1WHNA

Solution structure of the dsrbd from hypothetical protein bab26260
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
128
structure length
128
Chain Sequence
GSSGSSGSGIIKMAIRFDRRAYPPQITPKMCLLEWCRREKLPQPVYETVQRTIDRMFCSVVTVAEQKYQSTLWDKSKKLAEQTAAIVCLRSQGLPEGRLGEESPSLNKRKREAPDQDPGGPRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the dsRBD from hypothetical protein BAB26260
rcsb
source organism Mus musculus
molecule tags Rna binding protein
molecule keywords hypothetical protein RIKEN cDNA 2310016K04
total genus 14
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1whnA01
4DR7E 3HTXA 1YYOA 4B3SE 2DB2A 5IWAE 2VQEE 2UXCE 2DMYA 2UUBE 1J5EE 4JI4E 4DV5E 2NUFA 2L3JA 2MDRA 4YHHE 4AQYE 2EZ6A 4JI7E 4DV0E 2UUCE 1QU6A 4K0KE 1EKZA 1FKAE 3C4BA 4YY3E 4DR3E 1T4OA 4JYAE 1XMOE 3ADJA 4LF6E 1N36E 4WFTA 1N34E 1FJGE 4GKKE 2LRSA 4LF7E 4X62E 2RTXA 4OX9E 2NUGA 1YYKA 3LLHA 2B3TB 1N33E 1I94E 4JI0E 4X65E 4DKKA 2L2KB 1STUA 2N3GA 1X49A 2LTRA 4DV1E 4GKJE 2LJHA 4DV2E 2IHR1 1RC7A 1WHNA 4JI3E 2NUEA 1N32E 4DR5E 1XNRE 3P1XA 4WYQB 1IBLE 4M30A 1UILA 2RS7A 4JV5E 1WHQA 3ADLA 5BR8E 2VQFE 1HNWE 2UU9E 1J26A 4DR6E 4B3ME 5CFFE 2L2MA 2E5LE 4JI2E 2L2NA 2F4VE 4DV6E 2B7TA 2UXBE 1IBME 4DR4E 1PKPA 4JI6E 1GQEA 4LF8E 1X47A 4DV7E 4DR1E 1XMQE 4LF5E 4OOGC 4NXME 2L33A 4X66E 2L3CA 2HHHE 1HNXE 4NXNE 4DV3E 2LUQA 1DI2A 2LUPB 2JY9A 3ADGA 3T1HE 1HNZE 4M2ZA 2UXDE 3ADIA 5LMNE 1HR0E 4DR2E 4LFCE 1IBKE 1RQ0A 2LBSB 1XNQE 1T4NA 4X64E 2CPNA 5LMUE 2ZM6E 4JI8E 2DIXA 3VYYA 2RS6A 4B3RE 1X48A 1ZBTA 4JI5E 2UUAE 4KHPE 2LTSA 3J7Yp 2NA2A 3OTOE 4DV4E 4DUZE 2N3HA 3T1YE 2KHXA 2RSMA 4JI1E 4LFBE 1T4LB 4X8WA 4LF9E 3C4TA 4B3TE 1UHZA 4DUYE 4LF4E 1YZ9A 1O0WA 4LFAE 2JVAA 2YT4A 3VYXA 2B7VA 1YYWA
chains in the Genus database with same CATH superfamily
3HTXA 2DB2A 5IWAE 1A1KA 4MLQA 4J8ZA 1J5EE 2EM3A 2L92A 4JI4E 2EZ6A 4JI7E 2UUCE 1T39A 2FGGA 1EKZA 4R2AA 1X3CA 4LF6E 2GHFA 2FTXB 2YTNA 2LVHA 2KOUA 4WFTA 4HTGA 2RTXA 4F6NA 4OX9E 2NUGA 1YYKA 5KL3A 1A1HA 1PDAA 2JXPA 3C6KA 1Z1BA 2M1SA 3EPJA 1BBOA 2LCEA 4M0VA 2L2KB 1X6HA 4DV1E 2EPKX 2MKDA 4DV2E 4P78A 1RC7A 4GEQB 1UILA 2YTIA 3ADLA 3L00A 2EQ1A 4BC9A 2UU9E 4DR6E 5A6KA 1YFHA 1NEIA 