 3ECRA 2YTJA 2HGHA 4DV6E 2YTEA 2L2KB 2MC5A 3T1HE 2ELZA 2UUCE 1SR9A 2VF1A 2F4VE 5IWAE 4F54A 2EN7A 1P47A 2NUEA 2EPKX 4KHPE 1XNQE 2WCC3 2YU5A 4YHHE 3HTXA 3VHTB 3L00A 3FIGA 2EM0A 3EQ1A 5IV8B 3MHSC 3AUZA 1AAYA 4JI3E 3BBGA 3THNA 2NUFA 4RH8A 3DF6A 2M1SA 1HR0E 1XMQE 2ENCA 5IT9C 3JU0A 1A1LA 4BHBA 5KL5A 5LLQA 2MDRA 1L4SA 2V83A 2H36X 4Q28A 5AE3A 4LF6E 1N33E 3HPSA 1BBOA 1DQ3A 2EPAA 4LF9E 4DV4E 2N3GA 2WZOA 1YYKA 1AH5A 3DJWA 2EPZA 2DGCA 4DV0E 3C6MA 2EOSA 2KONA 2YTFA 2EPCA 4R2DA 2EOZA 1XMOE 2YSOA 2YTPA 1YZ9A 1X5WA 2GPIA 1QU6A 4NXNE 1HNZE 1GZ6A 4R8OA 4DR6E 4BS9A 2YSPA 2HHHE 2EN6A 2EN8A 1G2FC 5LMUE 3C4TA 2M7QA 2VE7C 1UN6B 4X64E 4X66E 4BC9A 2EOXA 2EJ4A 1X3CA 2V87A 2YU8A 2N8XA 2F8BA 3THOB 2YTDA 4Q35B 3HPZA 2B3TB 2JVAA 4RHBB 4F9AB 1ZBTA 1YYOA 4NZVA 2MC6A 2DRPA 2EOMA 4L5NC 4GKJE 1UILA 2EN2A 1ZAAC 1GTKA 2EPXA 1A1KA 2ADRA 4F9BB 2ODRC 1T4OA 2LRSA 3BF2A 4DUYE 1WRJA 4X65E
chains in the Genus database with same CATH topology
1SR9A 4KZSA 4DV3E 2VF1A 2LMZA 4LFAE 5IWAE 3HQ1A 2F4VE 4DR4E 2YT4A 2E5LE 4F54A 1T4NA 2YZTA 2NUEA 1N32E 3J7Yp 4KHPE 1XNQE 4WYQB 4B3SE 4WSPA 3ADJA 4LTYA 1O0WA 2EWLA 2FTXB 4YHHE 3HTXA 3AV0A 2VQFE 4LF5E 4DR7E 2NA2A 4WPYA 4DMIA 3FIGA 1I94E 2UXBE 3AUZA 4P78A 5LMNE 4JI3E 2G7HA 5CFFE 2NUFA 2V85A 2B7VA 3H09A 3IWCA 4DR5E 1IBME 4JI1E 4OX9E 3DF6A 2LBSB 1PKPA 2M1SA 3P1XA 4J8ZA 2JOXA 3JTZA 4R03A 5AE1A 3ADGA 4DR1E 2DMYA 5IT9C 1XMQE 4BCAA 3K6QA 3JU0A 4GKKE 1GQEA 5AASA 4JYAE 4GEQB 2MDRA 1N34E 3ZOQB 1X49A 2KHXA 2V83A 2NUGA 2H36X 4Q28A 5AE3A 4OOGC 4DV5E 1IBKE 4LF4E 4LF6E 4DKKA 1N33E 4JI5E 3HPSA 3LLHA 1WHQA 1YYWA 1HR0E 1STUA 2K4VA 1WXRA 2FV4B 4F9CB 2UXCE 1DQ3A 4M2ZA 2LTRA 2DIXA 4DV4E 2N3GA 2ODRD 2WZOA 3IWDA 5LL6R 4X62E 4LF9E 4TUGA 1YYKA 2L8TA 2L6MA 4DV1E 4NXME 3DJWA 2CPNA 5BR8E 1FKAE 1J26A 4DV0E 2B7TA 5F3WA 4JI6E 2KONA 1WHNA 4GKJE 3VK6A 2EZ6A 2UUAE 3LMLA 4BC7A 2V86A 1HNXE 3HXLA 1XMOE 2UU9E 3OTOE 5A2QC 1N36E 4JI4E 4M0VA 4LF8E 4B3RE 4JI0E 2LTSA 1YZ9A 4YY3E 1QU6A 4NXNE 1HNZE 1GZ6A 4R8OA 4BBYA 4DR6E 2LJHA 4BS9A 1IBLE 2HHHE 3J7AG 4WFTA 4JI8E 3RMPA 2JOBA 4X8WA 2L2NA 4DV2E 4LF7E 2JWOA 4DUZE 4B3TE 2RS6A 2E1MA 3J81C 4I8OA 5LMUE 3C4TA 4TUIA 2KOUA 3IWBA 1T4LB 4LFCE 4L8NA 1RQ0A 2B9DA 2M7QA 4DR3E 2VE7C 2DB2A 2M4IA 3JAMC 5AE2A 2LUPB 1XNRE 4X64E 4X66E 