1WHNA

Solution structure of the dsrbd from hypothetical protein bab26260
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
128
structure length
128
Chain Sequence
GSSGSSGSGIIKMAIRFDRRAYPPQITPKMCLLEWCRREKLPQPVYETVQRTIDRMFCSVVTVAEQKYQSTLWDKSKKLAEQTAAIVCLRSQGLPEGRLGEESPSLNKRKREAPDQDPGGPRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords hypothetical protein RIKEN cDNA 2310016K04
publication title Solution structure of the dsRBD from hypothetical protein BAB26260
rcsb
source organism Mus musculus
total genus 14
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1whnA01
4WFTA 1T4LB 4DV2E 4LF6E 4DR7E 1FJGE 2UU9E 3HTXA 2NA2A 2L33A 4LFCE 3C4BA 4DV6E 1N36E 4JV5E 1N32E 1RC7A 2UXBE 1J26A 4JI0E 1IBME 3ADGA 2CPNA 3VYXA 1XMOE 2LUQA 4DV0E 2UUCE 4DUZE 4YY3E 4B3ME 2DMYA 2L2NA 5BR8E 4JI4E 4LF4E 4X62E 4LFBE 1T4OA 1HNWE 4DR4E 2LJHA 2RS6A 2UUBE 2JY9A 2DB2A 4DR3E 4LF5E 4DKKA 3C4TA 4JI5E 2NUGA 1ZBTA 2LTSA 4X64E 4DUYE 1YYOA 2EZ6A 3ADJA 1XMQE 1WHNA 4DV4E 2LRSA 5LMUE 4DR6E 2N3GA 1STUA 3ADIA 4DV1E 2MDRA 2L3CA 4DV5E 2B7VA 1N34E 1IBKE 2LTRA 4JI3E 2IHR1 2N3HA 4DV3E 1J5EE 1XNQE 4DR2E 4DV7E 1DI2A 4OX9E 1X49A 4JI2E 4LFAE 2NUEA 2L2KB 2UUAE 1IBLE 4B3TE 4DR5E 4WYQB 2L3JA 4LF7E 3T1HE 1YYKA 4JYAE 1EKZA 4JI6E 4LF8E 2ZM6E 2VQFE 1PKPA 2RTXA 1HNXE 5CFFE 1GQEA 4OOGC 2YT4A 5LMNE 1UILA 3J7Yp 2B7TA 5IWAE 3P1XA 2VQEE 3VYYA 3T1YE 4X65E 1FKAE 1RQ0A 2RSMA 4NXME 3ADLA 4JI8E 2UXCE 1N33E 4B3RE 4B3SE 2DIXA 1XNRE 1QU6A 3OTOE 2JVAA 4JI7E 2HHHE 4X8WA 1X47A 4KHPE 2LBSB 4DR1E 4YHHE 1HNZE 3LLHA 2NUFA 1YYWA 4JI1E 2LUPB 2UXDE 1UHZA 1X48A 4NXNE 4GKJE 2E5LE 1HR0E 2RS7A 1WHQA 4AQYE 2L2MA 1O0WA 4M30A 4X66E 2B3TB 2F4VE 2KHXA 1I94E 1T4NA 4K0KE 4M2ZA 4GKKE 4LF9E 1YZ9A
chains in the Genus database with same CATH superfamily
1T4LB 5KL4A 2R76A 2V86A 5IXMB 1PJSA 3BGHA 2KOUA 2LMZA 2EMBA 3JTZA 2UXBE 3KZYA 2F8BA 1NEIA 3C6MA 3ADGA 2EQ1A 1XMOE 2DMYA 1IQOA 2EPCA 5BR8E 4JI4E 3IWCA 2LCEA 3HPSA 2EMIA 4WX9A 2KONA 2JY9A 2EN8A 3TQMA 2ENAA 2EPPA 3C4TA 1YSAC 2ELZA 2CT1A 3BBGA 2EOIA 2MDGA 2EPRA 1ZBTA 5A6KA 4WXDA 3MHHC 3KZZA 3M99B 4N4RB 5AE1A 2LRSA 4DR6E 