2ADRA 2EM2A 2ODRD 2EM7A 2L2MA 2E5LE 2EM4A 2L2NA 4JI2E 4I8OA 3MHHC 4ZYEA 5A6AA 2WCC3 2GPIA 5A6BA 3J7AG 2E1MA 1X5WA 2EM6A 3ZOQB 1GQEA 2R1FA 4DV7E 1XMQE 4OOGC 5IXMB 2L33A 3F6HA 1QNTA 2YTFA 4NXNE 2ELZA 4BHCA 2PRTA 2EPRA 2LV2A 2LUPB 3ADGA 3T1HE 2G7HA 2V86A 5AE1A 2EOYA 3EPHA 3ADIA 5LMNE 2MC5A 1BB8A 1SR9A 2EM8A 5A69A 3BF2A 4LFCE 1RQ0A 1YUJA 1UN6B 2YTEA 2EMXA 4JI8E 1YUIA 4F9CB 1A1LA 2WZOA 4R8OA 4F6MA 2EM5A 2EOMA 1ZBTA 4GZNC 3THNA 4BS9A 3OTOE 4ZYHA 2EPMX 4TUIA 4MLVA 2EN3A 2HJJA 4JI1E 5LLQA 4X8WA 2EOOA 5AE3A 5A6BD 1UHZA 2CTDA 2EN7A 4NZVA 1O0WA 4LF4E 3ECRA 2BBGA 2YTPA 1UBDC 1YYOA 2EOEA 1PJQA 2DRPA 2EMCA 2VQEE 4B3SE 2EMWA 2UXCE 1A1JA 2EJ4A 2UUBE 2EMKA 4ZYGA 2MDRA 2MC6A 3EPLA 2EOFA 2YU8A 3M99B 3IWBA 1EH6A 1FKAE 3C4BA 3THOB 4DR3E 3AV0A 5A2QC 4R2CA 3ADJA 4P7DA 3C6MA 2JYAA 2EMLA 1YSAC 4GKKE 2ODRC 4LF7E 4X62E 2EE8A 3F6GA 3RMPA 1RMDA 4DMIA 2E72A 1STUA 1X49A 2LTRA 4GKJE 2LJHA 2IHR1 3AUZA 3VK6A 2EMZA 4DR5E 4JV5E 3K6QA 5F3WA 1HNWE 2EPOA 4F9BB 2ENCA 2EOIA 2M9AA 2EPUA 4R2EA 4DV6E 2B7TA 2EOHA 2ENAA 4NHRA 2EOZA 1IBME 5AASA 5IV8B 1PKPA 1PJSA 2EOQA 1EH7A 2JR1A 1AAYA 2EOXA 4WXDA 3FIGA 2V85A 1GTKA 4WXCA 4NXME 2EPPA 4DV3E 1DI2A 4O5GA 4R2DA 2EMAA 1HNZE 2J7JA 2V88A 2I9IA 3LMLA 4KWYA 2EORA 4DR2E 4Q35B 1T4NA 4WSGA 2CPNA 2EL5A 2ZM6E 2EPXA 2EMGA 2LE2A 2EMFA 2YPNA 1ZAAC 2LO3A 1TN9A 3EQ1A 2JPAA 4DV4E 2HC5A 2N3HA 2DGCA 4Q28A 2RSIA 4HEIA 1T4LB 2YTGA 1WXRA 2GLIA 1L4SA 3C4TA 2K7IA 4WPYA 3TQMA 1YPNA 3IWCA 3HXLA 2JVAA 2YT4A 5AC5A 2I13A 3JAMC 1SFEA 5IT9C 2DMYA 1ZU1A 5DNYA 4YHHE 1A1FA 4DV0E 3QG5C 4YY3E 1T4OA 4JYAE 1XMOE 5KL2A 1N36E 3EPKA 2R76A 5AE2A 2LRSA 2EM9A 4WX9A 2EMBA 1AH5A 3LLHA 1N33E 1I94E 4X65E 4DKKA 2N3GA 3HPZA 1F2IG 4L5NC 1WHNA 2EN1A 4JI3E 2YTOA 3MSWA 1G2DC 2N8XA 4M30A 5T6JA 1WHQA 2B9DA 2EOJA 2YTJA 2VQFE 2EN8A 1J26A 5CFFE 2F4VE 1X6FA 2JOBA 2YSPA 4N4RB 3MHSC 2DLKA 2ENHA 1WRJA 5ADZA 5FLXC 2KONA 2L8TA 4DR1E 2HHHE 1HNXE 2LUQA 4R2QA 2CSHA 3KZYA 4M2ZA 4BHBA 2EPCA 4F9AB 2F8BA 1NCSA 2EN6A 2V83A 3IWDA 1P47A 1A1GA 3JTZA 2LBSB 2EQ3A 2JWOA 5A6JA 4TUGA 1JK2A 2DLQA 4IS1C 1KYQA 2Q8UA 2DIXA 2RS6A 2M7QA 5KL4A 2EN2A 2UUAE 4X9JA 3KWRA 4KHPE 2L6MA 2V8QB 3J7Yp 5KL6A 1MGTA 2LMZA 2EMHA 4F2JC 2D9HA 