2DMIA

Solution structure of the first and the second zf-c2h2 like domains of human teashirt homolog 3
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
115
structure length
115
Chain Sequence
GSSGSSGKLYGSIFTGASKFRCKDCSAAYDTLVELTVHMNETGHYRDDNHETDNNNPKRWSKPRKRSLLEMEGKEDAQKVLKCMYCGHSFESLQDLSVHMIKTKHYQKVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Teashirt homolog 3
publication title Solution structure of the first and the second zf-C2H2 like domains of human Teashirt homolog 3
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 15
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2006-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13912 zf-C2H2_6 C2H2-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2dmiA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2dmiA01
4GZNC 2EOZA 1JK2A 4IJDA 2WBTA 2EOYA 2LCEA 3EPKA 1LLMC 2E72A 2EPRA 2EMWA 2WCC3 2MDGA 2EOQA 2RSIA 2EMZA 1A1GA 2EQ0A 2A25A 4F6NA 2EM9A 4FK5C 2YRMA 2YTJA 1G2DC 2EM2A 2EL4A 2EMIA 2EP3A 1YUIA 2EM3A 1B69A 5KL6A 1A1JA 1X6HA 2EN8A 4R2SA 2YTIA 2YTFA 2EOEA 2EPUA 1WJPA 2EOIA 2YRKA 2YTEA 2YTQA 2EN7A 2EM0A 2DRPA 2YSPA 1F2IG 2EOFA 2EOXA 2EPCA 1TN9A 2LVHA 5KL4A 2EM4A 1RMDA 2DLQA 2LO3A 2YTNA 4R2DA 2JP9A 2PRTA 3EPJA 2CSHA 2YU8A 1KJKA 1YUJA 1P47A 1A1KA 3MHSC 1YSAC 2YSOA 2NABA 2EMKA 2D9HA 2EPPA 1A1IA 2ELYA 2ENAA 2M9AA 2CTDA 2EOJA 2MKDA 2EQ3A 4R2PA 1A1FA 2EMHA 2EN6A 4IS1C 2MKNA 2EM7A 2EE8A 1X3CA 2YTGA 2EMLA 5KL2A 1AAYA 2HGHA 4F6MA 1ZR9A 1JK1A 2EMBA 1BB8A 2YTOA 2YTPA 2R1FA 5KL5A 1Z1BA 2EPAA 2JPAA 1UBDC 4R2CA 2YRHA 1BBOA 3VHTB 2DMIA 4R2EA 2EM6A 2EL5A 2BB8A 2EOHA 2EMYA 2YU5A 2EMXA 2LV2A 4WSGA 2GLIA 1G2FC 2RPCA 2EN2A 2LT7A 1A1LA 1ZU1A 2EJ4A 1MEYC 2EMAA 2VRDA 2DGCA 1X5WA 1ZAAC 5KL7A 4M9VC 3M99B 4R2QA 4X9JA 3EPHA 2GHFA 2EPXA 2EPZA 2EQ1A 4R2AA 2I13A 2YTDA 2EM8A 2ENCA 2EOMA 1TF6A 1UN6B 2EN4A 2J7JA 2WBSA 2EOOA 1TF3A 4R2RA 5KL3A 2EMGA 3EPLA 2EN3A 2EORA 1A1HA 2EMCA 4F2JC 3MHHC 2ENHA 2EN1A 2EMFA 2ADRA 1DGCA 2EM5A 1X6EA 3UK3C 2EL6A 2DLKA 2WBUA 2CT1A 1NCSA 2ELZA 1X6FA 2EOSA
