2DMIA

Solution structure of the first and the second zf-c2h2 like domains of human teashirt homolog 3
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
115
structure length
115
Chain Sequence
GSSGSSGKLYGSIFTGASKFRCKDCSAAYDTLVELTVHMNETGHYRDDNHETDNNNPKRWSKPRKRSLLEMEGKEDAQKVLKCMYCGHSFESLQDLSVHMIKTKHYQKVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Teashirt homolog 3
publication title Solution structure of the first and the second zf-C2H2 like domains of human Teashirt homolog 3
rcsb
source organism Homo sapiens
total genus 15
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2006-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13912 zf-C2H2_6 C2H2-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2dmiA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2dmiA01
1NCSA 1RMDA 2EQ1A 1Z1BA 2EQ0A 2WBUA 2YTOA 2EPPA 2MKDA 4IS1C 2EMXA 2ELZA 2MDGA 2CT1A 2NABA 1A1IA 2JP9A 2VRDA 1BBOA 2EPZA 2YTFA 3EPLA 2YU8A 2LVHA 2EOOA 2RPCA 1X6FA 2EMZA 5KL7A 1X3CA 3VHTB 2EN6A 2EPCA 1B69A 1A1GA 2EN1A 1LLMC 2YRKA 2HGHA 2YRMA 2EOQA 4R2RA 2EM3A 2ELYA 2EE8A 2GHFA 2WCC3 2EM9A 2EN2A 2EN4A 4R2QA 2EOJA 2I13A 2R1FA 3EPKA 2EM2A 1KJKA 1ZR9A 2GLIA 1JK2A 2YTEA 2EMAA 2LO3A 2YTNA 2LV2A 2ADRA 1JK1A 2DGCA 4F6NA 2CTDA 3UK3C 3MHSC 2ENAA 2YSOA 5KL2A 1TF6A 2EMKA 2EOSA 2EPAA 2EMFA 1UBDC 2DRPA 2MKNA 4M9VC 1A1FA 1TF3A 1AAYA 2YTIA 1YUJA 2EN3A 2EMGA 2EORA 2DMIA 4R2SA 1UN6B 4R2AA 2LCEA 2D9HA 2J7JA 1A1KA 1X6EA 2YTQA 2EL4A 1ZAAC 5KL3A 2EP3A 4R2CA 2WBTA 2A25A 3MHHC 2EJ4A 2YTDA 2EN7A 4R2EA 2BB8A 2E72A 2EQ3A 5KL6A 4WSGA 1A1LA 2EOYA 1BB8A 2JPAA 2EMBA 4X9JA 2EPXA 2ENCA 4F6MA 2PRTA 1G2FC 2EM5A 4R2DA 2EPUA 1WJPA 2EM7A 2EMLA 5KL5A 3EPHA 2M9AA 2EOMA 2EN8A 2YTGA 4IJDA 2EM8A 2YRHA 2EOXA 1ZU1A 3EPJA 2EM4A 1TN9A 2EPRA 2WBSA 1DGCA 1YSAC 1A1JA 2RSIA 2YTPA 2ENHA 2LT7A 2EM0A 1X5WA 2EMCA 1P47A 2CSHA 4GZNC 2EOEA 2EL5A 1G2DC 2EOIA 2DLKA 1X6HA 2EMIA 1YUIA 2EMHA 3M99B 2EOFA 2EM6A 2EMYA 2YSPA 2EOZA 2YU5A 1F2IG 4R2PA 2EOHA 2YTJA 1MEYC 4FK5C 2DLQA 5KL4A 1A1HA 2EL6A 2EMWA 4F2JC