3T1YE 4LTYA 2RSMA 1A1IA 4LFBE 2EOSA 1IQSA 4R2SA 4B3TE 3H09A 1B69A 3UK3C 2DSYA 5KL7A 4LFAE 4O43A 2B7VA 2EPAA 4BMJA 1YYWA 4DR7E 2EWLA 1DQ3A 2YRMA 3BBGA 3DF6A 4DV5E 2NUFA 3J80C 3J81C 2L3JA 1JK1A 4AQYE 1GZ6A 3DJWA 1QU6A 4K0KE 2BB8A 5LL6R 2HGHA 2WBSA 2RPCA 2ELYA 1N34E 1FJGE 3HPSA 1IMUA 2V87A 2A25A 4RHBB 2EPNA 2B3TB 2YTQA 2JP9A 4JI0E 2K4VA 2NUEA 1N32E 2YRHA 2VF1A 3KZZA 3P1XA 4WYQB 4BBYA 1IBLE 2RS7A 1MEYC 1XNRE 5BR8E 2MKNA 2YWQA 2YZTA 2YU5A 1EH8A 4B3ME 2EPLX 4R03A 2RQLA 2UXBE 2NABA 4M9VC 1N3GA 4R2RA 2LT7A 1T38A 4DR4E 2EP3A 4JI6E 4LF8E 2FV4B 1X47A 4LF5E 4WSPA 2YTDA 2VRDA 4X66E 2L3CA 1ZR9A 2YSOA 1X6EA 2JY9A 1WJPA 4LU9A 2EL4A 2JOXA 4IJDA 2UXDE 4O4KA 3BIDA 1HR0E 2WBUA 4R2PA 2EPZA 1XNQE 3JU0A 1IBKE 2M4IA 2CT1A 4KZSA 5TSEA 1LLMC 3OMLA 4L8NA 4X64E 4RH8A 5LMUE 2WBTA 1IQOA 2V89A 2EMIA 2EL6A 2MDGA 3VYYA 2H36X 4B3RE 1ZBQA 1PJTA 1X48A 1TF6A 2YRKA 5KL5A 1BBGA 3VHTB 1G2FC 4JI5E 4FK5C 2LTSA 2NA2A 4BC7A 2LJUA 4DUZE 1TF3A 4F54A 2DMIA 2EM0A 2KHXA 2EN4A 4ZYDA 2VE7C 5AC4A 4LF9E 1KJKA 2EMYA 3BGHA 4O24A 4BCAA 3HQ1A 2EQ0A 4DUYE 1YZ9A 1DGCA 3VYXA
chains in the Genus database with same CATH topology
4DR7E 3HTXA 3JAMC 1YYOA 4B3SE 2DB2A 5IWAE 2VQEE 2UXCE 5IT9C 2DMYA 2EWLA 1DQ3A 4J8ZA 2UUBE 1J5EE 2L92A 3DF6A 4JI4E 4DV5E 2NUFA 3J80C 3J81C 2MDRA 2L3JA 5DNYA 4YHHE 4AQYE 2EZ6A 1GZ6A 2MC6A 4JI7E 4DV0E 2UUCE 3DJWA 1QU6A 2FGGA 4K0KE 3IWBA 1EKZA 5LL6R 3C4BA 4YY3E 4DR3E 1T4OA 3AV0A 1XMOE 1FKAE 4JYAE 5A2QC 3ADJA 4P7DA 4LF6E 2FTXB 1N36E 2KOUA 4WFTA 1N34E 1FJGE 5AE2A 1XNRE 3HPSA 2LRSA 2ODRC 4X62E 4LF7E 4GKKE 2RTXA 2V87A 4OX9E 2NUGA 1YYKA 3F6GA 3LLHA 2B3TB 1N33E 1I94E 3RMPA 2M1SA 4JI0E 4X65E 4DKKA 4DMIA 2K4VA 4M0VA 2L2KB 1STUA 2N3GA 1X49A 2LTRA 3HPZA 4L5NC 2LJHA 4DV1E 2IHR1 4P78A 3AUZA 3VK6A 1WHNA 4DV2E 1RC7A 3MSWA 4JI3E 1N32E 4GEQB 2NUEA 4DR5E 2VF1A 3P1XA 4WYQB 1IBLE 4M30A 1UILA 2RS7A 5T6JA 1WHQA 2B9DA 4BBYA 5BR8E 3K6QA 3ADLA 2VQFE 5F3WA 1HNWE 4BC9A 4F9BB 2UU9E 1J26A 2YZTA 4DR6E 4B3ME 5CFFE 2ODRD 2L2MA 2E5LE 4JI2E 2L2NA 2F4VE 4I8OA 4R03A 4DV6E 2B7TA 2UXBE 2JOBA 3J7AG 1IBME 5AASA 2E1MA 4DR4E 1PKPA 5ADZA 3ZOQB 2JR1A 2KONA 1GQEA 2L8TA 5FLXC 4JI6E 4LF8E 2FV4B 1X47A 3FIGA 4DV7E 4WSPA 2V85A 