chains in the Genus database with same CATH superfamily
2YT4A 2LCEA 3EPKA 2F8BA 5AC4A 2V86A 3C4TA 2E72A 1UILA 4GEQB 4JI7E 4DV2E 2WCC3 2EOQA 2EMZA 2EQ0A 1HNZE 3F6GA 4AQYE 2YTJA 4F9AB 4L5NC 5A6KA 2EM2A 2I9IA 2UU9E 4B3TE 1YUIA 2EM3A 1B69A 2L2MA 2EPOA 3JAMC 4Q28A 2EOEA 3AV0A 3AUZA 2B7VA 2YRKA 2YTEA 4JYAE 2N3GA 2YTQA 3L00A 1F2IG 2R76A 2UXDE 1DI2A 3ZOQB 4LF9E 5LMNE 2LVHA 2EM4A 2LO3A 2YTNA 2JP9A 2RS7A 1IQSA 3J81C 5LL6R 2PRTA 2CSHA 2YU8A 1YUJA 1P47A 2GPIA 1A1KA 1YSAC 4DV7E 4RHBB 2D9HA 2JWOA 4TUIA 2ELYA 2V87A 2MKDA 2EOJA 1X48A 2EQ3A 4R2PA 2LBSB 2EN6A 4GKKE 4WFTA 4KHPE 2MKNA 1X3CA 2HGHA 2YWQA 1HNXE 3OMLA 1ZR9A 2EMBA 2YTOA 5T6JA 4MLQA 2DMIA 4R2EA 2L8TA 2EL5A 2EMYA 2JXPA 2EMXA 4JI5E 3HQ1A 2LV2A 4N4RB 2RQLA 2EN2A 2LT7A 4JI2E 1ZU1A 4DR7E 4O24A 4R8OA 4J8ZA 1N32E 2EMAA 2VRDA 4DR1E 4LFCE 4X66E 3IWDA 3M99B 4DKKA 4X64E 4R2QA 2L3CA 2EPZA 2EQ1A 4R2AA 3VYXA 2YTDA 2ENCA 2EN4A 1WXRA 2UXCE 1TF3A 4DR2E 4Q35B 2M7QA 1EH6A 2EN3A 1A1HA 1IMUA 1KYQA 3MHHC 2NUEA 3IWCA 2ENHA 2ODRD 3FIGA 5AE1A 4DR4E 4WXCA 4B3RE 1X6EA 3UK3C 2JOBA 4NHRA 2EWLA 3J80C 1T4LB 1J26A 2H36X 4BHCA 2B7TA 2EOZA 4F9BB 1LLMC 2LE2A 2JVAA 4YHHE 1PDAA 1BBGA 4BCAA 2RSIA 3IWBA 1A1GA 4KZSA 2A25A 3DF6A 2YRMA 3QG5C 1G2DC 3HPZA 5AE2A 2EL4A 5KL6A 1X47A 2RS6A 2MDRA 2EN8A 4O5GA 4R2SA 1I94E 2YTIA 2YTFA 1N33E 1WJPA 2EOIA 1ZBTA 4YY3E 2EOFA 2EPCA 2RSMA 1XMQE 2JY9A 2BBGA 3DJWA 1RMDA 2DLQA 4JI1E 3THNA 5IXMB 3OTOE 3VYYA 4OX9E 4BS9A 5CFFE 2M9AA 2RTXA 3C6KA 4JI0E 2L2KB 2CTDA 4DV4E 4BHBA 1SR9A 3K6QA 2FV4B 2UXBE 1HNWE 4ZYHA 2WZOA 2EMLA 2DIXA 1JK1A 1IBME 4B3ME 1YPNA 4WYQB 3BBGA 5KL5A 1XMOE 4JV5E 4L8NA 3VHTB 3VK6A 5A2QC 2UUCE 4LF5E 4O4KA 2LJUA 1HR0E 2BB8A 2EOHA 3T1HE 1N3GA 2L6MA 4DV0E 1NEIA 4BBYA 1YYOA 3HTXA 5A6BA 3RMPA 4LF4E 2E5LE 4OOGC 5KL7A 4M9VC 1XNRE 3BF2A 2E1MA 1RQ0A 1J5EE 5ADZA 2DMYA 5IT9C 4P7DA 1RC7A 1TF6A 4JI6E 4LFAE 4WPYA 4LTYA 4GKJE 5AASA 1FJGE 2EMGA 3EPLA 2EMCA 1YFHA 4F54A 2EN1A 1MGTA 2ZM6E 4M0VA 4KWYA 2EM5A 1WRJA 2LUPB 1QU6A 3KZYA 2CT1A 2ELZA 1EH7A 1SFEA 1X6FA 1WHQA 5A6JA 4IJDA 2WBTA 2EOYA 