2DMIA

Solution structure of the first and the second zf-c2h2 like domains of human teashirt homolog 3
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
115
structure length
115
Chain Sequence
GSSGSSGKLYGSIFTGASKFRCKDCSAAYDTLVELTVHMNETGHYRDDNHETDNNNPKRWSKPRKRSLLEMEGKEDAQKVLKCMYCGHSFESLQDLSVHMIKTKHYQKVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Teashirt homolog 3
publication title Solution structure of the first and the second zf-C2H2 like domains of human Teashirt homolog 3
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 15
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2006-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13912 zf-C2H2_6 C2H2-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2dmiA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2dmiA01
1ZU1A 2YRMA 2PRTA 2EOOA 4M9VC 2EE8A 2EOXA 2EQ1A 2ENCA 2MKDA 2EQ0A 2LT7A 2EMGA 3VHTB 1Z1BA 4R2SA 2YTFA 2EMKA 2EJ4A 2GLIA 2EMCA 2YTPA 2EPAA 2EMHA 2J7JA 2MDGA 2MKNA 2EMWA 4F6MA 3EPKA 2EMAA 1YUJA 1A1FA 2DMIA 2CSHA 2EN1A 2EM4A 2YU5A 4WSGA 5KL5A 2EN6A 2YU8A 1WJPA 2YRHA 4R2DA 3UK3C 1YUIA 2ENAA 1X3CA 2LV2A 2EN4A 1TF3A 3EPJA 4R2PA 2EMLA 1X6HA 2EN2A 2JPAA 2EM6A 2EL5A 2EL6A 2WBSA 1X6FA 4FK5C 4F6NA 2R1FA 1ZR9A 2EPZA 2EOJA 1NCSA 2EPPA 2CT1A 2E72A 1ZAAC 2I13A 2EORA 1B69A 2LO3A 2DRPA 2EN8A 2DGCA 1A1KA 2RSIA 2LCEA 5KL6A 4GZNC 2M9AA 2EM5A 1UN6B 2HGHA 2RPCA 2EMZA 2VRDA 2EOEA 2EOIA 2EM0A 2YSPA 1RMDA 2YTOA 1F2IG 2EN3A 4R2AA 1DGCA 2EOMA 2BB8A 5KL7A 1A1HA 1YSAC 2YTQA 4R2RA 2EM2A 2YTNA 2YTIA 4R2EA 1AAYA 2A25A 2EPXA 5KL2A 1A1GA 4IJDA 1JK1A 2EPUA 2EM7A 1JK2A 2NABA 2D9HA 1MEYC 3EPHA 2EPRA 3M99B 1X5WA 2EN7A 5KL3A 1P47A 2WCC3 1G2FC 2WBUA 1TN9A 1UBDC 2EMFA 1TF6A 2YTEA 1A1LA 2EP3A 4IS1C 2ADRA 4R2CA 2CTDA 2EQ3A 2DLQA 1KJKA 1BBOA 2EMYA 2EOYA 2EMXA 2ELZA 2EL4A 2DLKA 4X9JA 2EM3A 2YSOA 1LLMC 2EOQA 2ENHA 2WBTA 2EOZA 2LVHA 2EM9A 4R2QA 2YTDA 2EPCA 2YRKA 2EOFA 5KL4A 2EMBA 2EM8A 1X6EA 1G2DC 1A1IA 2GHFA 2YTGA 3MHSC 3EPLA 2ELYA 1A1JA 2EOHA 2EMIA 2EOSA 1BB8A 2YTJA 4F2JC 3MHHC 2JP9A