4DR1E 1XMQE 4LF5E 4OOGC 4NXME 2L33A 3F6HA 4X66E 2L3CA 2HHHE 1HNXE 4NXNE 4DV3E 2LUQA 1DI2A 2LUPB 2JY9A 3ADGA 4LU9A 2G7HA 2JOXA 2V86A 4F9AB 5AE1A 2F8BA 3T1HE 1HNZE 4M2ZA 4JV5E 2UXDE 3ADIA 2V88A 2V83A 3LMLA 3IWDA 5LMNE 1HR0E 2MC5A 1SR9A 3JTZA 3JU0A 4DR2E 1RQ0A 2LBSB 2M4IA 1IBKE 4LFCE 4KZSA 1XNQE 1T4NA 2JWOA 3OMLA 4L8NA 4X64E 2CPNA 4TUGA 5LMUE 2ZM6E 4JI8E 2V89A 4F9CB 2DIXA 3VYYA 2RS6A 2WZOA 2LE2A 2H36X 4R8OA 4B3RE 4GKJE 1ZBQA 2M7QA 1X48A 1ZBTA 4JI5E 4BS9A 2UUAE 3KWRA 4KHPE 2LTSA 2L6MA 2V8QB 3J7Yp 2NA2A 3OTOE 4BC7A 4DV4E 4DUZE 4TUIA 2N3HA 4F54A 4Q28A 2LMZA 3T1YE 2KHXA 4LTYA 2RSMA 4JI1E 4LFBE 1T4LB 4X8WA 1WXRA 2VE7C 4LF9E 5AE3A 4BCAA 3C4TA 4WPYA 1UHZA 3HQ1A 3H09A 4B3TE 4DUYE 3IWCA 2DSYA 3HXLA 1O0WA 4LF4E 2JVAA 4LFAE 2YT4A 1YZ9A 2B7VA 3VYXA 4BMJA 1YYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR7 E;  3HTX A;  1YYO A;  4B3S E;  2DB2 A;  5IWA E;  2VQE E;  2UXC E;  2DMY A;  2UUB E;  1J5E E;  4JI4 E;  4DV5 E;  2NUF A;  2L3J A;  2MDR A;  4YHH E;  4AQY E;  2EZ6 A;  4JI7 E;  4DV0 E;  2UUC E;  1QU6 A;  4K0K E;  1EKZ A;  1FKA E;  3C4B A;  4YY3 E;  4DR3 E;  1T4O A;  4JYA E;  1XMO E;  3ADJ A;  4LF6 E;  1N36 E;  4WFT A;  1N34 E;  1FJG E;  4GKK E;  2LRS A;  4LF7 E;  4X62 E;  2RTX A;  4OX9 E;  2NUG A;  1YYK A;  3LLH A;  2B3T B;  1N33 E;  1I94 E;  4JI0 E;  4X65 E;  4DKK A;  2L2K B;  1STU A;  2N3G A;  1X49 A;  2LTR A;  4DV1 E;  4GKJ E;  2LJH A;  4DV2 E;  2IHR 1;  1RC7 A;  1WHN A;  4JI3 E;  2NUE A;  1N32 E;  4DR5 E;  1XNR E;  3P1X A;  4WYQ B;  1IBL E;  4M30 A;  1UIL A;  2RS7 A;  4JV5 E;  1WHQ A;  3ADL A;  5BR8 E;  2VQF E;  1HNW E;  2UU9 E;  1J26 A;  4DR6 E;  4B3M E;  5CFF E;  2L2M A;  2E5L E;  4JI2 E;  2L2N A;  2F4V E;  4DV6 E;  2B7T A;  2UXB E;  1IBM E;  4DR4 E;  1PKP A;  4JI6 E;  1GQE A;  4LF8 E;  1X47 A;  4DV7 E;  4DR1 E;  1XMQ E;  4LF5 E;  4OOG C;  4NXM E;  2L33 A;  4X66 E;  2L3C A;  2HHH E;  1HNX E;  4NXN E;  4DV3 E;  2LUQ A;  1DI2 A;  2LUP B;  2JY9 A;  3ADG A;  3T1H E;  1HNZ E;  4M2Z A;  2UXD E;  3ADI A;  5LMN E;  1HR0 E;  4DR2 E;  4LFC E;  1IBK E;  1RQ0 A;  2LBS B;  1XNQ E;  1T4N A;  4X64 E;  2CPN A;  5LMU E;  2ZM6 E;  4JI8 E;  2DIX A;  3VYY A;  2RS6 A;  4B3R E;  1X48 A;  1ZBT A;  4JI5 E;  2UUA E;  4KHP E;  2LTS A;  3J7Y p;  2NA2 A;  3OTO E;  4DV4 E;  4DUZ E;  2N3H A;  3T1Y E;  2KHX A;  2RSM A;  4JI1 E;  4LFB E;  1T4L B;  4X8W A;  4LF9 E;  3C4T A;  4B3T E;  1UHZ A;  4DUY E;  4LF4 E;  1YZ9 A;  1O0W A;  4LFA E;  2JVA A;  2YT4 A;  3VYX A;  2B7V A;  1YYW A; 