2EMWA 3BIDA 2MDGA 1STUA 4HTGA 4F6NA 2EM9A 2HJJA 2LRSA 2YPNA 2EP3A 3ADGA 5IWAE 2V85A 1T4NA 4BC7A 5LLQA 2IHR1 3J7Yp 5LMUE 2KONA 1L4SA 2EPUA 2L33A 4F9CB 2L3JA 2EM0A 4K0KE 3LMLA 2YSPA 4B3SE 4JI4E 2NUGA 3T1YE 3C6MA 5A6BD 1IQOA 3ADJA 1YYKA 2JOXA 3EPJA 4DR6E 1N36E 1KJKA 2YSOA 2NABA 2EMKA 1YZ9A 1A1IA 1ZBQA 2L92A 2ENAA 2EMHA 2N3HA 2YTGA 5KL2A 1AAYA 2MC6A 4F6MA 2UUAE 2V89A 3JTZA 3JU0A 1BB8A 2EPAA 2N8XA 2JPAA 4RH8A 1T39A 1UBDC 2YRHA 1BBOA 4NZVA 2B3TB 1WHNA 3KWRA 4O43A 2DB2A 2V83A 2V8QB 2GLIA 3P1XA 4WX9A 2RPCA 1QNTA 1A1LA 1EH8A 2EJ4A 1MEYC 3HPSA 4LF6E 4ZYGA 3ADIA 4WSPA 2FGGA 3ADLA 4R03A 3HXLA 2JYAA 2V88A 1IBLE 2I13A 4LFBE 2EM8A 2EPMX 2VQEE 1UN6B 5F3WA 2J7JA 2ODRC 4NXME 4DUYE 2WBSA 1YYWA 1T4OA 2LTSA 2VF1A 4P78A 2ADRA 4X62E 4BMJA 3H09A 1PKPA 1DQ3A 2K4VA 2EL6A 3MSWA 5A69A 2DLKA 1T38A 1NCSA 4JI3E 2EOSA 4GZNC 1JK2A 3LLHA 1PJQA 4I8OA 4DV6E 1PJSA 2EPRA 1AH5A 3C4BA 4X65E 1N34E 1X49A 2M4IA 4FK5C 4DV1E 2B9DA 2EMIA 2FTXB 1A1JA 1X6HA 1EKZA 2M1SA 5A6AA 3F6HA 5DNYA 4TUGA 1O0WA 3EQ1A 3J7AG 2EN7A 2DRPA 2NA2A 2EOXA 2JR1A 2KHXA 1TN9A 5KL4A 2VE7C 4R2DA 4DV5E 2HHHE 1GQEA 1XNQE 5FLXC 2UUBE 3MHSC 1PJTA 2EPPA 1GZ6A 1A1FA 4IS1C 2EM7A 2EE8A 4LF7E 3KZZA 1UHZA 2YTPA 4X8WA 2EPNA 2R1FA 2Q8UA 1Z1BA 1IBKE 1GTKA 4R2CA 2F4VE 4ZYEA 2EM6A 2KOUA 2YU5A 5AE3A 2G7HA 4WSGA 1G2FC 4M2ZA 2L2NA 4NXNE 5TSEA 4LF8E 2YZTA 3ECRA 2NUFA 2K7IA 1X5WA 1ZAAC 2DGCA 4HEIA 2VQFE 2LTRA 2HC5A 3THOB 4X9JA 2EZ6A 2DSYA 4DMIA 3EPHA 2GHFA 2EPXA 2MC5A 2LJHA 4WXDA 2LMZA 2EOMA 2EPLX 4DV3E 2EOOA 4DUZE 4DR5E 4R2RA 5KL3A 4LU9A 2EORA 5BR8E 4ZYDA 5IV8B 4F2JC 2EMFA 2CPNA 3TQMA 4MLVA 4JI8E 1DGCA 1FKAE 4BC9A 2EPKX 2LUQA 3BGHA 4DR3E 2WBUA 5AC5A 4M30A
chains in the Genus database with same CATH topology
4GZNC 2EOZA 1JK2A 4IJDA 2WBTA 2EOYA 2LCEA 3EPKA 1LLMC 2E72A 2EPRA 2EMWA 2WCC3 2MDGA 2EOQA 2RSIA 2EMZA 1A1GA 2EQ0A 2A25A 4F6NA 2EM9A 4FK5C 2YRMA 2YTJA 1G2DC 2EM2A 2EL4A 2EMIA 2EP3A 1YUIA 2EM3A 1B69A 5KL6A 1A1JA 1X6HA 2EN8A 4R2SA 2YTIA 2YTFA 2EOEA 2EPUA 1WJPA 2EOIA 2YRKA 2YTEA 2YTQA 2EN7A 2EM0A 2DRPA 2YSPA 