2N3GA 1JK1A 3ADIA 2L3CA 1N34E 1MEYC 2IHR1 2EOHA 1IQSA 4DMIA 2EM7A 4BHCA 2E1MA 1G2DC 4R2DA 2EOYA 4LU9A 2EM0A 4B3TE 4DR5E 2L8TA 4JI6E 2N8XA 1X6HA 3THNA 2VQFE 4R2RA 1GQEA 2RQLA 2ODRD 4BC7A 3J7Yp 4O24A 2B7TA 2EM9A 4BHBA 2HJJA 2JR1A 2RSMA 4NXME 3ADLA 3LMLA 1N33E 5IT9C 1A1GA 1X6FA 4X8WA 1A1LA 4KHPE 4NHRA 3EPKA 2EOEA 4KZSA 2LUPB 2EMWA 4WSPA 1X6EA 2NABA 2RS7A 1P47A 2LV2A 2L2MA 4X66E 2WCC3 3EPHA 2F4VE 3DF6A 1T4NA 2J7JA 2V85A 4Q28A 2V83A 4R2EA 2EPNA 3RMPA 4BC9A 4IS1C 4GKKE 2R1FA 1SR9A 4WSGA 4F6NA 3DJWA 2NA2A 2L33A 4LFCE 1BBGA 2EMFA 2EN6A 2BBGA 1RC7A 3H09A 3L00A 5DNYA 1IBME 2L92A 2EQ0A 2EWLA 1YFHA 3VYXA 2JXPA 4RHBB 4DV0E 1LLMC 2EPMX 4MLVA 3JAMC 1N3GA 2EM3A 5KL6A 2DLKA 4DR4E 1ZR9A 1AH5A 2RS6A 4ZYHA 2DB2A 2DMIA 4JI5E 2EM2A 2M4IA 4I8OA 2GHFA 2NUGA 2CTDA 3AUZA 2LJUA 2ODRC 4DUYE 1YYOA 4R2CA 2YTNA 4DV4E 4F9BB 5LMUE 2ELYA 4GEQB 5A6BA 1STUA 2EQ3A 2WBSA 2EN3A 4R2QA 4DV5E 3BF2A 2B7VA 1IBKE 2LTRA 4Q35B 1XNQE 4R2SA 3IWDA 1Z1BA 4F6MA 4LTYA 2EOZA 2E72A 1YYKA 3T1HE 4MLQA 1A1KA 5A2QC 1PKPA 1HNXE 2YWQA 5CFFE 4R2PA 2YT4A 2K4VA 2EOJA 3T1YE 4TUIA 3J7AG 2UXCE 1ZU1A 1KJKA 4HTGA 2LT7A 4B3SE 1XNRE 2JPAA 4IJDA 2DGCA 2EOSA 2YPNA 2EPLX 1X47A 1TF6A 2UXDE 3MSWA 2GPIA 2ADRA 2WZOA 4NXNE 2I13A 2LVHA 1YUJA 2EMZA 1EH8A 2YTPA 1GZ6A 2EL4A 3HXLA 1O0WA 2LE2A 5AE2A 4M30A 5ADZA 2M7QA 2YRMA 2JOXA 4NZVA 1QNTA 1I94E 5AC4A 1GTKA 4K0KE 2EN4A 3HQ1A 4M2ZA 2A25A 2RSIA 4WFTA 4DV2E 2EOMA 2DLQA 4X9JA 1JK2A 2JOBA 2YU8A 3BIDA 4F2JC 4JV5E 2YSOA 2EPUA 1J26A 5FLXC 3K6QA 2CPNA 3IWBA 4DUZE 2L2NA 2CSHA 4LFBE 4X62E 1KYQA 5A6AA 1BBOA 1WJPA 2YRHA 4ZYGA 2LJHA 2MKDA 2V89A 1ZBQA 2G7HA 1UBDC 5KL5A 2V8QB 2EORA 4DKKA 2EMKA 2HGHA 1A1JA 2EM4A 2K7IA 2LTSA 2EMLA 2JWOA 1A1IA 4R2AA 2DSYA 4M0VA 5IV8B 3J81C 5KL3A 2HC5A 4DV3E 3F6GA 1J5EE 4DR2E 3EPJA 1DI2A 2EN2A 2M9AA 4TUGA 4JI2E 4LFAE 5TSEA 5A6BD 2EOXA 2UUAE 1IBLE 4LF7E 4WYQB 2B9DA 2EM6A 2L3JA 1T38A 4P7DA 4LF8E 5A69A 5F3WA 2FV4B 4F54A 1UILA 5IWAE 2EPXA 2EL5A 4WPYA 2WBUA 5AC5A 4X65E 1FKAE 2H36X 1UN6B 4B3RE 1IMUA 2YTGA 3OTOE 4R8OA 2JVAA 2D9HA 2FGGA 1ZAAC 1DQ3A 2M1SA 3ECRA 2GLIA 2LBSB 4O5GA 2VRDA 1HNZE 4YHHE 1G2FC 2NUFA 