#chains in the Genus database with same CATH topology
 3HTX A;  2DB2 A;  5IWA E;  1A1K A;  4MLQ A;  4J8Z A;  1J5E E;  2EM3 A;  2L92 A;  4JI4 E;  2EZ6 A;  4JI7 E;  2UUC E;  1T39 A;  2FGG A;  1EKZ A;  4R2A A;  1X3C A;  4LF6 E;  2GHF A;  2FTX B;  2YTN A;  2LVH A;  2KOU A;  4WFT A;  4HTG A;  2RTX A;  4F6N A;  4OX9 E;  2NUG A;  1YYK A;  5KL3 A;  1A1H A;  1PDA A;  2JXP A;  3C6K A;  1Z1B A;  2M1S A;  3EPJ A;  1BBO A;  2LCE A;  4M0V A;  2L2K B;  1X6H A;  4DV1 E;  2EPK X;  2MKD A;  4DV2 E;  4P78 A;  1RC7 A;  4GEQ B;  1UIL A;  2YTI A;  3ADL A;  3L00 A;  2EQ1 A;  4BC9 A;  2UU9 E;  4DR6 E;  5A6K A;  1YFH A;  1NEI A;  2ADR A;  2EM2 A;  2ODR D;  2EM7 A;  2L2M A;  2E5L E;  2EM4 A;  2L2N A;  4JI2 E;  4I8O A;  3MHH C;  4ZYE A;  5A6A A;  2WCC 3;  2GPI A;  5A6B A;  3J7A G;  2E1M A;  1X5W A;  2EM6 A;  3ZOQ B;  1GQE A;  2R1F A;  4DV7 E;  1XMQ E;  4OOG C;  5IXM B;  2L33 A;  3F6H A;  1QNT A;  2YTF A;  4NXN E;  2ELZ A;  4BHC A;  2PRT A;  2EPR A;  2LV2 A;  2LUP B;  3ADG A;  3T1H E;  2G7H A;  2V86 A;  5AE1 A;  2EOY A;  3EPH A;  3ADI A;  5LMN E;  2MC5 A;  1BB8 A;  1SR9 A;  2EM8 A;  5A69 A;  3BF2 A;  4LFC E;  1RQ0 A;  1YUJ A;  1UN6 B;  2YTE A;  2EMX A;  4JI8 E;  1YUI A;  4F9C B;  1A1L A;  2WZO A;  4R8O A;  4F6M A;  2EM5 A;  2EOM A;  1ZBT A;  4GZN C;  3THN A;  4BS9 A;  3OTO E;  4ZYH A;  2EPM X;  4TUI A;  4MLV A;  2EN3 A;  2HJJ A;  4JI1 E;  5LLQ A;  4X8W A;  2EOO A;  5AE3 A;  5A6B D;  1UHZ A;  2CTD A;  2EN7 A;  4NZV A;  1O0W A;  4LF4 E;  3ECR A;  2BBG A;  2YTP A;  1UBD C;  1YYO A;  2EOE A;  1PJQ A;  2DRP A;  2EMC A;  2VQE E;  4B3S E;  2EMW A;  2UXC E;  1A1J A;  2EJ4 A;  2UUB E;  2EMK A;  4ZYG A;  2MDR A;  2MC6 A;  3EPL A;  2EOF A;  2YU8 A;  3M99 B;  3IWB A;  1EH6 A;  1FKA E;  3C4B A;  3THO B;  4DR3 E;  3AV0 A;  5A2Q C;  4R2C A;  3ADJ A;  4P7D A;  3C6M A;  2JYA A;  2EML