1F2IG 2EOFA 2EOXA 2EPCA 1TN9A 2LVHA 5KL4A 2EM4A 1RMDA 2DLQA 2LO3A 2YTNA 4R2DA 2JP9A 2PRTA 3EPJA 2CSHA 2YU8A 1KJKA 1YUJA 1P47A 1A1KA 3MHSC 1YSAC 2YSOA 2NABA 2EMKA 2D9HA 2EPPA 1A1IA 2ELYA 2ENAA 2M9AA 2CTDA 2EOJA 2MKDA 2EQ3A 4R2PA 1A1FA 2EMHA 2EN6A 4IS1C 2MKNA 2EM7A 2EE8A 1X3CA 2YTGA 2EMLA 5KL2A 1AAYA 2HGHA 4F6MA 1ZR9A 1JK1A 2EMBA 1BB8A 2YTOA 2YTPA 2R1FA 5KL5A 1Z1BA 2EPAA 2JPAA 1UBDC 4R2CA 2YRHA 1BBOA 3VHTB 2DMIA 4R2EA 2EM6A 2EL5A 2BB8A 2EOHA 2EMYA 2YU5A 2EMXA 2LV2A 4WSGA 2GLIA 1G2FC 2RPCA 2EN2A 2LT7A 1A1LA 1ZU1A 2EJ4A 1MEYC 2EMAA 2VRDA 2DGCA 1X5WA 1ZAAC 5KL7A 4M9VC 3M99B 4R2QA 4X9JA 3EPHA 2GHFA 2EPXA 2EPZA 2EQ1A 4R2AA 2I13A 2YTDA 2EM8A 2ENCA 2EOMA 1TF6A 1UN6B 2EN4A 2J7JA 2WBSA 2EOOA 1TF3A 4R2RA 5KL3A 2EMGA 3EPLA 2EN3A 2EORA 1A1HA 2EMCA 4F2JC 3MHHC 2ENHA 2EN1A 2EMFA 2ADRA 1DGCA 2EM5A 1X6EA 3UK3C 2EL6A 2DLKA 2WBUA 2CT1A 1NCSA 2ELZA 1X6FA 2EOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GZN C;  2EOZ A;  1JK2 A;  4IJD A;  2WBT A;  2EOY A;  2LCE A;  3EPK A;  1LLM C;  2E72 A;  2EPR A;  2EMW A;  2WCC 3;  2MDG A;  2EOQ A;  2RSI A;  2EMZ A;  1A1G A;  2EQ0 A;  2A25 A;  4F6N A;  2EM9 A;  4FK5 C;  2YRM A;  2YTJ A;  1G2D C;  2EM2 A;  2EL4 A;  2EMI A;  2EP3 A;  1YUI A;  2EM3 A;  1B69 A;  5KL6 A;  1A1J A;  1X6H A;  2EN8 A;  4R2S A;  2YTI A;  2YTF A;  2EOE A;  2EPU A;  1WJP A;  2EOI A;  2YRK A;  2YTE A;  2YTQ A;  2EN7 A;  2EM0 A;  2DRP A;  2YSP A;  1F2I G;  2EOF A;  2EOX A;  2EPC A;  1TN9 A;  2LVH A;  5KL4 A;  2EM4 A;  1RMD A;  2DLQ A;  2LO3 A;  2YTN A;  4R2D A;  2JP9 A;  2PRT A;  3EPJ A;  2CSH A;  2YU8 A;  1KJK A;  1YUJ A;  1P47 A;  1A1K A;  3MHS C;  1YSA C;  2YSO A;  2NAB A;  2EMK A;  2D9H A;  2EPP A;  1A1I A;  2ELY A;  2ENA A;  2M9A A;  2CTD A;  2EOJ A;  2MKD A;  2EQ3 A;  4R2P A;  1A1F A;  2EMH A;  2EN6 A;  4IS1 C;  2MKN A;  2EM7 A;  2EE8 A;  1X3C A;  2YTG A;  2EML A;  5KL2 A;  1AAY A;  2HGH A;  4F6M A;  1ZR9 A;  1JK1 A;  2EMB A;  1BB8 A;  2YTO A;  2YTP A;  2R1F A;  5KL5 A;  1Z1B A;  2EPA A;  2JPA A;  1UBD C;  4R2C A;  2YRH