chains in the Genus database with same CATH superfamily
4RH8A 1Z1BA 2EQ1A 4WXDA 3BGHA 2WBUA 4Q35B 1T38A 1MGTA 2MKDA 1DI2A 1A1IA 1BBOA 2VRDA 4B3RE 2HC5A 3VYXA 2YTFA 2N3GA 2FGGA 3EPLA 2LVHA 4ZYEA 1WXRA 5KL7A 5LLQA 1X3CA 3VHTB 4DMIA 2EN6A 1XMOE 4BMJA 4WYQB 2JXPA 1LLMC 2VE7C 2EM3A 2ELYA 3JU0A 2EM9A 2EN2A 2EN4A 4JI5E 2EOJA 3BF2A 1KJKA 4DR7E 4JI3E 2LV2A 5A6BD 5AASA 5IXMB 4DV4E 3H09A 2KHXA 3MHSC 1HR0E 5BR8E 4JI8E 2EPAA 1UILA 4WX9A 2EPMX 2MKNA 3L00A 1YUJA 1RC7A 4R2SA 2LCEA 2E1MA 2D9HA 1A1KA 2JOXA 4TUIA 5KL3A 4WFTA 2A25A 3MHHC 2EJ4A 4ZYGA 3ADJA 4M2ZA 3ADIA 4R2EA 4BHBA 4X8WA 2EPOA 4NZVA 2JPAA 2EMBA 2V88A 2VQFE 3C6MA 4JI7E 2ENCA 2UU9E 4OX9E 1G2FC 1KYQA 2EM5A 5IT9C 2EM7A 2EMLA 3EPHA 4GKKE 2M9AA 2H36X 2EOMA 1T39A 4IJDA 3LMLA 1PJSA 3THOB 2NUFA 1ZU1A 1UHZA 1X48A 5FLXC 4J8ZA 2EPRA 1IBME 1A1JA 1YSAC 2EM0A 1X5WA 1IBKE 1P47A 1G2DC 4DR2E 2EOIA 1X6HA 4JI4E 4DV3E 3M99B 2NA2A 2EOFA 2EM6A 2KOUA 2YSPA 2FTXB 4X64E 2V86A 2YZTA 2DLQA 1RQ0A 4O43A 5KL4A 2V85A 1WHQA 1NCSA 4JYAE 2L2NA 4O4KA 3OTOE 1HNXE 2EQ0A 1O0WA 4DR5E 3EQ1A 2ODRC 4O5GA 1PDAA 4DR1E 3VYYA 5LMNE 3KZYA 1GTKA 2EPKX 1B69A 2B7VA 1A1GA 2NUEA 4F9AB 4MLQA 1SR9A 2EOQA 2LBSB 2M1SA 3AV0A 2EZ6A 2UXBE 5A6KA 2R1FA 3EPKA 2EM2A 5IV8B 1ZR9A 4B3ME 1WHNA 2LMZA 2YTEA 2LO3A 2YTNA 2DSYA 4BCAA 2ADRA 5A69A 2DGCA 4K0KE 2JWOA 3UK3C 4Q28A 2JY9A 1X47A 3LLHA 4X66E 1TF6A 2EMKA 2EOSA 4BC9A 2DRPA 1BBGA 1TF3A 4I8OA 2DB2A 5DNYA 3ADLA 2YTQA 2EP3A 2RTXA 3BBGA 1N32E 1AH5A 2E72A 3DJWA 5IWAE 4KWYA 4WSGA 2V87A 1A1LA 1BB8A 2V89A 1YZ9A 1PJTA 4M0VA 4LFCE 2LTSA 1YPNA 2B9DA 2V83A 4F54A 3BIDA 3MSWA 2MC6A 2YTGA 2BBGA 5CFFE 4LF4E 2K7IA 2LJHA 1HNZE 2F8BA 1TN9A 3HPZA 2WBSA 2ZM6E 1DGCA 2RSIA 3KZZA 2EMCA 2IHR1 2EOEA 2DLKA 2EMIA 1YUIA 3F6GA 3THNA 2HHHE 4JI1E 1I94E 4GKJE 2EMYA 2V8QB 2EOZA 2YU5A 1F2IG 2RQLA 4R2PA 1ZBTA 1EH7A 2YTJA 1MEYC 3C4BA 5LL6R 4BS9A 2VQEE 2FV4B 2EMWA 4L5NC 4LF8E 4YY3E 1EKZA 5ADZA 4RHBB 4DV2E 2UXCE 4IS1C 3JAMC 4DV1E 4NXNE 2EMXA 2ELZA 2M4IA 2DIXA 2NABA 3OMLA 2L33A 4LTYA 3TQMA 2R76A 5AE2A 2YU8A 2EMZA 4JI2E 4L8NA 2EPNA 