A;  1YSA C;  4GKK E;  2ODR C;  4LF7 E;  4X62 E;  2EE8 A;  3F6G A;  3RMP A;  1RMD A;  4DMI A;  2E72 A;  1STU A;  1X49 A;  2LTR A;  4GKJ E;  2LJH A;  2IHR 1;  3AUZ A;  3VK6 A;  2EMZ A;  4DR5 E;  4JV5 E;  3K6Q A;  5F3W A;  1HNW E;  2EPO A;  4F9B B;  2ENC A;  2EOI A;  2M9A A;  2EPU A;  4R2E A;  4DV6 E;  2B7T A;  2EOH A;  2ENA A;  4NHR A;  2EOZ A;  1IBM E;  5AAS A;  5IV8 B;  1PKP A;  1PJS A;  2EOQ A;  1EH7 A;  2JR1 A;  1AAY A;  2EOX A;  4WXD A;  3FIG A;  2V85 A;  1GTK A;  4WXC A;  4NXM E;  2EPP A;  4DV3 E;  1DI2 A;  4O5G A;  4R2D A;  2EMA A;  1HNZ E;  2J7J A;  2V88 A;  2I9I A;  3LML A;  4KWY A;  2EOR A;  4DR2 E;  4Q35 B;  1T4N A;  4WSG A;  2CPN A;  2EL5 A;  2ZM6 E;  2EPX A;  2EMG A;  2LE2 A;  2EMF A;  2YPN A;  1ZAA C;  2LO3 A;  1TN9 A;  3EQ1 A;  2JPA A;  4DV4 E;  2HC5 A;  2N3H A;  2DGC A;  4Q28 A;  2RSI A;  4HEI A;  1T4L B;  2YTG A;  1WXR A;  2GLI A;  1L4S A;  3C4T A;  2K7I A;  4WPY A;  3TQM A;  1YPN A;  3IWC A;  3HXL A;  2JVA A;  2YT4 A;  5AC5 A;  2I13 A;  3JAM C;  1SFE A;  5IT9 C;  2DMY A;  1ZU1 A;  5DNY A;  4YHH E;  1A1F A;  4DV0 E;  3QG5 C;  4YY3 E;  1T4O A;  4JYA E;  1XMO E;  5KL2 A;  1N36 E;  3EPK A;  2R76 A;  5AE2 A;  2LRS A;  2EM9 A;  4WX9 A;  2EMB A;  1AH5 A;  3LLH A;  1N33 E;  1I94 E;  4X65 E;  4DKK A;  2N3G A;  3HPZ A;  1F2I G;  4L5N C;  1WHN A;  2EN1 A;  4JI3 E;  2YTO A;  3MSW A;  1G2D C;  2N8X A;  4M30 A;  5T6J A;  1WHQ A;  2B9D A;  2EOJ A;  2YTJ A;  2VQF E;  2EN8 A;  1J26 A;  5CFF E;  2F4V E;  1X6F A;  2JOB A;  2YSP A;  4N4R B;  3MHS C;  2DLK A;  2ENH A;  1WRJ A;  5ADZ A;  5FLX C;  2KON A;  2L8T A;  4DR1 E;  2HHH E;  1HNX E;  2LUQ A;  4R2Q A;  2CSH A;  3KZY A;  4M2Z A;  4BHB A;  2EPC A;  4F9A B;  2F8B A;  1NCS A;  2EN6 A;  2V83 A;  3IWD A;  1P47 A;  1A1G A;  3JTZ A;  2LBS B;  2EQ3 A;  2JWO A;  5A6J A;  4TUG A;  1JK2 A;  2DLQ A;  4IS1 C;  1KYQ A;  2Q8U A;  2DIX A;  2RS6 A;  2M7Q A;  5KL4 A;  2EN2 A;  2UUA E;  4X9J A;  3KWR A;  4KHP E;  2L6M A;  2V8Q B;  3J7Y p;  5KL6 A;  1MGT A;  2LMZ A;  2EMH A;  4F2J C;  2D9H A;  3T1Y E;  4LTY A;  2RSM A;  1A1I A;  4LFB E;  2EOS A;  1IQS A;  4R2S A;  4B3T E;  3H09 A;  1B69 A;  3UK3 C;  2DSY A;  