2UXDE 4JV5E 4BC9A 2RTXA 3KWRA 3F6HA 1UHZA 5DNYA 2IHR1 4DR2E 2V87A 2F8BA 1X47A 4M30A 3MSWA 1DI2A 2L2MA 3HPZA 4BMJA 4P7DA 4DV7E 2B3TB 2JVAA 4F9AB 4AQYE 1ZBTA 1YYOA 3VYXA 3T1YE 4K0KE 2VQEE 2MC6A 1FJGE 2JY9A 3C4BA 3J80C 5T6JA 5ADZA 4B3ME 1HNWE 2V88A 1EKZA 2DSYA 2RSMA 2L33A 1UILA 2L92A 2V8QB 4L5NC 1X48A 2LE2A 2LUQA 2L3JA 3VYYA 1J5EE 3F6GA 1RC7A 2UUBE 2JR1A 4JI2E 4LU9A 3ADIA 2FGGA 3OMLA 2RS7A 4DV6E 2L2KB 5FLXC 2MC5A 4F9BB 2ODRC 2N3HA 3ADLA 3T1HE 1ZBQA 2L3CA 4JI7E 1T4OA 2LRSA 2ZM6E 2UUCE 4LFBE 4DUYE 4X65E 2V89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JTZ A;  3RMP A;  3JU0 A; 
#chains in the Genus database with same CATH topology
 2BB8 A;  4DV3 E;  4LFA E;  2LMZ A;  2MKN A;  1YFH A;  4DR4 E;  2EL4 A;  2EM2 A;  4WYQ B;  4B3S E;  2LT7 A;  2EWL A;  2K7I A;  3MHH C;  2EMW A;  3AV0 A;  4R2Q A;  2HJJ A;  2NA2 A;  2EOF A;  4WPY A;  4DMI A;  4ZYG A;  4WXC A;  3C6K A;  4P78 A;  5CFF E;  2V85 A;  2EMI A;  3H09 A;  4JI1 E;  4DR5 E;  1WJP A;  2DLK A;  3P1X A;  2EE8 A;  2EM4 A;  1N34 E;  1ZU1 A;  4ZYD A;  2GHF A;  1YSA C;  4DKK A;  4JI5 E;  3LLH A;  2EQ1 A;  2NAB A;  2CTD A;  1STU A;  2K4V A;  5A6B A;  2UXC E;  4F9C B;  5KL7 A;  4M2Z A;  2DIX A;  2EMB A;  4X62 E;  5LL6 R;  2L8T A;  4O43 A;  1FKA E;  5BR8 E;  3EPK A;  4MLV A;  1DGC A;  5A6A A;  2EMK A;  3VK6 A;  2GLI A;  2UUA E;  3LML A;  1PJT A;  1EH6 A;  1MGT A;  1N36 E;  2MKD A;  4JI0 E;  2DMI A;  2CSH A;  4JI8 E;  4KWY A;  5KL3 A;  3BID A;  1A1F A;  2JWO A;  3J81 C;  2KOU A;  1EH8 A;  4L8N A;  4DR3 E;  1XNR E;  3M99 B;  3JAM C;  5AE2 A;  1TF3 A;  2EPM X;  1UHZ A;  1LLM C;  4O24 A;  1EH7 A;  3BGH A;  2L2M A;  3MSW A;  3QG5 C;  2VRD A;  2BBG A;  2EOH A;  2VQE E;  1IQO A;  2JY9 A;  3J80 C;  4B3M E;  2EM6 A;  4IJD A;  2V88 A;  1YPN A;  2UXD E;  2LE2 A;  3VYY A;  2UUB E;  3F6G A;  3TQM A;  3ADI A;  5FLX C;  4F2J C;  2EMG A;  1T39 A;  2L3C A;  4JI7 E;  2ENA A;  2ZM6 E;  4LFB E;  2EOO A;  1T38 A;  1YUI A;  2V89 A;  4KZS A;  1BB8 A;  2EMF A;  4N4R B;  4ZYH A;  4BHC A;  1T4N A;  3J7Y p;  2E72 A;  5IXM B;  2EL6 A;  1TN9 A;  4X9J A;  1SFE A;  3ADJ A;  2EMX A;  2FTX B;  1KJK A;  4LF5 E;  1PDA A;  2EMA A;  2LCE A;  2EM9 A;  2EP3 A;  1G2D C;  2G7H A;  3IWC A;  1IBM E;  4HTG A;  