4JI1E 2V88A 4R03A 1UHZA 4F9AB 1MGTA 4BCAA 1TF3A 1WHQA 4AQYE 1B69A 1AAYA 2YTIA 2EPOA 2EOQA 1TN9A 2EPZA 1PJQA 4KWYA 4M9VC 2KHXA 2EPKX 2FTXB 4F9CB 1F2IG 3EPLA 4GZNC 4LF9E 1YZ9A 4GKJE 2EJ4A 2MKNA 4LF6E 1PJTA 1RMDA 3VK6A 4DR7E 4ZYEA 4L5NC 1DGCA 1FJGE 2UU9E 2EM8A 3HTXA 3C4BA 2YRKA 4DV6E 1N36E 2YTFA 4P78A 5A6JA 2Q8UA 1EH6A 2MC5A 1N32E 2YU5A 2LO3A 4JI0E 2ENHA 1WRJA 4J8ZA 2LUQA 3UK3C 2UUCE 4YY3E 4B3ME 2VE7C 5LLQA 4ZYDA 4LF4E 5KL2A 1T39A 1T4OA 2JP9A 2RPCA 1HNWE 2YTQA 3QG5C 1YUIA 2YZTA 2UUBE 3VHTB 4DR3E 3AV0A 2EMCA 2JYAA 3JU0A 4LF5E 3J80C 2I9IA 1X3CA 2EP3A 4X64E 2EZ6A 3ADJA 3FIGA 4BBYA 2ENCA 1WHNA 2EMGA 1XMQE 3C6KA 2EM5A 2WBTA 4DV1E 2MDRA 4JI3E 2EMAA 2YSPA 2EN7A 3OMLA 1SFEA 2N3HA 3ZOQB 4O4KA 1X5WA 2EMHA 1L4SA 2EMXA 4DV7E 1A1FA 4O43A 4OX9E 1X49A 2MC6A 2NUEA 2L2KB 4JYAE 2DRPA 1A1HA 2VF1A 1EKZA 2EOOA 2ZM6E 2RTXA 4RH8A 4BS9A 4OOGC 5LMNE 3EQ1A 1NCSA 2EL6A 3P1XA 2VQEE 3VYYA 1WXRA 1EH7A 5T6JA 2V87A 2EE8A 1YPNA 1RQ0A 3F6HA 5AASA 2BB8A 4JI8E 5KL7A 2DIXA 4L8NA 2YTOA 3HPZA 2EMYA 1QU6A 2EN1A 4WXCA 4JI7E 2HHHE 4DR1E 3LLHA 4FK5C 3MHSC 1X48A 2L6MA 5LL6R 1BB8A 2E5LE 1HR0E 2YTEA 4BMJA 2YTDA 1PDAA 3THOB 3KWRA 2B3TB 5AE3A 2EOFA 4HEIA 2YTJA 2EPAA 1YYWA 2PRTA
chains in the Genus database with same CATH topology
4WFTA 1SR9A 4DV2E 3VK6A 1T4LB 4LF6E 4DR7E 1FJGE 4L5NC 3DJWA 2UU9E 3HTXA 2NA2A 2L33A 2V86A 4LFCE 3C4BA 2JOBA 2KOUA 2LMZA 4DV6E 1N36E 4P78A 3JTZA 4JV5E 2MC5A 1N32E 1RC7A 2UXBE 2F8BA 1J26A 3H09A 1IBME 5DNYA 4JI0E 2L92A 5FLXC 2EWLA 3ADGA 2CPNA 3K6QA 4J8ZA 2LUQA 1XMOE 4DV0E 3VYXA 3IWBA 4DUZE 2UUCE 4YY3E 3JAMC 4B3ME 2DMYA 2VE7C 2L2NA 5BR8E 4JI4E 4LF4E 4X62E 3IWCA 4LFBE 1T4OA 2UXDE 1HNWE 2YZTA 3HPSA 4DR4E 2LJHA 2RS6A 2V89A 2UUBE 2KONA 1ZBQA 2G7HA 2JY9A 2DB2A 4DR3E 3AV0A 3JU0A 2V8QB 4LF5E 4DKKA 3C4TA 3J80C 4JI5E 2M4IA 4I8OA 2NUGA 1ZBTA 2LTSA 3AUZA 2ODRC 4X64E 4DUYE 1YYOA 2EZ6A 3ADJA 3FIGA 4BBYA 2JWOA 1WHNA 1XMQE 5AE1A 1YYWA 4DV4E 2LRSA 4F9BB 2DSYA 5LMUE 4M0VA 4JI1E 4DR6E 4GEQB 3J81C 2N3GA 1STUA 3ADIA 4DV1E 2MDRA 2L3CA 4DV5E 2B7VA 3OMLA 1N34E 2LTRA 1IBKE 2IHR1 2N3HA 3ZOQB 4DV3E 3F6GA 1J5EE 1XNQE 4DMIA 4DR2E 4DV7E 