5KL7 A;  4LFA E;  4O43 A;  2B7V A;  2EPA A;  4BMJ A;  1YYW A;  4DR7 E;  2EWL A;  1DQ3 A;  2YRM A;  3BBG A;  3DF6 A;  4DV5 E;  2NUF A;  3J80 C;  3J81 C;  2L3J A;  1JK1 A;  4AQY E;  1GZ6 A;  3DJW A;  1QU6 A;  4K0K E;  2BB8 A;  5LL6 R;  2HGH A;  2WBS A;  2RPC A;  2ELY A;  1N34 E;  1FJG E;  3HPS A;  1IMU A;  2V87 A;  2A25 A;  4RHB B;  2EPN A;  2B3T B;  2YTQ A;  2JP9 A;  4JI0 E;  2K4V A;  2NUE A;  1N32 E;  2YRH A;  2VF1 A;  3KZZ A;  3P1X A;  4WYQ B;  4BBY A;  1IBL E;  2RS7 A;  1MEY C;  1XNR E;  5BR8 E;  2MKN A;  2YWQ A;  2YZT A;  2YU5 A;  1EH8 A;  4B3M E;  2EPL X;  4R03 A;  2RQL A;  2UXB E;  2NAB A;  4M9V C;  1N3G A;  4R2R A;  2LT7 A;  1T38 A;  4DR4 E;  2EP3 A;  4JI6 E;  4LF8 E;  2FV4 B;  1X47 A;  4LF5 E;  4WSP A;  2YTD A;  2VRD A;  4X66 E;  2L3C A;  1ZR9 A;  2YSO A;  1X6E A;  2JY9 A;  1WJP A;  4LU9 A;  2EL4 A;  2JOX A;  4IJD A;  2UXD E;  4O4K A;  3BID A;  1HR0 E;  2WBU A;  4R2P A;  2EPZ A;  1XNQ E;  3JU0 A;  1IBK E;  2M4I A;  2CT1 A;  4KZS A;  5TSE A;  1LLM C;  3OML A;  4L8N A;  4X64 E;  4RH8 A;  5LMU E;  2WBT A;  1IQO A;  2V89 A;  2EMI A;  2EL6 A;  2MDG A;  3VYY A;  2H36 X;  4B3R E;  1ZBQ A;  1PJT A;  1X48 A;  1TF6 A;  2YRK A;  5KL5 A;  1BBG A;  3VHT B;  1G2F C;  4JI5 E;  4FK5 C;  2LTS A;  2NA2 A;  4BC7 A;  2LJU A;  4DUZ E;  1TF3 A;  4F54 A;  2DMI A;  2EM0 A;  2KHX A;  2EN4 A;  4ZYD A;  2VE7 C;  5AC4 A;  4LF9 E;  1KJK A;  2EMY A;  3BGH A;  4O24 A;  4BCA A;  3HQ1 A;  2EQ0 A;  4DUY E;  1YZ9 A;  1DGC A;  3VYX A; 
#chains in the Genus database with same CATH homology
 4DR7 E;  3HTX A;  3JAM C;  1YYO A;  4B3S E;  2DB2 A;  5IWA E;  2VQE E;  2UXC E;  5IT9 C;  2DMY A;  2EWL A;  1DQ3 A;  4J8Z A;  2UUB E;  1J5E E;  2L92 A;  3DF6 A;  4JI4 E;  4DV5 E;  2NUF A;  3J80 C;  3J81 C;  2MDR A;  2L3J A;  5DNY A;  4YHH E;  4AQY E;  2EZ6 A;  1GZ6 A;  2MC6 A;  4JI7 E;  4DV0 E;  2UUC E;  3DJW A;  1QU6 A;  2FGG A;  4K0K E;  3IWB A;  1EKZ A;  5LL6 R;  3C4B A;  4YY3 E;  4DR3 E;  1T4O A;  3AV0 A;  1XMO E;  1FKA E;  4JYA E;  5A2Q C;  3ADJ A;  4P7D A;  4LF6 E;  2FTX B;  1N36 E;  2KOU A;  4WFT A;  1N34 E;  1FJG E;  5AE2 A;  1XNR E;  3HPS A;  2LRS A;  2ODR C;  4X62 E;  4LF7 E;  