chains in the Genus database with same CATH superfamily
1ZU1A 4L8NA 2EOXA 4BMJA 4I8OA 1J5EE 1Z1BA 2HJJA 2YTFA 2DIXA 3JU0A 3QG5C 2GLIA 3J7AG 2EMCA 2EMWA 2EPLX 2RS7A 3EPKA 4F6MA 2JWOA 1A1FA 4R8OA 2EM4A 2YU8A 1WJPA 1BBGA 2YT4A 3VK6A 5T6JA 2EN4A 1TF3A 1X6HA 4DV1E 2EN2A 2BBGA 2K7IA 3ADGA 2E5LE 4GKJE 2EM6A 2ODRC 3HPZA 5AE1A 1I94E 5TSEA 2HC5A 1T4NA 2F8BA 2V85A 4WSPA 1IMUA 2EPPA 2KONA 1ZAAC 2E72A 2DRPA 4WFTA 2VE7C 2V86A 2LUQA 4P78A 3KZZA 3BIDA 5A2QC 4NXME 1EH8A 4M0VA 4MLQA 1PKPA 5KL7A 1YSAC 4O43A 2YTQA 2LRSA 1QU6A 1J26A 1AAYA 2A25A 2LUPB 1IQSA 4IJDA 2FGGA 1ZBTA 1JK1A 1WHNA 4JI3E 1N34E 2EN7A 1P47A 4ZYEA 2WCC3 1G2FC 1UBDC 2LMZA 2MC6A 3P1XA 4X66E 1A1LA 4R2CA 4KZSA 2CPNA 2JVAA 2DLQA 3VYYA 3J81C 1DI2A 2IHR1 4WXDA 2HHHE 2DMYA 3F6HA 1EKZA 3DF6A 4F9BB 1YZ9A 4BS9A 2LVHA 2NUEA 1QNTA 4R2QA 2L3JA 2L92A 4DR2E 2EOFA 2EMBA 2VF1A 3HQ1A 2VQFE 2RSMA 3DJWA 2B3TB 3MHHC 5LMUE 4KHPE 2YRMA 5A6KA 2EE8A 2EQ1A 2ENCA 2NA2A 2LT7A 2K4VA 4R2SA 2RQLA 2YTPA 1YFHA 3T1YE 2V89A 4YHHE 1XMOE 2NUGA 4DR7E 3IWDA 2UU9E 1EH6A 5LMNE 1YUIA 4DR3E 2YZTA 4X8WA 3LMLA 2JPAA 2EL5A 2JOXA 4LFAE 2UXCE 2RTXA 2WZOA 2R1FA 4LF7E 4J8ZA 1SFEA 2H36X 2EPZA 2EOJA 4AQYE 4LF8E 2I13A 2EORA 4HEIA 2EPMX 3C4TA 4DV7E 4M30A 1HR0E 1A1KA 2LCEA 4JI5E 5KL6A 1X49A 2B9DA 4DV0E 4F54A 2M9AA 4GZNC 3THOB 1IQOA 2VRDA 2EOEA 2EOIA 1F2IG 3MSWA 2EN3A 5A6JA 2EOMA 2BB8A 2M1SA 2V88A 4HTGA 1EH7A 3AV0A 1FJGE 5KL2A 4X65E 4LF5E 4JI7E 5A6BD 4TUIA 5AC5A 2NABA 3F6GA 4R03A 2D9HA 1MEYC 2UXBE 1PDAA 1WXRA 4F9CB 3THNA 2EMFA 2YTEA 1IBME 4DR6E 2ADRA 2L3CA 2L8TA 1KJKA 1BBOA 2EMYA 3KWRA 4JI0E 2EOYA 2ZM6E 3ZOQB 1UILA 4O4KA 3BGHA 4GEQB 4ZYDA 4BBYA 2WBTA 2EOZA 2MC5A 2B7VA 1T38A 4L5NC 2JYAA 5AC4A 2GHFA 2YTGA 3MHSC 3AUZA 3EPLA 1XMQE 2EOHA 5A6BA 2DSYA 5IT9C 2UUCE 2DB2A 4M2ZA 2UUBE 4B3TE 3ADJA 2PRTA 4BHBA 5IXMB 4JI6E 3JTZA 3VHTB 1DQ3A 2EMKA 4DV6E 3OTOE 3C6KA 2EPAA 2EMHA 2R76A 5AASA 4DR5E 5IV8B 1YUJA 2E1MA 1GTKA 2CSHA 2EN1A 4WSGA 3J80C 2MDRA 1FKAE 2ODRD 2YRHA 3K6QA 2RS6A 2YWQA 5FLXC 4R2DA 3UK3C 1X3CA 2EMLA 4NHRA 4WPYA 2EWLA 4JI1E 