A;  1BBO A;  3VHT B;  2DMI A;  4R2E A;  2EM6 A;  2EL5 A;  2BB8 A;  2EOH A;  2EMY A;  2YU5 A;  2EMX A;  2LV2 A;  4WSG A;  2GLI A;  1G2F C;  2RPC A;  2EN2 A;  2LT7 A;  1A1L A;  1ZU1 A;  2EJ4 A;  1MEY C;  2EMA A;  2VRD A;  2DGC A;  1X5W A;  1ZAA C;  5KL7 A;  4M9V C;  3M99 B;  4R2Q A;  4X9J A;  3EPH A;  2GHF A;  2EPX A;  2EPZ A;  2EQ1 A;  4R2A A;  2I13 A;  2YTD A;  2EM8 A;  2ENC A;  2EOM A;  1TF6 A;  1UN6 B;  2EN4 A;  2J7J A;  2WBS A;  2EOO A;  1TF3 A;  4R2R A;  5KL3 A;  2EMG A;  3EPL A;  2EN3 A;  2EOR A;  1A1H A;  2EMC A;  4F2J C;  3MHH C;  2ENH A;  2EN1 A;  2EMF A;  2ADR A;  1DGC A;  2EM5 A;  1X6E A;  3UK3 C;  2EL6 A;  2DLK A;  2WBU A;  2CT1 A;  1NCS A;  2ELZ A;  1X6F A;  2EOS A; 
#chains in the Genus database with same CATH topology
 2YT4 A;  2LCE A;  3EPK A;  2F8B A;  5AC4 A;  2V86 A;  3C4T A;  2E72 A;  1UIL A;  4GEQ B;  4JI7 E;  4DV2 E;  2WCC 3;  2EOQ A;  2EMZ A;  2EQ0 A;  1HNZ E;  3F6G A;  4AQY E;  2YTJ A;  4F9A B;  4L5N C;  5A6K A;  2EM2 A;  2I9I A;  2UU9 E;  4B3T E;  1YUI A;  2EM3 A;  1B69 A;  2L2M A;  2EPO A;  3JAM C;  4Q28 A;  2EOE A;  3AV0 A;  3AUZ A;  2B7V A;  2YRK A;  2YTE A;  4JYA E;  2N3G A;  2YTQ A;  3L00 A;  1F2I G;  2R76 A;  2UXD E;  1DI2 A;  3ZOQ B;  4LF9 E;  5LMN E;  2LVH A;  2EM4 A;  2LO3 A;  2YTN A;  2JP9 A;  2RS7 A;  1IQS A;  3J81 C;  5LL6 R;  2PRT A;  2CSH A;  2YU8 A;  1YUJ A;  1P47 A;  2GPI A;  1A1K A;  1YSA C;  4DV7 E;  4RHB B;  2D9H A;  2JWO A;  4TUI A;  2ELY A;  2V87 A;  2MKD A;  2EOJ A;  1X48 A;  2EQ3 A;  4R2P A;  2LBS B;  2EN6 A;  4GKK E;  4WFT A;  4KHP E;  2MKN A;  1X3C A;  2HGH A;  2YWQ A;  1HNX E;  3OML A;  1ZR9 A;  2EMB A;  2YTO A;  5T6J A;  4MLQ A;  2DMI A;  4R2E A;  2L8T A;  2EL5 A;  2EMY A;  2JXP A;  2EMX A;  4JI5 E;  3HQ1 A;  2LV2 A;  4N4R B;  2RQL A;  2EN2 A;  2LT7 A;  4JI2 E;  1ZU1 A;  4DR7 E;  4O24 A;  4R8O A;  4J8Z A;  1N32 E;  2EMA A;  2VRD A;  4DR1 E;  4LFC E;  4X66 E;  3IWD A;  3M99 B;  4DKK A;  4X64 E;  4R2Q A;  2L3C A;  2EPZ A;  2EQ1 A;  4R2A A;  3VYX A;  2YTD A;  2ENC A;  2EN4 