2LBS B;  4J8Z A;  2JOX A;  4R03 A;  3ADG A;  2DMY A;  4FK5 C;  4GKK E;  1GQE A;  2EOR A;  4R2S A;  4GEQ B;  2LO3 A;  3ZOQ B;  1X49 A;  2LJU A;  2NUG A;  1IBK E;  4DV5 E;  1IQS A;  1WHQ A;  2YPN A;  1YYW A;  2EPO A;  2JYA A;  1WXR A;  4GZN C;  2LTR A;  2EMH A;  3IWD A;  2EMZ A;  4DV1 E;  4NXM E;  3KZY A;  5KL2 A;  1RMD A;  2D9H A;  2DLQ A;  2EPP A;  1F2I G;  1WHN A;  1NEI A;  2EZ6 A;  2EOE A;  2MDG A;  4IS1 C;  2EPN A;  5TSE A;  3HXL A;  2EQ3 A;  1HNX E;  2UU9 E;  5A2Q C;  2EM8 A;  4NHR A;  4M0V A;  1A1I A;  4R2E A;  4LF8 E;  4B3R E;  2LTS A;  4O5G A;  4YY3 E;  5A6B D;  4BBY A;  5KL4 A;  1IBL E;  2YTG A;  3J7A G;  4WFT A;  3RMP A;  4WX9 A;  2PRT A;  2JOB A;  4X8W A;  4DV2 E;  4LF7 E;  5A69 A;  4I8O A;  2RPC A;  4TUI A;  3IWB A;  4LFC E;  1RQ0 A;  2EM3 A;  2LUP B;  2JPA A;  2DB2 A;  2M4I A;  1QNT A;  1ZR9 A;  4JV5 E;  3UK3 C;  3F6H A;  2R76 A;  5DNY A;  2IHR 1;  4DR2 E;  4M30 A;  1X47 A;  1X6E A;  2EOJ A;  2RQL A;  4DV7 E;  2ELY A;  3VYX A;  2EPU A;  3T1Y E;  2EOI A;  4WSG A;  2EMC A;  5T6J A;  5A6K A;  1HNW E;  2YTQ A;  4O4K A;  2V8Q B;  2EN4 A;  1N3G A;  1YUJ A;  1X48 A;  2LVH A;  3EPJ A;  3EPL A;  1X6F A;  2JR1 A;  4HEI A;  2EN1 A;  4LU9 A;  2FGG A;  3OML A;  2RS7 A;  3EPH A;  2N3H A;  3ADL A;  1ZBQ A;  4F6N A;  2YRK A;  4JI2 E;  3HQ1 A;  2YT4 A;  2EM7 A;  1X6H A;  2YRH A;  2EOY A;  2WBS A;  2E5L E;  2EM5 A;  2YZT A;  2CT1 A;  1N32 E;  2EPR A;  2WBT A;  2I13 A;  4F6M A;  4WSP A;  1JK2 A;  4LTY A;  1O0W A;  2VQF E;  4DR7 E;  1I94 E;  2UXB E;  2R1F A;  5LMN E;  1TF6 A;  2WBU A;  2B7V A;  5KL6 A;  4OX9 E;  2EQ0 A;  1PKP A;  2EPL X;  3JTZ A;  5AE1 A;  4DR1 E;  4BCA A;  3K6Q A;  1MEY C;  5AAS A;  2JP9 A;  2EMY A;  1KYQ A;  2EOQ A;  4JYA E;  2KHX A;  4R2C A;  1A1H A;  2HC5 A;  2Q8U A;  4ZYE A;  4OOG C;  4LF4 E;  1B69 A;  3KZZ A;  4R2A A;  2RSI A;  2FV4 B;  4R2R A;  2ODR D;  2JXP A;  4TUG A;  2L6M A;  2A25 A;  2CPN A;  2YRM A;  1BBG A;  1J26 A;  2YTN A;  2B7T A;  5F3W A;  4JI6 E;  1A1G A;  1NCS A;  1UBD C;  4BC7 A;  2V86 A;  2M9A A;  2EN3 A;  3OTO E;  4JI4 E;  2I9I A;  1PJQ A;  4M9V C;  2EL5 A;  2LJH A;  1Z1B A;  2L2N A;  2YTO A;  4DUZ E;  4B3T E;  2RS6 A;  2E1M A;  1A1J A;  1T4L B;  2B9D A;  4WXD A;  5AC5 A;  5A6J