3IWDA 1DI2A 4OX9E 4TUGA 1X49A 2E1MA 2MC6A 4JI2E 4LFAE 2NUEA 4LTYA 4LU9A 2L2KB 2UUAE 1IBLE 4B3TE 4DR5E 4WYQB 2B9DA 2L3JA 3T1HE 4LF7E 2L8TA 2VF1A 4P7DA 1EKZA 4JI6E 1YYKA 4LF8E 2ZM6E 5F3WA 5A2QC 1PKPA 2RTXA 2VQFE 2FV4B 5CFFE 1HNXE 1GQEA 4F54A 4BS9A 4OOGC 2YT4A 5LMNE 1UILA 2ODRD 4BC7A 3J7Yp 2B7TA 5IWAE 3P1XA 2VQEE 4WPYA 3VYYA 1WXRA 2K4VA 5T6JA 3T1YE 2V87A 4X65E 1FKAE 2H36X 2JR1A 1RQ0A 2RSMA 3F6HA 4TUIA 4NXME 5AASA 3ADLA 4JI8E 3LMLA 3J7AG 1N33E 2UXCE 5IT9C 4B3RE 4B3SE 2DIXA 4L8NA 3HPZA 1XNRE 1QU6A 3OTOE 4R8OA 2JVAA 4JI7E 2FGGA 4X8WA 2HHHE 1X47A 1DQ3A 2M1SA 4JYAE 4KHPE 2LBSB 4DR1E 4YHHE 1HNZE 3LLHA 4KZSA 3MSWA 2NUFA 2V88A 4R03A 1UHZA 1X48A 2WZOA 2L6MA 4WSPA 4F9AB 5LL6R 2LUPB 4NXNE 4BCAA 2E5LE 1HR0E 2RS7A 4GKJE 1WHQA 4BMJA 4AQYE 1GZ6A 2L2MA 3HXLA 1O0WA 2LE2A 5AE2A 4M30A 5ADZA 2M7QA 3KWRA 4X66E 4JI3E 2JOXA 2B3TB 2F4VE 3DF6A 2KHXA 5AE3A 1T4NA 1I94E 2V85A 4Q28A 2V83A 3RMPA 4K0KE 2FTXB 4BC9A 4F9CB 3HQ1A 4M2ZA 4GKKE 4LF9E 1YZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WFT A;  1T4L B;  4DV2 E;  4LF6 E;  4DR7 E;  1FJG E;  2UU9 E;  3HTX A;  2NA2 A;  2L33 A;  4LFC E;  3C4B A;  4DV6 E;  1N36 E;  4JV5 E;  1N32 E;  1RC7 A;  2UXB E;  1J26 A;  4JI0 E;  1IBM E;  3ADG A;  2CPN A;  3VYX A;  1XMO E;  2LUQ A;  4DV0 E;  2UUC E;  4DUZ E;  4YY3 E;  4B3M E;  2DMY A;  2L2N A;  5BR8 E;  4JI4 E;  4LF4 E;  4X62 E;  4LFB E;  1T4O A;  1HNW E;  4DR4 E;  2LJH A;  2RS6 A;  2UUB E;  2JY9 A;  2DB2 A;  4DR3 E;  4LF5 E;  4DKK A;  3C4T A;  4JI5 E;  2NUG A;  1ZBT A;  2LTS A;  4X64 E;  4DUY E;  1YYO A;  2EZ6 A;  3ADJ A;  1XMQ E;  1WHN A;  4DV4 E;  2LRS A;  5LMU E;  4DR6 E;  2N3G A;  1STU A;  3ADI A;  4DV1 E;  2MDR A;  2L3C A;  4DV5 E;  2B7V A;  1N34 E;  1IBK E;  2LTR A;  4JI3 E;  2IHR 1;  2N3H A;  4DV3 E;  1J5E E;  1XNQ E;  4DR2 E;  4DV7 E;  1DI2 A;  4OX9 E;  1X49 A;  4JI2 E;  4LFA E;  2NUE A;  2L2K B;  2UUA E;  1IBL E;  4B3T E;  4DR5 E;  4WYQ B;  2L3J A;  4LF7 E;  3T1H E;  1YYK A;  4JYA E;  1EKZ A;  4JI6 E;  4LF8 E;  2ZM6 E;  2VQF E;  1PKP A;  2RTX A;  1HNX E;  5CFF E;  1GQE A;  4OOG C;  2YT4 A;  5LMN E;  1UIL