A;  1WXR A;  2UXC E;  1TF3 A;  4DR2 E;  4Q35 B;  2M7Q A;  1EH6 A;  2EN3 A;  1A1H A;  1IMU A;  1KYQ A;  3MHH C;  2NUE A;  3IWC A;  2ENH A;  2ODR D;  3FIG A;  5AE1 A;  4DR4 E;  4WXC A;  4B3R E;  1X6E A;  3UK3 C;  2JOB A;  4NHR A;  2EWL A;  3J80 C;  1T4L B;  1J26 A;  2H36 X;  4BHC A;  2B7T A;  2EOZ A;  4F9B B;  1LLM C;  2LE2 A;  2JVA A;  4YHH E;  1PDA A;  1BBG A;  4BCA A;  2RSI A;  3IWB A;  1A1G A;  4KZS A;  2A25 A;  3DF6 A;  2YRM A;  3QG5 C;  1G2D C;  3HPZ A;  5AE2 A;  2EL4 A;  5KL6 A;  1X47 A;  2RS6 A;  2MDR A;  2EN8 A;  4O5G A;  4R2S A;  1I94 E;  2YTI A;  2YTF A;  1N33 E;  1WJP A;  2EOI A;  1ZBT A;  4YY3 E;  2EOF A;  2EPC A;  2RSM A;  1XMQ E;  2JY9 A;  2BBG A;  3DJW A;  1RMD A;  2DLQ A;  4JI1 E;  3THN A;  5IXM B;  3OTO E;  3VYY A;  4OX9 E;  4BS9 A;  5CFF E;  2M9A A;  2RTX A;  3C6K A;  4JI0 E;  2L2K B;  2CTD A;  4DV4 E;  4BHB A;  1SR9 A;  3K6Q A;  2FV4 B;  2UXB E;  1HNW E;  4ZYH A;  2WZO A;  2EML A;  2DIX A;  1JK1 A;  1IBM E;  4B3M E;  1YPN A;  4WYQ B;  3BBG A;  5KL5 A;  1XMO E;  4JV5 E;  4L8N A;  3VHT B;  3VK6 A;  5A2Q C;  2UUC E;  4LF5 E;  4O4K A;  2LJU A;  1HR0 E;  2BB8 A;  2EOH A;  3T1H E;  1N3G A;  2L6M A;  4DV0 E;  1NEI A;  4BBY A;  1YYO A;  3HTX A;  5A6B A;  3RMP A;  4LF4 E;  2E5L E;  4OOG C;  5KL7 A;  4M9V C;  1XNR E;  3BF2 A;  2E1M A;  1RQ0 A;  1J5E E;  5ADZ A;  2DMY A;  5IT9 C;  4P7D A;  1RC7 A;  1TF6 A;  4JI6 E;  4LFA E;  4WPY A;  4LTY A;  4GKJ E;  5AAS A;  1FJG E;  2EMG A;  3EPL A;  2EMC A;  1YFH A;  4F54 A;  2EN1 A;  1MGT A;  2ZM6 E;  4M0V A;  4KWY A;  2EM5 A;  1WRJ A;  2LUP B;  1QU6 A;  3KZY A;  2CT1 A;  2ELZ A;  1EH7 A;  1SFE A;  1X6F A;  1WHQ A;  5A6J A;  4IJD A;  2WBT A;  2EOY A;  2EMW A;  3BID A;  2MDG A;  1STU A;  4HTG A;  4F6N A;  2EM9 A;  2HJJ A;  2LRS A;  2YPN A;  2EP3 A;  3ADG A;  5IWA E;  2V85 A;  1T4N A;  4BC7 A;  5LLQ A;  2IHR 1;  3J7Y p;  5LMU E;  2KON A;  1L4S A;  2EPU A;  2L33 A;  4F9C B;  2L3J A;  2EM0 A;  4K0K E;  3LML A;  2YSP A;  4B3S E;  4JI4 E;  2NUG A;  3T1Y E;  3C6M A;  5A6B D;  