A;  2YWQ A;  2RTX A;  3KWR A;  4MLQ A;  1DI2 A;  1PJS A;  4BMJ A;  2J7J A;  4P7D A;  4AQY E;  2YTI A;  4K0K E;  1FJG E;  1JK1 A;  3C4B A;  2LV2 A;  2EML A;  5ADZ A;  2ENH A;  5AC4 A;  1EKZ A;  2DSY A;  2RSM A;  2L33 A;  2L92 A;  2L3J A;  1IMU A;  1J5E E;  2LUQ A;  4R2P A;  1RC7 A;  3ECR A;  2YTJ A;  2HGH A;  4DV6 E;  2YTE A;  2L2K B;  2MC5 A;  3T1H E;  2ELZ A;  2UUC E;  1SR9 A;  2VF1 A;  2F4V E;  5IWA E;  4F54 A;  2EN7 A;  1P47 A;  2NUE A;  2EPK X;  4KHP E;  1XNQ E;  2WCC 3;  2YU5 A;  4YHH E;  3HTX A;  3VHT B;  3L00 A;  3FIG A;  2EM0 A;  3EQ1 A;  5IV8 B;  3MHS C;  3AUZ A;  1AAY A;  4JI3 E;  3BBG A;  3THN A;  2NUF A;  4RH8 A;  3DF6 A;  2M1S A;  1HR0 E;  1XMQ E;  2ENC A;  5IT9 C;  3JU0 A;  1A1L A;  4BHB A;  5KL5 A;  5LLQ A;  2MDR A;  1L4S A;  2V83 A;  2H36 X;  4Q28 A;  5AE3 A;  4LF6 E;  1N33 E;  3HPS A;  1BBO A;  1DQ3 A;  2EPA A;  4LF9 E;  4DV4 E;  2N3G A;  2WZO A;  1YYK A;  1AH5 A;  3DJW A;  2EPZ A;  2DGC A;  4DV0 E;  3C6M A;  2EOS A;  2KON A;  2YTF A;  2EPC A;  4R2D A;  2EOZ A;  1XMO E;  2YSO A;  2YTP A;  1YZ9 A;  1X5W A;  2GPI A;  1QU6 A;  4NXN E;  1HNZ E;  1GZ6 A;  4R8O A;  4DR6 E;  4BS9 A;  2YSP A;  2HHH E;  2EN6 A;  2EN8 A;  1G2F C;  5LMU E;  3C4T A;  2M7Q A;  2VE7 C;  1UN6 B;  4X64 E;  4X66 E;  4BC9 A;  2EOX A;  2EJ4 A;  1X3C A;  2V87 A;  2YU8 A;  2N8X A;  2F8B A;  3THO B;  2YTD A;  4Q35 B;  3HPZ A;  2B3T B;  2JVA A;  4RHB B;  4F9A B;  1ZBT A;  1YYO A;  4NZV A;  2MC6 A;  2DRP A;  2EOM A;  4L5N C;  4GKJ E;  1UIL A;  2EN2 A;  1ZAA C;  1GTK A;  2EPX A;  1A1K A;  2ADR A;  4F9B B;  2ODR C;  1T4O A;  2LRS A;  3BF2 A;  4DUY E;  1WRJ A;  4X65 E; 
#chains in the Genus database with same CATH homology
 1SR9 A;  4KZS A;  4DV3 E;  2VF1 A;  2LMZ A;  4LFA E;  5IWA E;  3HQ1 A;  2F4V E;  4DR4 E;  2YT4 A;  2E5L E;  4F54 A;  1T4N A;  2YZT A;  2NUE A;  1N32 E;  3J7Y p;  4KHP E;  1XNQ E;  4WYQ B;  4B3S E;  4WSP A;  3ADJ A;  4LTY A;  1O0W A;  2EWL A;  2FTX B;  4YHH E;  3HTX A;  3AV0 A;  2VQF E;  4LF5 E;  4DR7 E;  2NA2 A;  4WPY A;  4DMI A;  3FIG A;  1I94 E;  2UXB E;  3AUZ A;  4P78 A;  5LMN E;  4JI3 E;  2G7H A;  5CFF E;  2NUF A;  2V85 A;  2B7V A;  3H09 A;  3IWC A;  4DR5 E;  1IBM E;  4JI1 E;  4OX9 E;  3DF6 A;  2LBS B;  1PKP A;  