1IBLE 2WBSA 2YPNA 1X6FA 2B7TA 4FK5C 4F6NA 3LLHA 2LBSB 2EZ6A 5IWAE 3OMLA 4LU9A 4JV5E 2UXDE 3L00A 3T1HE 1B69A 2LO3A 4LFBE 5F3WA 2DGCA 4Q35B 3C4BA 3BF2A 3IWCA 1HNXE 5LL6R 1IBKE 2YSPA 2EM0A 5A69A 1RMDA 2Q8UA 4N4RB 1A1HA 4R2RA 1NEIA 3HPSA 1YPNA 2YTIA 2EPXA 2V8QB 1A1GA 1L4SA 4MLVA 1PJTA 2EPNA 2F4VE 1JK2A 2EPRA 3M99B 5KL3A 4O24A 1YYWA 2WBUA 1TN9A 4OOGC 1N33E 3BBGA 4NZVA 4DV5E 2G7HA 1GZ6A 4KWYA 1T4OA 1RC7A 5AE3A 2M7QA 1HNZE 5LLQA 2LTSA 2ELZA 2EL4A 2EM3A 1MGTA 1X48A 3J7Yp 2LE2A 2L6MA 2ENHA 4DV4E 4ZYGA 3HTXA 5DNYA 4LF4E 2EM9A 1N32E 2FV4B 3IWBA 2YTDA 2YRKA 4YY3E 1RQ0A 2EM8A 2KHXA 2N3GA 2FTXB 1A1IA 1T39A 2ELYA 2EMIA 2I9IA 1WRJA 4LF6E 2JY9A 1PJQA 1BB8A 2JXPA 2N3HA 1YYKA 2JP9A 3ADLA 2EOOA 2UUAE 4M9VC 1XNRE 2L33A 2MKDA 2EQ0A 2EMGA 3KZYA 5BR8E 2EJ4A 4DKKA 3JAMC 4BC9A 4DV2E 4DR4E 2J7JA 4LTYA 2MDGA 2MKNA 4DUZE 4B3RE 4DUYE 4GKKE 2EMAA 1HNWE 5ADZA 1N3GA 2DMIA 2YU5A 5KL5A 3VYXA 2L2KB 2EN6A 4DV3E 4BC7A 2LJHA 4WXCA 2ENAA 2LV2A 5AE2A 3EPJA 2JOBA 4R2PA 4LF9E 2EL6A 4NXNE 1ZBQA 1ZR9A 1NCSA 2CT1A 4DR1E 1X47A 2EN8A 2EPKX 3EQ1A 1WHQA 2RSIA 4BCAA 2EM5A 5A6AA 1UN6B 2HGHA 2M4IA 2RPCA 2EMZA 4JI8E 4RH8A 3TQMA 3RMPA 3ADIA 2YTOA 3FIGA 4B3ME 4R2AA 1DGCA 3H09A 4F9AB 2V83A 1AH5A 1O0WA 2EM2A 2YTNA 4X64E 1STUA 4R2EA 2L2MA 4O5GA 4WX9A 4OX9E 4ZYHA 4Q28A 4WYQB 2EPUA 2EM7A 1XNQE 3EPHA 4JI4E 3ECRA 1X5WA 2LJUA 4B3SE 4JYAE 1TF6A 4P7DA 2GPIA 2EP3A 4IS1C 3HXLA 2CTDA 2V87A 2NUFA 2EQ3A 4RHBB 4TUGA 2EMXA 1UHZA 2DLKA 2VQEE 4DMIA 4X9JA 1GQEA 1KYQA 4X62E 2YSOA 2JR1A 1YYOA 1LLMC 2EOQA 4JI2E 4LFCE 1N36E 2KOUA 2EPCA 1T4LB 5KL4A 1X6EA 3C6MA 4BHCA 1G2DC 1PJSA 1A1JA 2LTRA 2L2NA 2EOSA 2EPOA 5CFFE 2N8XA 2YTJA 4K0KE 4F2JC 1SR9A
chains in the Genus database with same CATH topology
1ZU1A 2YRMA 2PRTA 2EOOA 4M9VC 2EE8A 2EOXA 2EQ1A 2ENCA 2MKDA 2EQ0A 2LT7A 2EMGA 3VHTB 1Z1BA 4R2SA 2YTFA 2EMKA 2EJ4A 2GLIA 2EMCA 2YTPA 2EPAA 2EMHA 2J7JA 2MDGA 2MKNA 2EMWA 4F6MA 3EPKA 2EMAA 1YUJA 1A1FA 2DMIA 2CSHA 2EN1A 2EM4A 2YU5A 4WSGA 5KL5A 2EN6A 2YU8A 1WJPA 2YRHA 4R2DA 3UK3C 1YUIA 2ENAA 1X3CA 2LV2A 2EN4A 