A;  3J7Y p;  2B7T A;  5IWA E;  3P1X A;  2VQE E;  3VYY A;  3T1Y E;  4X65 E;  1FKA E;  1RQ0 A;  2RSM A;  4NXM E;  3ADL A;  4JI8 E;  2UXC E;  1N33 E;  4B3R E;  4B3S E;  2DIX A;  1XNR E;  1QU6 A;  3OTO E;  2JVA A;  4JI7 E;  2HHH E;  4X8W A;  1X47 A;  4KHP E;  2LBS B;  4DR1 E;  4YHH E;  1HNZ E;  3LLH A;  2NUF A;  1YYW A;  4JI1 E;  2LUP B;  2UXD E;  1UHZ A;  1X48 A;  4NXN E;  4GKJ E;  2E5L E;  1HR0 E;  2RS7 A;  1WHQ A;  4AQY E;  2L2M A;  1O0W A;  4M30 A;  4X66 E;  2B3T B;  2F4V E;  2KHX A;  1I94 E;  1T4N A;  4K0K E;  4M2Z A;  4GKK E;  4LF9 E;  1YZ9 A; 
#chains in the Genus database with same CATH topology
 1T4L B;  5KL4 A;  2R76 A;  2V86 A;  5IXM B;  1PJS A;  3BGH A;  2KOU A;  2LMZ A;  2EMB A;  3JTZ A;  2UXB E;  3KZY A;  2F8B A;  1NEI A;  3C6M A;  3ADG A;  2EQ1 A;  1XMO E;  2DMY A;  1IQO A;  2EPC A;  5BR8 E;  4JI4 E;  3IWC A;  2LCE A;  3HPS A;  2EMI A;  4WX9 A;  2KON A;  2JY9 A;  2EN8 A;  3TQM A;  2ENA A;  2EPP A;  3C4T A;  1YSA C;  2ELZ A;  2CT1 A;  3BBG A;  2EOI A;  2MDG A;  2EPR A;  1ZBT A;  5A6K A;  4WXD A;  3MHH C;  3KZZ A;  3M99 B;  4N4R B;  5AE1 A;  2LRS A;  4DR6 E;  2N3G A;  1JK1 A;  3ADI A;  2L3C A;  1N34 E;  1MEY C;  2IHR 1;  2EOH A;  1IQS A;  4DMI A;  2EM7 A;  4BHC A;  2E1M A;  1G2D C;  4R2D A;  2EOY A;  4LU9 A;  2EM0 A;  4B3T E;  4DR5 E;  2L8T A;  4JI6 E;  2N8X A;  1X6H A;  3THN A;  2VQF E;  4R2R A;  1GQE A;  2RQL A;  2ODR D;  4BC7 A;  3J7Y p;  4O24 A;  2B7T A;  2EM9 A;  4BHB A;  2HJJ A;  2JR1 A;  2RSM A;  4NXM E;  3ADL A;  3LML A;  1N33 E;  5IT9 C;  1A1G A;  1X6F A;  4X8W A;  1A1L A;  4KHP E;  4NHR A;  3EPK A;  2EOE A;  4KZS A;  2LUP B;  2EMW A;  4WSP A;  1X6E A;  2NAB A;  2RS7 A;  1P47 A;  2LV2 A;  2L2M A;  4X66 E;  2WCC 3;  3EPH A;  2F4V E;  3DF6 A;  1T4N A;  2J7J A;  2V85 A;  4Q28 A;  2V83 A;  4R2E A;  2EPN A;  3RMP A;  4BC9 A;  4IS1 C;  4GKK E;  2R1F A;  1SR9 A;  4WSG A;  4F6N A;  3DJW A;  2NA2 A;  2L33 A;  4LFC E;  1BBG A;  2EMF A;  2EN6 A;  2BBG A;  1RC7 A;  3H09 A;  3L00 A;  5DNY A;  1IBM E;  2L92 A;  2EQ0 A;  2EWL A;  1YFH A;  3VYX A;  2JXP A;  4RHB B;  4DV0 E;  1LLM