4OOGC 2B3TB 4R03A 1WRJA 2EN1A 1IQSA 2YRKA 1FKAE 2JR1A 2YRMA 4O24A 2RS6A 4R8OA 2L92A 4R2RA 2I13A 2EE8A 3HXLA 3ECRA 3HPSA 4P78A 4R2QA 4KHPE 1J26A 3C4TA 2E5LE 2L3JA 2EMAA 2RS7A 4LF5E 1JK1A 2N3HA 2CPNA 2CTDA 3F6HA 1N36E 4BBYA 4ZYDA 5KL2A 4B3TE 1T4NA 4DV7E 1AAYA 2YTIA 1X49A 2EORA 2DMIA 4R2AA 1QNTA 2J7JA 2LJUA 2EL4A 1ZAAC 1N3GA 4X65E 2WBTA 1L4SA 2YTDA 2N8XA 4DV6E 4M30A 2JOBA 3J81C 2I9IA 4GEQB 4F9BB 4JV5E 2ODRD 2EPXA 4F6MA 2PRTA 2Q8UA 4R2DA 2UUBE 4N4RB 1EH8A 1IQOA 1WJPA 4WXCA 3AUZA 5KL5A 3P1XA 4DR6E 4NHRA 2DMYA 1YFHA 4AQYE 1J5EE 1PKPA 2EM8A 4DR3E 3IWCA 2G7HA 4JI0E 3EPJA 5AE1A 1NEIA 3HQ1A 3FIGA 2B7TA 2JYAA 4GZNC 2EL5A 2EMHA 5TSEA 1T4OA 4WPYA 3DF6A 4BHCA 4F9CB 2EOHA 2LE2A 4KZSA 1GZ6A 4FK5C 2NUGA 4NXME 1A1HA 2EL6A 4F2JC 4LFBE 2HJJA 1ZBQA 4HEIA 4LF7E 1SFEA 2GPIA 1RMDA 4WSPA 3VK6A 3ZOQB 2YTOA 2EPPA 5A6JA 2MDGA 4LFAE 2CT1A 2JP9A 3HTXA 2MC5A 4P7DA 2EPZA 1DQ3A 1STUA 3JTZA 2WZOA 5AC4A 2EOOA 2RPCA 4B3SE 1X6FA 2UXDE 2UUCE 1QU6A 2YPNA 4TUGA 5F3WA 2EPCA 2K4VA 2HGHA 4DUYE 2M7QA 5AC5A 5A6AA 3K6QA 2WCC3 2GHFA 1UN6B 4DV0E 2EPLX 1EH6A 3J7AG 2GLIA 1JK2A 2UUAE 2YWQA 4F6NA 1YYOA 2ENAA 2LRSA 2YSOA 4X62E 1N33E 3T1HE 1UBDC 2EMFA 2L2MA 4DV5E 4M9VC 1IMUA 3KWRA 1IBLE 1A1FA 5A2QC 3ADGA 2EN3A 2EMGA 1YYKA 2YT4A 4ZYHA 5LMUE 2L8TA 1X6EA 1XMQE 4HTGA 2VF1A 1PJQA 4LU9A 4MLVA 4R2CA 1XNRE 1HNWE 2EN7A 2BB8A 2EQ3A 5T6JA 3J80C 4LF6E 5KL6A 2LUQA 2EOYA 1YYWA 4DKKA 2LUPB 4DR4E 4X9JA 3IWDA 3J7Yp 1T4LB 2EWLA 2EPUA 3T1YE 3IWBA 1XNQE 1FJGE 4BC7A 2EN8A 3QG5C 2F4VE 5AE3A 4LF9E 2YRHA 2EOXA 4JI6E 2L3CA 2JVAA 2L6MA 1GQEA 2EM4A 4YHHE 2KONA 2YTPA 2ENHA 2LT7A 1N34E 2CSHA 4DUZE 2MDRA 3RMPA 5A6BA 2LTRA 2RSMA 3C6KA 2L2KB
chains in the Genus database with same CATH topology
1NCSA 1RMDA 2EQ1A 1Z1BA 2EQ0A 2WBUA 2YTOA 2EPPA 2MKDA 4IS1C 2EMXA 2ELZA 2MDGA 2CT1A 2NABA 1A1IA 2JP9A 2VRDA 1BBOA 2EPZA 2YTFA 3EPLA 2YU8A 2LVHA 2EOOA 2RPCA 1X6FA 2EMZA 5KL7A 1X3CA 3VHTB 2EN6A 2EPCA 1B69A 1A1GA 2EN1A 1LLMC 2YRKA 2HGHA 2YRMA 2EOQA 4R2RA 2EM3A 2ELYA 2EE8A 2GHFA 2WCC3 2EM9A 2EN2A 2EN4A 4R2QA 2EOJA 