1TF3A 3EPJA 4R2PA 2EMLA 1X6HA 2EN2A 2JPAA 2EM6A 2EL5A 2EL6A 2WBSA 1X6FA 4FK5C 4F6NA 2R1FA 1ZR9A 2EPZA 2EOJA 1NCSA 2EPPA 2CT1A 2E72A 1ZAAC 2I13A 2EORA 1B69A 2LO3A 2DRPA 2EN8A 2DGCA 1A1KA 2RSIA 2LCEA 5KL6A 4GZNC 2M9AA 2EM5A 1UN6B 2HGHA 2RPCA 2EMZA 2VRDA 2EOEA 2EOIA 2EM0A 2YSPA 1RMDA 2YTOA 1F2IG 2EN3A 4R2AA 1DGCA 2EOMA 2BB8A 5KL7A 1A1HA 1YSAC 2YTQA 4R2RA 2EM2A 2YTNA 2YTIA 4R2EA 1AAYA 2A25A 2EPXA 5KL2A 1A1GA 4IJDA 1JK1A 2EPUA 2EM7A 1JK2A 2NABA 2D9HA 1MEYC 3EPHA 2EPRA 3M99B 1X5WA 2EN7A 5KL3A 1P47A 2WCC3 1G2FC 2WBUA 1TN9A 1UBDC 2EMFA 1TF6A 2YTEA 1A1LA 2EP3A 4IS1C 2ADRA 4R2CA 2CTDA 2EQ3A 2DLQA 1KJKA 1BBOA 2EMYA 2EOYA 2EMXA 2ELZA 2EL4A 2DLKA 4X9JA 2EM3A 2YSOA 1LLMC 2EOQA 2ENHA 2WBTA 2EOZA 2LVHA 2EM9A 4R2QA 2YTDA 2EPCA 2YRKA 2EOFA 5KL4A 2EMBA 2EM8A 1X6EA 1G2DC 1A1IA 2GHFA 2YTGA 3MHSC 3EPLA 2ELYA 1A1JA 2EOHA 2EMIA 2EOSA 1BB8A 2YTJA 4F2JC 3MHHC 2JP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZU1 A;  2YRM A;  2PRT A;  2EOO A;  4M9V C;  2EE8 A;  2EOX A;  2EQ1 A;  2ENC A;  2MKD A;  2EQ0 A;  2LT7 A;  2EMG A;  3VHT B;  1Z1B A;  4R2S A;  2YTF A;  2EMK A;  2EJ4 A;  2GLI A;  2EMC A;  2YTP A;  2EPA A;  2EMH A;  2J7J A;  2MDG A;  2MKN A;  2EMW A;  4F6M A;  3EPK A;  2EMA A;  1YUJ A;  1A1F A;  2DMI A;  2CSH A;  2EN1 A;  2EM4 A;  2YU5 A;  4WSG A;  5KL5 A;  2EN6 A;  2YU8 A;  1WJP A;  2YRH A;  4R2D A;  3UK3 C;  1YUI A;  2ENA A;  1X3C A;  2LV2 A;  2EN4 A;  1TF3 A;  3EPJ A;  4R2P A;  2EML A;  1X6H A;  2EN2 A;  2JPA A;  2EM6 A;  2EL5 A;  2EL6 A;  2WBS A;  1X6F A;  4FK5 C;  4F6N A;  2R1F A;  1ZR9 A;  2EPZ A;  2EOJ A;  1NCS A;  2EPP A;  2CT1 A;  2E72 A;  1ZAA C;  2I13 A;  2EOR A;  1B69 A;  2LO3 A;  2DRP A;  2EN8 A;  2DGC A;  1A1K A;  2RSI A;  2LCE A;  5KL6 A;  4GZN C;  2M9A A;  2EM5 A;  1UN6 B;  2HGH A;  2RPC A;  2EMZ A;  2VRD A;  2EOE A;  2EOI A;  2EM0 A;  2YSP A;  1RMD A;  2YTO A;  1F2I G;  2EN3 A;  4R2A A;  1DGC A;  2EOM A;  2BB8 A;  5KL7 A;  1A1H A;  1YSA C;  2YTQ A;  4R2R A;  2EM2 A;  2YTN A;  2YTI A;  4R2E A;  1AAY A;  2A25 A;  2EPX