C;  2EPM X;  4MLV A;  3JAM C;  1N3G A;  2EM3 A;  5KL6 A;  2DLK A;  4DR4 E;  1ZR9 A;  1AH5 A;  2RS6 A;  4ZYH A;  2DB2 A;  2DMI A;  4JI5 E;  2EM2 A;  2M4I A;  4I8O A;  2GHF A;  2NUG A;  2CTD A;  3AUZ A;  2LJU A;  2ODR C;  4DUY E;  1YYO A;  4R2C A;  2YTN A;  4DV4 E;  4F9B B;  5LMU E;  2ELY A;  4GEQ B;  5A6B A;  1STU A;  2EQ3 A;  2WBS A;  2EN3 A;  4R2Q A;  4DV5 E;  3BF2 A;  2B7V A;  1IBK E;  2LTR A;  4Q35 B;  1XNQ E;  4R2S A;  3IWD A;  1Z1B A;  4F6M A;  4LTY A;  2EOZ A;  2E72 A;  1YYK A;  3T1H E;  4MLQ A;  1A1K A;  5A2Q C;  1PKP A;  1HNX E;  2YWQ A;  5CFF E;  4R2P A;  2YT4 A;  2K4V A;  2EOJ A;  3T1Y E;  4TUI A;  3J7A G;  2UXC E;  1ZU1 A;  1KJK A;  4HTG A;  2LT7 A;  4B3S E;  1XNR E;  2JPA A;  4IJD A;  2DGC A;  2EOS A;  2YPN A;  2EPL X;  1X47 A;  1TF6 A;  2UXD E;  3MSW A;  2GPI A;  2ADR A;  2WZO A;  4NXN E;  2I13 A;  2LVH A;  1YUJ A;  2EMZ A;  1EH8 A;  2YTP A;  1GZ6 A;  2EL4 A;  3HXL A;  1O0W A;  2LE2 A;  5AE2 A;  4M30 A;  5ADZ A;  2M7Q A;  2YRM A;  2JOX A;  4NZV A;  1QNT A;  1I94 E;  5AC4 A;  1GTK A;  4K0K E;  2EN4 A;  3HQ1 A;  4M2Z A;  2A25 A;  2RSI A;  4WFT A;  4DV2 E;  2EOM A;  2DLQ A;  4X9J A;  1JK2 A;  2JOB A;  2YU8 A;  3BID A;  4F2J C;  4JV5 E;  2YSO A;  2EPU A;  1J26 A;  5FLX C;  3K6Q A;  2CPN A;  3IWB A;  4DUZ E;  2L2N A;  2CSH A;  4LFB E;  4X62 E;  1KYQ A;  5A6A A;  1BBO A;  1WJP A;  2YRH A;  4ZYG A;  2LJH A;  2MKD A;  2V89 A;  1ZBQ A;  2G7H A;  1UBD C;  5KL5 A;  2V8Q B;  2EOR A;  4DKK A;  2EMK A;  2HGH A;  1A1J A;  2EM4 A;  2K7I A;  2LTS A;  2EML A;  2JWO A;  1A1I A;  4R2A A;  2DSY A;  4M0V A;  5IV8 B;  3J81 C;  5KL3 A;  2HC5 A;  4DV3 E;  3F6G A;  1J5E E;  4DR2 E;  3EPJ A;  1DI2 A;  2EN2 A;  2M9A A;  4TUG A;  4JI2 E;  4LFA E;  5TSE A;  5A6B D;  2EOX A;  2UUA E;  1IBL E;  4LF7 E;  4WYQ B;  2B9D A;  2EM6 A;  2L3J A;  1T38 A;  4P7D A;  4LF8 E;  5A69 A;  5F3W A;  2FV4 B;  4F54 A;  1UIL A;  5IWA E;  2EPX A;  2EL5 A;  4WPY A;  2WBU A;  5AC5 A;  4X65 E;  1FKA E;  2H36 X;  1UN6 B;  4B3R E;  1IMU A;  2YTG A;  3OTO E;  4R8O A;  2JVA A;  2D9H A;  2FGG A;  1ZAA C;  1DQ3 A;  2M1S A;  3ECR