1IQO A;  3ADJ A;  1YYK A;  2JOX A;  3EPJ A;  4DR6 E;  1N36 E;  1KJK A;  2YSO A;  2NAB A;  2EMK A;  1YZ9 A;  1A1I A;  1ZBQ A;  2L92 A;  2ENA A;  2EMH A;  2N3H A;  2YTG A;  5KL2 A;  1AAY A;  2MC6 A;  4F6M A;  2UUA E;  2V89 A;  3JTZ A;  3JU0 A;  1BB8 A;  2EPA A;  2N8X A;  2JPA A;  4RH8 A;  1T39 A;  1UBD C;  2YRH A;  1BBO A;  4NZV A;  2B3T B;  1WHN A;  3KWR A;  4O43 A;  2DB2 A;  2V83 A;  2V8Q B;  2GLI A;  3P1X A;  4WX9 A;  2RPC A;  1QNT A;  1A1L A;  1EH8 A;  2EJ4 A;  1MEY C;  3HPS A;  4LF6 E;  4ZYG A;  3ADI A;  4WSP A;  2FGG A;  3ADL A;  4R03 A;  3HXL A;  2JYA A;  2V88 A;  1IBL E;  2I13 A;  4LFB E;  2EM8 A;  2EPM X;  2VQE E;  1UN6 B;  5F3W A;  2J7J A;  2ODR C;  4NXM E;  4DUY E;  2WBS A;  1YYW A;  1T4O A;  2LTS A;  2VF1 A;  4P78 A;  2ADR A;  4X62 E;  4BMJ A;  3H09 A;  1PKP A;  1DQ3 A;  2K4V A;  2EL6 A;  3MSW A;  5A69 A;  2DLK A;  1T38 A;  1NCS A;  4JI3 E;  2EOS A;  4GZN C;  1JK2 A;  3LLH A;  1PJQ A;  4I8O A;  4DV6 E;  1PJS A;  2EPR A;  1AH5 A;  3C4B A;  4X65 E;  1N34 E;  1X49 A;  2M4I A;  4FK5 C;  4DV1 E;  2B9D A;  2EMI A;  2FTX B;  1A1J A;  1X6H A;  1EKZ A;  2M1S A;  5A6A A;  3F6H A;  5DNY A;  4TUG A;  1O0W A;  3EQ1 A;  3J7A G;  2EN7 A;  2DRP A;  2NA2 A;  2EOX A;  2JR1 A;  2KHX A;  1TN9 A;  5KL4 A;  2VE7 C;  4R2D A;  4DV5 E;  2HHH E;  1GQE A;  1XNQ E;  5FLX C;  2UUB E;  3MHS C;  1PJT A;  2EPP A;  1GZ6 A;  1A1F A;  4IS1 C;  2EM7 A;  2EE8 A;  4LF7 E;  3KZZ A;  1UHZ A;  2YTP A;  4X8W A;  2EPN A;  2R1F A;  2Q8U A;  1Z1B A;  1IBK E;  1GTK A;  4R2C A;  2F4V E;  4ZYE A;  2EM6 A;  2KOU A;  2YU5 A;  5AE3 A;  2G7H A;  4WSG A;  1G2F C;  4M2Z A;  2L2N A;  4NXN E;  5TSE A;  4LF8 E;  2YZT A;  3ECR A;  2NUF A;  2K7I A;  1X5W A;  1ZAA C;  2DGC A;  4HEI A;  2VQF E;  2LTR A;  2HC5 A;  3THO B;  4X9J A;  2EZ6 A;  2DSY A;  4DMI A;  3EPH A;  2GHF A;  2EPX A;  2MC5 A;  2LJH A;  4WXD A;  2LMZ A;  2EOM A;  2EPL X;  4DV3 E;  2EOO A;  4DUZ E;  4DR5 E;  4R2R A;  5KL3 A;  4LU9 A;  2EOR A;  5BR8 E;  4ZYD A;  5IV8 B;  4F2J C;  2EMF A;  2CPN A;  3TQM A;  4MLV A;  4JI8 E;  1DGC A;  1FKA E;  4BC9 A;  2EPK X;  2LUQ A;  3BGH A;  4DR3 E;  2WBU A;  5AC5 A;  4M30 A; 