A;  5KL2 A;  1A1G A;  4IJD A;  1JK1 A;  2EPU A;  2EM7 A;  1JK2 A;  2NAB A;  2D9H A;  1MEY C;  3EPH A;  2EPR A;  3M99 B;  1X5W A;  2EN7 A;  5KL3 A;  1P47 A;  2WCC 3;  1G2F C;  2WBU A;  1TN9 A;  1UBD C;  2EMF A;  1TF6 A;  2YTE A;  1A1L A;  2EP3 A;  4IS1 C;  2ADR A;  4R2C A;  2CTD A;  2EQ3 A;  2DLQ A;  1KJK A;  1BBO A;  2EMY A;  2EOY A;  2EMX A;  2ELZ A;  2EL4 A;  2DLK A;  4X9J A;  2EM3 A;  2YSO A;  1LLM C;  2EOQ A;  2ENH A;  2WBT A;  2EOZ A;  2LVH A;  2EM9 A;  4R2Q A;  2YTD A;  2EPC A;  2YRK A;  2EOF A;  5KL4 A;  2EMB A;  2EM8 A;  1X6E A;  1G2D C;  1A1I A;  2GHF A;  2YTG A;  3MHS C;  3EPL A;  2ELY A;  1A1J A;  2EOH A;  2EMI A;  2EOS A;  1BB8 A;  2YTJ A;  4F2J C;  3MHH C;  2JP9 A; 
#chains in the Genus database with same CATH topology
 1ZU1 A;  4L8N A;  2EOX A;  4BMJ A;  4I8O A;  1J5E E;  1Z1B A;  2HJJ A;  2YTF A;  2DIX A;  3JU0 A;  3QG5 C;  2GLI A;  3J7A G;  2EMC A;  2EMW A;  2EPL X;  2RS7 A;  3EPK A;  4F6M A;  2JWO A;  1A1F A;  4R8O A;  2EM4 A;  2YU8 A;  1WJP A;  1BBG A;  2YT4 A;  3VK6 A;  5T6J A;  2EN4 A;  1TF3 A;  1X6H A;  4DV1 E;  2EN2 A;  2BBG A;  2K7I A;  3ADG A;  2E5L E;  4GKJ E;  2EM6 A;  2ODR C;  3HPZ A;  5AE1 A;  1I94 E;  5TSE A;  2HC5 A;  1T4N A;  2F8B A;  2V85 A;  4WSP A;  1IMU A;  2EPP A;  2KON A;  1ZAA C;  2E72 A;  2DRP A;  4WFT A;  2VE7 C;  2V86 A;  2LUQ A;  4P78 A;  3KZZ A;  3BID A;  5A2Q C;  4NXM E;  1EH8 A;  4M0V A;  4MLQ A;  1PKP A;  5KL7 A;  1YSA C;  4O43 A;  2YTQ A;  2LRS A;  1QU6 A;  1J26 A;  1AAY A;  2A25 A;  2LUP B;  1IQS A;  4IJD A;  2FGG A;  1ZBT A;  1JK1 A;  1WHN A;  4JI3 E;  1N34 E;  2EN7 A;  1P47 A;  4ZYE A;  2WCC 3;  1G2F C;  1UBD C;  2LMZ A;  2MC6 A;  3P1X A;  4X66 E;  1A1L A;  4R2C A;  4KZS A;  2CPN A;  2JVA A;  2DLQ A;  3VYY A;  3J81 C;  1DI2 A;  2IHR 1;  4WXD A;  2HHH E;  2DMY A;  3F6H A;  1EKZ A;  3DF6 A;  4F9B B;  1YZ9 A;  4BS9 A;  2LVH A;  2NUE A;  1QNT A;  4R2Q A;  2L3J A;  2L92 A;  4DR2 E;  2EOF A;  2EMB A;  2VF1 A;  3HQ1 A;  2VQF E;  2RSM A;  3DJW A;  2B3T B;  3MHH C;  5LMU E;  4KHP