2I13A 2R1FA 3EPKA 2EM2A 1KJKA 1ZR9A 2GLIA 1JK2A 2YTEA 2EMAA 2LO3A 2YTNA 2LV2A 2ADRA 1JK1A 2DGCA 4F6NA 2CTDA 3UK3C 3MHSC 2ENAA 2YSOA 5KL2A 1TF6A 2EMKA 2EOSA 2EPAA 2EMFA 1UBDC 2DRPA 2MKNA 4M9VC 1A1FA 1TF3A 1AAYA 2YTIA 1YUJA 2EN3A 2EMGA 2EORA 2DMIA 4R2SA 1UN6B 4R2AA 2LCEA 2D9HA 2J7JA 1A1KA 1X6EA 2YTQA 2EL4A 1ZAAC 5KL3A 2EP3A 4R2CA 2WBTA 2A25A 3MHHC 2EJ4A 2YTDA 2EN7A 4R2EA 2BB8A 2E72A 2EQ3A 5KL6A 4WSGA 1A1LA 2EOYA 1BB8A 2JPAA 2EMBA 4X9JA 2EPXA 2ENCA 4F6MA 2PRTA 1G2FC 2EM5A 4R2DA 2EPUA 1WJPA 2EM7A 2EMLA 5KL5A 3EPHA 2M9AA 2EOMA 2EN8A 2YTGA 4IJDA 2EM8A 2YRHA 2EOXA 1ZU1A 3EPJA 2EM4A 1TN9A 2EPRA 2WBSA 1DGCA 1YSAC 1A1JA 2RSIA 2YTPA 2ENHA 2LT7A 2EM0A 1X5WA 2EMCA 1P47A 2CSHA 4GZNC 2EOEA 2EL5A 1G2DC 2EOIA 2DLKA 1X6HA 2EMIA 1YUIA 2EMHA 3M99B 2EOFA 2EM6A 2EMYA 2YSPA 2EOZA 2YU5A 1F2IG 4R2PA 2EOHA 2YTJA 1MEYC 4FK5C 2DLQA 5KL4A 1A1HA 2EL6A 2EMWA 4F2JC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NCS A;  1RMD A;  2EQ1 A;  1Z1B A;  2EQ0 A;  2WBU A;  2YTO A;  2EPP A;  2MKD A;  4IS1 C;  2EMX A;  2ELZ A;  2MDG A;  2CT1 A;  2NAB A;  1A1I A;  2JP9 A;  2VRD A;  1BBO A;  2EPZ A;  2YTF A;  3EPL A;  2YU8 A;  2LVH A;  2EOO A;  2RPC A;  1X6F A;  2EMZ A;  5KL7 A;  1X3C A;  3VHT B;  2EN6 A;  2EPC A;  1B69 A;  1A1G A;  2EN1 A;  1LLM C;  2YRK A;  2HGH A;  2YRM A;  2EOQ A;  4R2R A;  2EM3 A;  2ELY A;  2EE8 A;  2GHF A;  2WCC 3;  2EM9 A;  2EN2 A;  2EN4 A;  4R2Q A;  2EOJ A;  2I13 A;  2R1F A;  3EPK A;  2EM2 A;  1KJK A;  1ZR9 A;  2GLI A;  1JK2 A;  2YTE A;  2EMA A;  2LO3 A;  2YTN A;  2LV2 A;  2ADR A;  1JK1 A;  2DGC A;  4F6N A;  2CTD A;  3UK3 C;  3MHS C;  2ENA A;  2YSO A;  5KL2 A;  1TF6 A;  2EMK A;  2EOS A;  2EPA A;  2EMF A;  1UBD C;  2DRP A;  2MKN A;  4M9V C;  1A1F A;  1TF3 A;  1AAY A;  2YTI A;  1YUJ A;  2EN3 A;  2EMG A;  2EOR A;  2DMI A;  4R2S A;  1UN6 B;  4R2A A;  2LCE A;  2D9H A;  2J7J A;  1A1K A;  1X6E A;  2YTQ A;  2EL4 A;  1ZAA C;  5KL3 A;  2EP3 A;  4R2C A;  2WBT A;  2A25 A;  3MHH C;  2EJ4 A;  2YTD A;  2EN7 A;  4R2E A;  2BB8 A;  2E72 A;  2EQ3 A;  