#chains in the Genus database with same CATH homology
 4GZN C;  2EOZ A;  1JK2 A;  4IJD A;  2WBT A;  2EOY A;  2LCE A;  3EPK A;  1LLM C;  2E72 A;  2EPR A;  2EMW A;  2WCC 3;  2MDG A;  2EOQ A;  2RSI A;  2EMZ A;  1A1G A;  2EQ0 A;  2A25 A;  4F6N A;  2EM9 A;  4FK5 C;  2YRM A;  2YTJ A;  1G2D C;  2EM2 A;  2EL4 A;  2EMI A;  2EP3 A;  1YUI A;  2EM3 A;  1B69 A;  5KL6 A;  1A1J A;  1X6H A;  2EN8 A;  4R2S A;  2YTI A;  2YTF A;  2EOE A;  2EPU A;  1WJP A;  2EOI A;  2YRK A;  2YTE A;  2YTQ A;  2EN7 A;  2EM0 A;  2DRP A;  2YSP A;  1F2I G;  2EOF A;  2EOX A;  2EPC A;  1TN9 A;  2LVH A;  5KL4 A;  2EM4 A;  1RMD A;  2DLQ A;  2LO3 A;  2YTN A;  4R2D A;  2JP9 A;  2PRT A;  3EPJ A;  2CSH A;  2YU8 A;  1KJK A;  1YUJ A;  1P47 A;  1A1K A;  3MHS C;  1YSA C;  2YSO A;  2NAB A;  2EMK A;  2D9H A;  2EPP A;  1A1I A;  2ELY A;  2ENA A;  2M9A A;  2CTD A;  2EOJ A;  2MKD A;  2EQ3 A;  4R2P A;  1A1F A;  2EMH A;  2EN6 A;  4IS1 C;  2MKN A;  2EM7 A;  2EE8 A;  1X3C A;  2YTG A;  2EML A;  5KL2 A;  1AAY A;  2HGH A;  4F6M A;  1ZR9 A;  1JK1 A;  2EMB A;  1BB8 A;  2YTO A;  2YTP A;  2R1F A;  5KL5 A;  1Z1B A;  2EPA A;  2JPA A;  1UBD C;  4R2C A;  2YRH A;  1BBO A;  3VHT B;  2DMI A;  4R2E A;  2EM6 A;  2EL5 A;  2BB8 A;  2EOH A;  2EMY A;  2YU5 A;  2EMX A;  2LV2 A;  4WSG A;  2GLI A;  1G2F C;  2RPC A;  2EN2 A;  2LT7 A;  1A1L A;  1ZU1 A;  2EJ4 A;  1MEY C;  2EMA A;  2VRD A;  2DGC A;  1X5W A;  1ZAA C;  5KL7 A;  4M9V C;  3M99 B;  4R2Q A;  4X9J A;  3EPH A;  2GHF A;  2EPX A;  2EPZ A;  2EQ1 A;  4R2A A;  2I13 A;  2YTD A;  2EM8 A;  2ENC A;  2EOM A;  1TF6 A;  1UN6 B;  2EN4 A;  2J7J A;  2WBS A;  2EOO A;  1TF3 A;  4R2R A;  5KL3 A;  2EMG A;  3EPL A;  2EN3 A;  2EOR A;  1A1H A;  2EMC A;  4F2J C;  3MHH C;  2ENH A;  2EN1 A;  2EMF A;  2ADR A;  1DGC A;  2EM5 A;  1X6E A;  3UK3 C;  2EL6 A;  2DLK A;  2WBU A;  2CT1 A;  1NCS A;  2ELZ A;  1X6F A;  2EOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...