2M1S A;  3P1X A;  4J8Z A;  2JOX A;  3JTZ A;  4R03 A;  5AE1 A;  3ADG A;  4DR1 E;  2DMY A;  5IT9 C;  1XMQ E;  4BCA A;  3K6Q A;  3JU0 A;  4GKK E;  1GQE A;  5AAS A;  4JYA E;  4GEQ B;  2MDR A;  1N34 E;  3ZOQ B;  1X49 A;  2KHX A;  2V83 A;  2NUG A;  2H36 X;  4Q28 A;  5AE3 A;  4OOG C;  4DV5 E;  1IBK E;  4LF4 E;  4LF6 E;  4DKK A;  1N33 E;  4JI5 E;  3HPS A;  3LLH A;  1WHQ A;  1YYW A;  1HR0 E;  1STU A;  2K4V A;  1WXR A;  2FV4 B;  4F9C B;  2UXC E;  1DQ3 A;  4M2Z A;  2LTR A;  2DIX A;  4DV4 E;  2N3G A;  2ODR D;  2WZO A;  3IWD A;  5LL6 R;  4X62 E;  4LF9 E;  4TUG A;  1YYK A;  2L8T A;  2L6M A;  4DV1 E;  4NXM E;  3DJW A;  2CPN A;  5BR8 E;  1FKA E;  1J26 A;  4DV0 E;  2B7T A;  5F3W A;  4JI6 E;  2KON A;  1WHN A;  4GKJ E;  3VK6 A;  2EZ6 A;  2UUA E;  3LML A;  4BC7 A;  2V86 A;  1HNX E;  3HXL A;  1XMO E;  2UU9 E;  3OTO E;  5A2Q C;  1N36 E;  4JI4 E;  4M0V A;  4LF8 E;  4B3R E;  4JI0 E;  2LTS A;  1YZ9 A;  4YY3 E;  1QU6 A;  4NXN E;  1HNZ E;  1GZ6 A;  4R8O A;  4BBY A;  4DR6 E;  2LJH A;  4BS9 A;  1IBL E;  2HHH E;  3J7A G;  4WFT A;  4JI8 E;  3RMP A;  2JOB A;  4X8W A;  2L2N A;  4DV2 E;  4LF7 E;  2JWO A;  4DUZ E;  4B3T E;  2RS6 A;  2E1M A;  3J81 C;  4I8O A;  5LMU E;  3C4T A;  4TUI A;  2KOU A;  3IWB A;  1T4L B;  4LFC E;  4L8N A;  1RQ0 A;  2B9D A;  2M7Q A;  4DR3 E;  2VE7 C;  2DB2 A;  2M4I A;  3JAM C;  5AE2 A;  2LUP B;  1XNR E;  4X64 E;  4X66 E;  2UXD E;  4JV5 E;  4BC9 A;  2RTX A;  3KWR A;  3F6H A;  1UHZ A;  5DNY A;  2IHR 1;  4DR2 E;  2V87 A;  2F8B A;  1X47 A;  4M30 A;  3MSW A;  1DI2 A;  2L2M A;  3HPZ A;  4BMJ A;  4P7D A;  4DV7 E;  2B3T B;  2JVA A;  4F9A B;  4AQY E;  1ZBT A;  1YYO A;  3VYX A;  3T1Y E;  4K0K E;  2VQE E;  2MC6 A;  1FJG E;  2JY9 A;  3C4B A;  3J80 C;  5T6J A;  5ADZ A;  4B3M E;  1HNW E;  2V88 A;  1EKZ A;  2DSY A;  2RSM A;  2L33 A;  1UIL A;  2L92 A;  2V8Q B;  4L5N C;  1X48 A;  2LE2 A;  2LUQ A;  2L3J A;  3VYY A;  1J5E E;  3F6G A;  1RC7 A;  2UUB E;  2JR1 A;  4JI2 E;  4LU9 A;  3ADI A;  2FGG A;  3OML A;  2RS7 A;  4DV6 E;  2L2K B;  5FLX C;  2MC5 A;  4F9B B;  2ODR C;  2N3H A;  3ADL A;  3T1H E;  1ZBQ A;  2L3C A;  4JI7 E;  1T4O A;  2LRS A;  2ZM6 E;  2UUC E;  4LFB E;  4DUY E;  4X65 E;  2V89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...