A;  2GLI A;  2LBS B;  4O5G A;  2VRD A;  1HNZ E;  4YHH E;  1G2F C;  2NUF A;  4JI1 E;  2V88 A;  4R03 A;  1UHZ A;  4F9A B;  1MGT A;  4BCA A;  1TF3 A;  1WHQ A;  4AQY E;  1B69 A;  1AAY A;  2YTI A;  2EPO A;  2EOQ A;  1TN9 A;  2EPZ A;  1PJQ A;  4KWY A;  4M9V C;  2KHX A;  2EPK X;  2FTX B;  4F9C B;  1F2I G;  3EPL A;  4GZN C;  4LF9 E;  1YZ9 A;  4GKJ E;  2EJ4 A;  2MKN A;  4LF6 E;  1PJT A;  1RMD A;  3VK6 A;  4DR7 E;  4ZYE A;  4L5N C;  1DGC A;  1FJG E;  2UU9 E;  2EM8 A;  3HTX A;  3C4B A;  2YRK A;  4DV6 E;  1N36 E;  2YTF A;  4P78 A;  5A6J A;  2Q8U A;  1EH6 A;  2MC5 A;  1N32 E;  2YU5 A;  2LO3 A;  4JI0 E;  2ENH A;  1WRJ A;  4J8Z A;  2LUQ A;  3UK3 C;  2UUC E;  4YY3 E;  4B3M E;  2VE7 C;  5LLQ A;  4ZYD A;  4LF4 E;  5KL2 A;  1T39 A;  1T4O A;  2JP9 A;  2RPC A;  1HNW E;  2YTQ A;  3QG5 C;  1YUI A;  2YZT A;  2UUB E;  3VHT B;  4DR3 E;  3AV0 A;  2EMC A;  2JYA A;  3JU0 A;  4LF5 E;  3J80 C;  2I9I A;  1X3C A;  2EP3 A;  4X64 E;  2EZ6 A;  3ADJ A;  3FIG A;  4BBY A;  2ENC A;  1WHN A;  2EMG A;  1XMQ E;  3C6K A;  2EM5 A;  2WBT A;  4DV1 E;  2MDR A;  4JI3 E;  2EMA A;  2YSP A;  2EN7 A;  3OML A;  1SFE A;  2N3H A;  3ZOQ B;  4O4K A;  1X5W A;  2EMH A;  1L4S A;  2EMX A;  4DV7 E;  1A1F A;  4O43 A;  4OX9 E;  1X49 A;  2MC6 A;  2NUE A;  2L2K B;  4JYA E;  2DRP A;  1A1H A;  2VF1 A;  1EKZ A;  2EOO A;  2ZM6 E;  2RTX A;  4RH8 A;  4BS9 A;  4OOG C;  5LMN E;  3EQ1 A;  1NCS A;  2EL6 A;  3P1X A;  2VQE E;  3VYY A;  1WXR A;  1EH7 A;  5T6J A;  2V87 A;  2EE8 A;  1YPN A;  1RQ0 A;  3F6H A;  5AAS A;  2BB8 A;  4JI8 E;  5KL7 A;  2DIX A;  4L8N A;  2YTO A;  3HPZ A;  2EMY A;  1QU6 A;  2EN1 A;  4WXC A;  4JI7 E;  2HHH E;  4DR1 E;  3LLH A;  4FK5 C;  3MHS C;  1X48 A;  2L6M A;  5LL6 R;  1BB8 A;  2E5L E;  1HR0 E;  2YTE A;  4BMJ A;  2YTD A;  1PDA A;  3THO B;  3KWR A;  2B3T B;  5AE3 A;  2EOF A;  4HEI A;  2YTJ A;  2EPA A;  1YYW A;  2PRT A; 
#chains in the Genus database with same CATH homology