E;  2YRM A;  5A6K A;  2EE8 A;  2EQ1 A;  2ENC A;  2NA2 A;  2LT7 A;  2K4V A;  4R2S A;  2RQL A;  2YTP A;  1YFH A;  3T1Y E;  2V89 A;  4YHH E;  1XMO E;  2NUG A;  4DR7 E;  3IWD A;  2UU9 E;  1EH6 A;  5LMN E;  1YUI A;  4DR3 E;  2YZT A;  4X8W A;  3LML A;  2JPA A;  2EL5 A;  2JOX A;  4LFA E;  2UXC E;  2RTX A;  2WZO A;  2R1F A;  4LF7 E;  4J8Z A;  1SFE A;  2H36 X;  2EPZ A;  2EOJ A;  4AQY E;  4LF8 E;  2I13 A;  2EOR A;  4HEI A;  2EPM X;  3C4T A;  4DV7 E;  4M30 A;  1HR0 E;  1A1K A;  2LCE A;  4JI5 E;  5KL6 A;  1X49 A;  2B9D A;  4DV0 E;  4F54 A;  2M9A A;  4GZN C;  3THO B;  1IQO A;  2VRD A;  2EOE A;  2EOI A;  1F2I G;  3MSW A;  2EN3 A;  5A6J A;  2EOM A;  2BB8 A;  2M1S A;  2V88 A;  4HTG A;  1EH7 A;  3AV0 A;  1FJG E;  5KL2 A;  4X65 E;  4LF5 E;  4JI7 E;  5A6B D;  4TUI A;  5AC5 A;  2NAB A;  3F6G A;  4R03 A;  2D9H A;  1MEY C;  2UXB E;  1PDA A;  1WXR A;  4F9C B;  3THN A;  2EMF A;  2YTE A;  1IBM E;  4DR6 E;  2ADR A;  2L3C A;  2L8T A;  1KJK A;  1BBO A;  2EMY A;  3KWR A;  4JI0 E;  2EOY A;  2ZM6 E;  3ZOQ B;  1UIL A;  4O4K A;  3BGH A;  4GEQ B;  4ZYD A;  4BBY A;  2WBT A;  2EOZ A;  2MC5 A;  2B7V A;  1T38 A;  4L5N C;  2JYA A;  5AC4 A;  2GHF A;  2YTG A;  3MHS C;  3AUZ A;  3EPL A;  1XMQ E;  2EOH A;  5A6B A;  2DSY A;  5IT9 C;  2UUC E;  2DB2 A;  4M2Z A;  2UUB E;  4B3T E;  3ADJ A;  2PRT A;  4BHB A;  5IXM B;  4JI6 E;  3JTZ A;  3VHT B;  1DQ3 A;  2EMK A;  4DV6 E;  3OTO E;  3C6K A;  2EPA A;  2EMH A;  2R76 A;  5AAS A;  4DR5 E;  5IV8 B;  1YUJ A;  2E1M A;  1GTK A;  2CSH A;  2EN1 A;  4WSG A;  3J80 C;  2MDR A;  1FKA E;  2ODR D;  2YRH A;  3K6Q A;  2RS6 A;  2YWQ A;  5FLX C;  4R2D A;  3UK3 C;  1X3C A;  2EML A;  4NHR A;  4WPY A;  2EWL A;  4JI1 E;  1IBL E;  2WBS A;  2YPN A;  1X6F A;  2B7T A;  4FK5 C;  4F6N A;  3LLH A;  2LBS B;  2EZ6 A;  5IWA E;  3OML A;  4LU9 A;  4JV5 E;  2UXD E;  3L00 A;  3T1H E;  1B69 A;  2LO3 A;  4LFB E;  5F3W A;  2DGC A;  4Q35 B;  3C4B A;  3BF2 A;  3IWC A;  1HNX E;  5LL6 R;  1IBK E;  2YSP A;  2EM0 A;  5A69 A;  1RMD A;  2Q8U A;  4N4R B;  1A1H A;  