5KL6 A;  4WSG A;  1A1L A;  2EOY A;  1BB8 A;  2JPA A;  2EMB A;  4X9J A;  2EPX A;  2ENC A;  4F6M A;  2PRT A;  1G2F C;  2EM5 A;  4R2D A;  2EPU A;  1WJP A;  2EM7 A;  2EML A;  5KL5 A;  3EPH A;  2M9A A;  2EOM A;  2EN8 A;  2YTG A;  4IJD A;  2EM8 A;  2YRH A;  2EOX A;  1ZU1 A;  3EPJ A;  2EM4 A;  1TN9 A;  2EPR A;  2WBS A;  1DGC A;  1YSA C;  1A1J A;  2RSI A;  2YTP A;  2ENH A;  2LT7 A;  2EM0 A;  1X5W A;  2EMC A;  1P47 A;  2CSH A;  4GZN C;  2EOE A;  2EL5 A;  1G2D C;  2EOI A;  2DLK A;  1X6H A;  2EMI A;  1YUI A;  2EMH A;  3M99 B;  2EOF A;  2EM6 A;  2EMY A;  2YSP A;  2EOZ A;  2YU5 A;  1F2I G;  4R2P A;  2EOH A;  2YTJ A;  1MEY C;  4FK5 C;  2DLQ A;  5KL4 A;  1A1H A;  2EL6 A;  2EMW A;  4F2J C; 
#chains in the Genus database with same CATH topology
 4RH8 A;  1Z1B A;  2EQ1 A;  4WXD A;  3BGH A;  2WBU A;  4Q35 B;  1T38 A;  1MGT A;  2MKD A;  1DI2 A;  1A1I A;  1BBO A;  2VRD A;  4B3R E;  2HC5 A;  3VYX A;  2YTF A;  2N3G A;  2FGG A;  3EPL A;  2LVH A;  4ZYE A;  1WXR A;  5KL7 A;  5LLQ A;  1X3C A;  3VHT B;  4DMI A;  2EN6 A;  1XMO E;  4BMJ A;  4WYQ B;  2JXP A;  1LLM C;  2VE7 C;  2EM3 A;  2ELY A;  3JU0 A;  2EM9 A;  2EN2 A;  2EN4 A;  4JI5 E;  2EOJ A;  3BF2 A;  1KJK A;  4DR7 E;  4JI3 E;  2LV2 A;  5A6B D;  5AAS A;  5IXM B;  4DV4 E;  3H09 A;  2KHX A;  3MHS C;  1HR0 E;  5BR8 E;  4JI8 E;  2EPA A;  1UIL A;  4WX9 A;  2EPM X;  2MKN A;  3L00 A;  1YUJ A;  1RC7 A;  4R2S A;  2LCE A;  2E1M A;  2D9H A;  1A1K A;  2JOX A;  4TUI A;  5KL3 A;  4WFT A;  2A25 A;  3MHH C;  2EJ4 A;  4ZYG A;  3ADJ A;  4M2Z A;  3ADI A;  4R2E A;  4BHB A;  4X8W A;  2EPO A;  4NZV A;  2JPA A;  2EMB A;  2V88 A;  2VQF E;  3C6M A;  4JI7 E;  2ENC A;  2UU9 E;  4OX9 E;  1G2F C;  1KYQ A;  2EM5 A;  5IT9 C;  2EM7 A;  2EML A;  3EPH A;  4GKK E;  2M9A A;  2H36 X;  2EOM A;  1T39 A;  4IJD A;  3LML A;  1PJS A;  3THO B;  2NUF A;  1ZU1 A;  1UHZ A;  1X48 A;  5FLX C;  4J8Z A;  2EPR A;  1IBM E;  1A1J A;  1YSA C;  2EM0 A;  1X5W A;  1IBK E;  1P47 A;  1G2D C;  4DR2 E;  2EOI A;  1X6H A;  4JI4 E;  4DV3 E;  3M99 B;  2NA2 A;  