4GKK E;  2RTX A;  2V87 A;  4OX9 E;  2NUG A;  1YYK A;  3F6G A;  3LLH A;  2B3T B;  1N33 E;  1I94 E;  3RMP A;  2M1S A;  4JI0 E;  4X65 E;  4DKK A;  4DMI A;  2K4V A;  4M0V A;  2L2K B;  1STU A;  2N3G A;  1X49 A;  2LTR A;  3HPZ A;  4L5N C;  2LJH A;  4DV1 E;  2IHR 1;  4P78 A;  3AUZ A;  3VK6 A;  1WHN A;  4DV2 E;  1RC7 A;  3MSW A;  4JI3 E;  1N32 E;  4GEQ B;  2NUE A;  4DR5 E;  2VF1 A;  3P1X A;  4WYQ B;  1IBL E;  4M30 A;  1UIL A;  2RS7 A;  5T6J A;  1WHQ A;  2B9D A;  4BBY A;  5BR8 E;  3K6Q A;  3ADL A;  2VQF E;  5F3W A;  1HNW E;  4BC9 A;  4F9B B;  2UU9 E;  1J26 A;  2YZT A;  4DR6 E;  4B3M E;  5CFF E;  2ODR D;  2L2M A;  2E5L E;  4JI2 E;  2L2N A;  2F4V E;  4I8O A;  4R03 A;  4DV6 E;  2B7T A;  2UXB E;  2JOB A;  3J7A G;  1IBM E;  5AAS A;  2E1M A;  4DR4 E;  1PKP A;  5ADZ A;  3ZOQ B;  2JR1 A;  2KON A;  1GQE A;  2L8T A;  5FLX C;  4JI6 E;  4LF8 E;  2FV4 B;  1X47 A;  3FIG A;  4DV7 E;  4WSP A;  2V85 A;  4DR1 E;  1XMQ E;  4LF5 E;  4OOG C;  4NXM E;  2L33 A;  3F6H A;  4X66 E;  2L3C A;  2HHH E;  1HNX E;  4NXN E;  4DV3 E;  2LUQ A;  1DI2 A;  2LUP B;  2JY9 A;  3ADG A;  4LU9 A;  2G7H A;  2JOX A;  2V86 A;  4F9A B;  5AE1 A;  2F8B A;  3T1H E;  1HNZ E;  4M2Z A;  4JV5 E;  2UXD E;  3ADI A;  2V88 A;  2V83 A;  3LML A;  3IWD A;  5LMN E;  1HR0 E;  2MC5 A;  1SR9 A;  3JTZ A;  3JU0 A;  4DR2 E;  1RQ0 A;  2LBS B;  2M4I A;  1IBK E;  4LFC E;  4KZS A;  1XNQ E;  1T4N A;  2JWO A;  3OML A;  4L8N A;  4X64 E;  2CPN A;  4TUG A;  5LMU E;  2ZM6 E;  4JI8 E;  2V89 A;  4F9C B;  2DIX A;  3VYY A;  2RS6 A;  2WZO A;  2LE2 A;  2H36 X;  4R8O A;  4B3R E;  4GKJ E;  1ZBQ A;  2M7Q A;  1X48 A;  1ZBT A;  4JI5 E;  4BS9 A;  2UUA E;  3KWR A;  4KHP E;  2LTS A;  2L6M A;  2V8Q B;  3J7Y p;  2NA2 A;  3OTO E;  4BC7 A;  4DV4 E;  4DUZ E;  4TUI A;  2N3H A;  4F54 A;  4Q28 A;  2LMZ A;  3T1Y E;  2KHX A;  4LTY A;  2RSM A;  4JI1 E;  4LFB E;  1T4L B;  4X8W A;  1WXR A;  2VE7 C;  4LF9 E;  5AE3 A;  4BCA A;  3C4T A;  4WPY A;  1UHZ A;  3HQ1 A;  3H09 A;  4B3T E;  4DUY E;  3IWC A;  2DSY A;  3HXL A;  1O0W A;  4LF4 E;  2JVA A;  4LFA E;  2YT4 A;  1YZ9 A;  2B7V A;  3VYX A;  4BMJ A;  1YYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...