4R2R A;  1NEI A;  3HPS A;  1YPN A;  2YTI A;  2EPX A;  2V8Q B;  1A1G A;  1L4S A;  4MLV A;  1PJT A;  2EPN A;  2F4V E;  1JK2 A;  2EPR A;  3M99 B;  5KL3 A;  4O24 A;  1YYW A;  2WBU A;  1TN9 A;  4OOG C;  1N33 E;  3BBG A;  4NZV A;  4DV5 E;  2G7H A;  1GZ6 A;  4KWY A;  1T4O A;  1RC7 A;  5AE3 A;  2M7Q A;  1HNZ E;  5LLQ A;  2LTS A;  2ELZ A;  2EL4 A;  2EM3 A;  1MGT A;  1X48 A;  3J7Y p;  2LE2 A;  2L6M A;  2ENH A;  4DV4 E;  4ZYG A;  3HTX A;  5DNY A;  4LF4 E;  2EM9 A;  1N32 E;  2FV4 B;  3IWB A;  2YTD A;  2YRK A;  4YY3 E;  1RQ0 A;  2EM8 A;  2KHX A;  2N3G A;  2FTX B;  1A1I A;  1T39 A;  2ELY A;  2EMI A;  2I9I A;  1WRJ A;  4LF6 E;  2JY9 A;  1PJQ A;  1BB8 A;  2JXP A;  2N3H A;  1YYK A;  2JP9 A;  3ADL A;  2EOO A;  2UUA E;  4M9V C;  1XNR E;  2L33 A;  2MKD A;  2EQ0 A;  2EMG A;  3KZY A;  5BR8 E;  2EJ4 A;  4DKK A;  3JAM C;  4BC9 A;  4DV2 E;  4DR4 E;  2J7J A;  4LTY A;  2MDG A;  2MKN A;  4DUZ E;  4B3R E;  4DUY E;  4GKK E;  2EMA A;  1HNW E;  5ADZ A;  1N3G A;  2DMI A;  2YU5 A;  5KL5 A;  3VYX A;  2L2K B;  2EN6 A;  4DV3 E;  4BC7 A;  2LJH A;  4WXC A;  2ENA A;  2LV2 A;  5AE2 A;  3EPJ A;  2JOB A;  4R2P A;  4LF9 E;  2EL6 A;  4NXN E;  1ZBQ A;  1ZR9 A;  1NCS A;  2CT1 A;  4DR1 E;  1X47 A;  2EN8 A;  2EPK X;  3EQ1 A;  1WHQ A;  2RSI A;  4BCA A;  2EM5 A;  5A6A A;  1UN6 B;  2HGH A;  2M4I A;  2RPC A;  2EMZ A;  4JI8 E;  4RH8 A;  3TQM A;  3RMP A;  3ADI A;  2YTO A;  3FIG A;  4B3M E;  4R2A A;  1DGC A;  3H09 A;  4F9A B;  2V83 A;  1AH5 A;  1O0W A;  2EM2 A;  2YTN A;  4X64 E;  1STU A;  4R2E A;  2L2M A;  4O5G A;  4WX9 A;  4OX9 E;  4ZYH A;  4Q28 A;  4WYQ B;  2EPU A;  2EM7 A;  1XNQ E;  3EPH A;  4JI4 E;  3ECR A;  1X5W A;  2LJU A;  4B3S E;  4JYA E;  1TF6 A;  4P7D A;  2GPI A;  2EP3 A;  4IS1 C;  3HXL A;  2CTD A;  2V87 A;  2NUF A;  2EQ3 A;  4RHB B;  4TUG A;  2EMX A;  1UHZ A;  2DLK A;  2VQE E;  4DMI A;  4X9J A;  1GQE A;  1KYQ A;  4X62 E;  2YSO A;  2JR1 A;  1YYO A;  1LLM C;  2EOQ A;  4JI2 E;  4LFC E;  1N36 E;  2KOU A;  2EPC A;  1T4L B;  5KL4 A;  1X6E A;  3C6M A;  4BHC A;  1G2D C;  1PJS A;  1A1J A;  2LTR A;  2L2N A;  2EOS A;  2EPO A;  5CFF E;  2N8X A;  2YTJ A;  4K0K E;  4F2J C;  1SR9 A; 