2EOF A;  2EM6 A;  2KOU A;  2YSP A;  2FTX B;  4X64 E;  2V86 A;  2YZT A;  2DLQ A;  1RQ0 A;  4O43 A;  5KL4 A;  2V85 A;  1WHQ A;  1NCS A;  4JYA E;  2L2N A;  4O4K A;  3OTO E;  1HNX E;  2EQ0 A;  1O0W A;  4DR5 E;  3EQ1 A;  2ODR C;  4O5G A;  1PDA A;  4DR1 E;  3VYY A;  5LMN E;  3KZY A;  1GTK A;  2EPK X;  1B69 A;  2B7V A;  1A1G A;  2NUE A;  4F9A B;  4MLQ A;  1SR9 A;  2EOQ A;  2LBS B;  2M1S A;  3AV0 A;  2EZ6 A;  2UXB E;  5A6K A;  2R1F A;  3EPK A;  2EM2 A;  5IV8 B;  1ZR9 A;  4B3M E;  1WHN A;  2LMZ A;  2YTE A;  2LO3 A;  2YTN A;  2DSY A;  4BCA A;  2ADR A;  5A69 A;  2DGC A;  4K0K E;  2JWO A;  3UK3 C;  4Q28 A;  2JY9 A;  1X47 A;  3LLH A;  4X66 E;  1TF6 A;  2EMK A;  2EOS A;  4BC9 A;  2DRP A;  1BBG A;  1TF3 A;  4I8O A;  2DB2 A;  5DNY A;  3ADL A;  2YTQ A;  2EP3 A;  2RTX A;  3BBG A;  1N32 E;  1AH5 A;  2E72 A;  3DJW A;  5IWA E;  4KWY A;  4WSG A;  2V87 A;  1A1L A;  1BB8 A;  2V89 A;  1YZ9 A;  1PJT A;  4M0V A;  4LFC E;  2LTS A;  1YPN A;  2B9D A;  2V83 A;  4F54 A;  3BID A;  3MSW A;  2MC6 A;  2YTG A;  2BBG A;  5CFF E;  4LF4 E;  2K7I A;  2LJH A;  1HNZ E;  2F8B A;  1TN9 A;  3HPZ A;  2WBS A;  2ZM6 E;  1DGC A;  2RSI A;  3KZZ A;  2EMC A;  2IHR 1;  2EOE A;  2DLK A;  2EMI A;  1YUI A;  3F6G A;  3THN A;  2HHH E;  4JI1 E;  1I94 E;  4GKJ E;  2EMY A;  2V8Q B;  2EOZ A;  2YU5 A;  1F2I G;  2RQL A;  4R2P A;  1ZBT A;  1EH7 A;  2YTJ A;  1MEY C;  3C4B A;  5LL6 R;  4BS9 A;  2VQE E;  2FV4 B;  2EMW A;  4L5N C;  4LF8 E;  4YY3 E;  1EKZ A;  5ADZ A;  4RHB B;  4DV2 E;  2UXC E;  4IS1 C;  3JAM C;  4DV1 E;  4NXN E;  2EMX A;  2ELZ A;  2M4I A;  2DIX A;  2NAB A;  3OML A;  2L33 A;  4LTY A;  3TQM A;  2R76 A;  5AE2 A;  2YU8 A;  2EMZ A;  4JI2 E;  4L8N A;  2EPN A;  4OOG C;  2B3T B;  4R03 A;  1WRJ A;  2EN1 A;  1IQS A;  2YRK A;  1FKA E;  2JR1 A;  2YRM A;  4O24 A;  2RS6 A;  4R8O A;  2L92 A;  4R2R A;  2I13 A;  2EE8 A;  3HXL A;  3ECR A;  3HPS A;  4P78 A;  4R2Q A;  4KHP E;  1J26 A;  3C4T A;  2E5L E;  2L3J A;  2EMA A;  2RS7 A;  4LF5 E;  1JK1 A;  2N3H A;  2CPN A;  2CTD A;  3F6H A;  1N36 