#chains in the Genus database with same CATH homology
 1ZU1 A;  2YRM A;  2PRT A;  2EOO A;  4M9V C;  2EE8 A;  2EOX A;  2EQ1 A;  2ENC A;  2MKD A;  2EQ0 A;  2LT7 A;  2EMG A;  3VHT B;  1Z1B A;  4R2S A;  2YTF A;  2EMK A;  2EJ4 A;  2GLI A;  2EMC A;  2YTP A;  2EPA A;  2EMH A;  2J7J A;  2MDG A;  2MKN A;  2EMW A;  4F6M A;  3EPK A;  2EMA A;  1YUJ A;  1A1F A;  2DMI A;  2CSH A;  2EN1 A;  2EM4 A;  2YU5 A;  4WSG A;  5KL5 A;  2EN6 A;  2YU8 A;  1WJP A;  2YRH A;  4R2D A;  3UK3 C;  1YUI A;  2ENA A;  1X3C A;  2LV2 A;  2EN4 A;  1TF3 A;  3EPJ A;  4R2P A;  2EML A;  1X6H A;  2EN2 A;  2JPA A;  2EM6 A;  2EL5 A;  2EL6 A;  2WBS A;  1X6F A;  4FK5 C;  4F6N A;  2R1F A;  1ZR9 A;  2EPZ A;  2EOJ A;  1NCS A;  2EPP A;  2CT1 A;  2E72 A;  1ZAA C;  2I13 A;  2EOR A;  1B69 A;  2LO3 A;  2DRP A;  2EN8 A;  2DGC A;  1A1K A;  2RSI A;  2LCE A;  5KL6 A;  4GZN C;  2M9A A;  2EM5 A;  1UN6 B;  2HGH A;  2RPC A;  2EMZ A;  2VRD A;  2EOE A;  2EOI A;  2EM0 A;  2YSP A;  1RMD A;  2YTO A;  1F2I G;  2EN3 A;  4R2A A;  1DGC A;  2EOM A;  2BB8 A;  5KL7 A;  1A1H A;  1YSA C;  2YTQ A;  4R2R A;  2EM2 A;  2YTN A;  2YTI A;  4R2E A;  1AAY A;  2A25 A;  2EPX A;  5KL2 A;  1A1G A;  4IJD A;  1JK1 A;  2EPU A;  2EM7 A;  1JK2 A;  2NAB A;  2D9H A;  1MEY C;  3EPH A;  2EPR A;  3M99 B;  1X5W A;  2EN7 A;  5KL3 A;  1P47 A;  2WCC 3;  1G2F C;  2WBU A;  1TN9 A;  1UBD C;  2EMF A;  1TF6 A;  2YTE A;  1A1L A;  2EP3 A;  4IS1 C;  2ADR A;  4R2C A;  2CTD A;  2EQ3 A;  2DLQ A;  1KJK A;  1BBO A;  2EMY A;  2EOY A;  2EMX A;  2ELZ A;  2EL4 A;  2DLK A;  4X9J A;  2EM3 A;  2YSO A;  1LLM C;  2EOQ A;  2ENH A;  2WBT A;  2EOZ A;  2LVH A;  2EM9 A;  4R2Q A;  2YTD A;  2EPC A;  2YRK A;  2EOF A;  5KL4 A;  2EMB A;  2EM8 A;  1X6E A;  1G2D C;  1A1I A;  2GHF A;  2YTG A;  3MHS C;  3EPL A;  2ELY A;  1A1J A;  2EOH A;  2EMI A;  2EOS A;  1BB8 A;  2YTJ A;  4F2J C;  3MHH C;  2JP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...