E;  4BBY A;  4ZYD A;  5KL2 A;  4B3T E;  1T4N A;  4DV7 E;  1AAY A;  2YTI A;  1X49 A;  2EOR A;  2DMI A;  4R2A A;  1QNT A;  2J7J A;  2LJU A;  2EL4 A;  1ZAA C;  1N3G A;  4X65 E;  2WBT A;  1L4S A;  2YTD A;  2N8X A;  4DV6 E;  4M30 A;  2JOB A;  3J81 C;  2I9I A;  4GEQ B;  4F9B B;  4JV5 E;  2ODR D;  2EPX A;  4F6M A;  2PRT A;  2Q8U A;  4R2D A;  2UUB E;  4N4R B;  1EH8 A;  1IQO A;  1WJP A;  4WXC A;  3AUZ A;  5KL5 A;  3P1X A;  4DR6 E;  4NHR A;  2DMY A;  1YFH A;  4AQY E;  1J5E E;  1PKP A;  2EM8 A;  4DR3 E;  3IWC A;  2G7H A;  4JI0 E;  3EPJ A;  5AE1 A;  1NEI A;  3HQ1 A;  3FIG A;  2B7T A;  2JYA A;  4GZN C;  2EL5 A;  2EMH A;  5TSE A;  1T4O A;  4WPY A;  3DF6 A;  4BHC A;  4F9C B;  2EOH A;  2LE2 A;  4KZS A;  1GZ6 A;  4FK5 C;  2NUG A;  4NXM E;  1A1H A;  2EL6 A;  4F2J C;  4LFB E;  2HJJ A;  1ZBQ A;  4HEI A;  4LF7 E;  1SFE A;  2GPI A;  1RMD A;  4WSP A;  3VK6 A;  3ZOQ B;  2YTO A;  2EPP A;  5A6J A;  2MDG A;  4LFA E;  2CT1 A;  2JP9 A;  3HTX A;  2MC5 A;  4P7D A;  2EPZ A;  1DQ3 A;  1STU A;  3JTZ A;  2WZO A;  5AC4 A;  2EOO A;  2RPC A;  4B3S E;  1X6F A;  2UXD E;  2UUC E;  1QU6 A;  2YPN A;  4TUG A;  5F3W A;  2EPC A;  2K4V A;  2HGH A;  4DUY E;  2M7Q A;  5AC5 A;  5A6A A;  3K6Q A;  2WCC 3;  2GHF A;  1UN6 B;  4DV0 E;  2EPL X;  1EH6 A;  3J7A G;  2GLI A;  1JK2 A;  2UUA E;  2YWQ A;  4F6N A;  1YYO A;  2ENA A;  2LRS A;  2YSO A;  4X62 E;  1N33 E;  3T1H E;  1UBD C;  2EMF A;  2L2M A;  4DV5 E;  4M9V C;  1IMU A;  3KWR A;  1IBL E;  1A1F A;  5A2Q C;  3ADG A;  2EN3 A;  2EMG A;  1YYK A;  2YT4 A;  4ZYH A;  5LMU E;  2L8T A;  1X6E A;  1XMQ E;  4HTG A;  2VF1 A;  1PJQ A;  4LU9 A;  4MLV A;  4R2C A;  1XNR E;  1HNW E;  2EN7 A;  2BB8 A;  2EQ3 A;  5T6J A;  3J80 C;  4LF6 E;  5KL6 A;  2LUQ A;  2EOY A;  1YYW A;  4DKK A;  2LUP B;  4DR4 E;  4X9J A;  3IWD A;  3J7Y p;  1T4L B;  2EWL A;  2EPU A;  3T1Y E;  3IWB A;  1XNQ E;  1FJG E;  4BC7 A;  2EN8 A;  3QG5 C;  2F4V E;  5AE3 A;  4LF9 E;  2YRH A;  2EOX A;  4JI6 E;  2L3C A;  2JVA A;  2L6M A;  1GQE A;  2EM4 A;  4YHH E;  2KON A;  2YTP A;  2ENH A;  2LT7 A;  1N34 E;  2CSH A;  4DUZ E;  2MDR A;  3RMP A;  5A6B A;  2LTR A;  2RSM A;  3C6K A;  2L2K B; 
#chains in the Genus database with same CATH homology
 1NCS A;  1RMD A;  2EQ1 A;  1Z1B A;  2EQ0 A;  2WBU A;  2YTO A;  2EPP A;  2MKD A;  4IS1 C;  2EMX A;  2ELZ A;  2MDG A;  2CT1 A;  2NAB A;  1A1I A;  2JP9 A;  2VRD A;  1BBO A;  2EPZ A;  2YTF A;  3EPL A;  2YU8 A;  2LVH A;  2EOO A;  2RPC A;  1X6F A;  2EMZ A;  5KL7 A;  1X3C A;  3VHT B;  2EN6 A;  2EPC A;  1B69 A;  1A1G A;  2EN1 A;  1LLM C;  2YRK A;  2HGH A;  2YRM A;  2EOQ A;  4R2R A;  2EM3 A;  2ELY A;  2EE8 A;  2GHF A;  2WCC 3;  2EM9 A;  2EN2 A;  2EN4 A;  4R2Q A;  2EOJ A;  2I13 A;  2R1F A;  3EPK A;  2EM2 A;  1KJK A;  1ZR9 A;  2GLI A;  1JK2 A;  2YTE A;  2EMA A;  2LO3 A;  2YTN A;  2LV2 A;  2ADR A;  1JK1 A;  2DGC A;  4F6N A;  2CTD A;  3UK3 C;  3MHS C;  2ENA A;  2YSO A;  5KL2 A;  1TF6 A;  2EMK A;  2EOS A;  2EPA A;  2EMF A;  1UBD C;  2DRP A;  2MKN A;  4M9V C;  1A1F A;  1TF3 A;  1AAY A;  2YTI A;  1YUJ A;  2EN3 A;  2EMG A;  2EOR A;  2DMI A;  4R2S A;  1UN6 B;  4R2A A;  2LCE A;  2D9H A;  2J7J A;  1A1K A;  1X6E A;  2YTQ A;  2EL4 A;  1ZAA C;  5KL3 A;  2EP3 A;  4R2C A;  2WBT A;  2A25 A;  3MHH C;  2EJ4 A;  2YTD A;  2EN7 A;  4R2E A;  2BB8 A;  2E72 A;  2EQ3 A;  5KL6 A;  4WSG A;  1A1L A;  2EOY A;  1BB8 A;  2JPA A;  2EMB A;  4X9J A;  2EPX A;  2ENC A;  4F6M A;  2PRT A;  1G2F C;  2EM5 A;  4R2D A;  2EPU A;  1WJP A;  2EM7 A;  2EML A;  5KL5 A;  3EPH A;  2M9A A;  2EOM A;  2EN8 A;  2YTG A;  4IJD A;  2EM8 A;  2YRH A;  2EOX A;  1ZU1 A;  3EPJ A;  2EM4 A;  1TN9 A;  2EPR A;  2WBS A;  1DGC A;  1YSA C;  1A1J A;  2RSI A;  2YTP A;  2ENH A;  2LT7 A;  2EM0 A;  1X5W A;  2EMC A;  1P47 A;  2CSH A;  4GZN C;  2EOE A;  2EL5 A;  1G2D C;  2EOI A;  2DLK A;  1X6H A;  2EMI A;  1YUI A;  2EMH A;  3M99 B;  2EOF A;  2EM6 A;  2EMY A;  2YSP A;  2EOZ A;  2YU5 A;  1F2I G;  4R2P A;  2EOH A;  2YTJ A;  1MEY C;  4FK5 C;  2DLQ A;  5KL4 A;  1A1H A;  2EL6 A;  2EMW A;  4F2J C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...