 4WFT A;  1SR9 A;  4DV2 E;  3VK6 A;  1T4L B;  4LF6 E;  4DR7 E;  1FJG E;  4L5N C;  3DJW A;  2UU9 E;  3HTX A;  2NA2 A;  2L33 A;  2V86 A;  4LFC E;  3C4B A;  2JOB A;  2KOU A;  2LMZ A;  4DV6 E;  1N36 E;  4P78 A;  3JTZ A;  4JV5 E;  2MC5 A;  1N32 E;  1RC7 A;  2UXB E;  2F8B A;  1J26 A;  3H09 A;  1IBM E;  5DNY A;  4JI0 E;  2L92 A;  5FLX C;  2EWL A;  3ADG A;  2CPN A;  3K6Q A;  4J8Z A;  2LUQ A;  1XMO E;  4DV0 E;  3VYX A;  3IWB A;  4DUZ E;  2UUC E;  4YY3 E;  3JAM C;  4B3M E;  2DMY A;  2VE7 C;  2L2N A;  5BR8 E;  4JI4 E;  4LF4 E;  4X62 E;  3IWC A;  4LFB E;  1T4O A;  2UXD E;  1HNW E;  2YZT A;  3HPS A;  4DR4 E;  2LJH A;  2RS6 A;  2V89 A;  2UUB E;  2KON A;  1ZBQ A;  2G7H A;  2JY9 A;  2DB2 A;  4DR3 E;  3AV0 A;  3JU0 A;  2V8Q B;  4LF5 E;  4DKK A;  3C4T A;  3J80 C;  4JI5 E;  2M4I A;  4I8O A;  2NUG A;  1ZBT A;  2LTS A;  3AUZ A;  2ODR C;  4X64 E;  4DUY E;  1YYO A;  2EZ6 A;  3ADJ A;  3FIG A;  4BBY A;  2JWO A;  1WHN A;  1XMQ E;  5AE1 A;  1YYW A;  4DV4 E;  2LRS A;  4F9B B;  2DSY A;  5LMU E;  4M0V A;  4JI1 E;  4DR6 E;  4GEQ B;  3J81 C;  2N3G A;  1STU A;  3ADI A;  4DV1 E;  2MDR A;  2L3C A;  4DV5 E;  2B7V A;  3OML A;  1N34 E;  2LTR A;  1IBK E;  2IHR 1;  2N3H A;  3ZOQ B;  4DV3 E;  3F6G A;  1J5E E;  1XNQ E;  4DMI A;  4DR2 E;  4DV7 E;  3IWD A;  1DI2 A;  4OX9 E;  4TUG A;  1X49 A;  2E1M A;  2MC6 A;  4JI2 E;  4LFA E;  2NUE A;  4LTY A;  4LU9 A;  2L2K B;  2UUA E;  1IBL E;  4B3T E;  4DR5 E;  4WYQ B;  2B9D A;  2L3J A;  3T1H E;  4LF7 E;  2L8T A;  2VF1 A;  4P7D A;  1EKZ A;  4JI6 E;  1YYK A;  4LF8 E;  2ZM6 E;  5F3W A;  5A2Q C;  1PKP A;  2RTX A;  2VQF E;  2FV4 B;  5CFF E;  1HNX E;  1GQE A;  4F54 A;  4BS9 A;  4OOG C;  2YT4 A;  5LMN E;  1UIL A;  2ODR D;  4BC7 A;  3J7Y p;  2B7T A;  5IWA E;  3P1X A;  2VQE E;  4WPY A;  3VYY A;  1WXR A;  2K4V A;  5T6J A;  3T1Y E;  2V87 A;  4X65 E;  1FKA E;  2H36 X;  2JR1 A;  1RQ0 A;  2RSM A;  3F6H A;  4TUI A;  4NXM E;  5AAS A;  3ADL A;  4JI8 E;  3LML A;  3J7A G;  1N33 E;  2UXC E;  5IT9 C;  4B3R E;  4B3S E;  2DIX A;  4L8N A;  3HPZ A;  1XNR E;  1QU6 A;  3OTO E;  4R8O A;  2JVA A;  4JI7 E;  2FGG A;  4X8W A;  2HHH E;  1X47 A;  1DQ3 A;  2M1S A;  4JYA E;  4KHP E;  2LBS B;  4DR1 E;  4YHH E;  1HNZ E;  3LLH A;  4KZS A;  3MSW A;  2NUF A;  2V88 A;  4R03 A;  1UHZ A;  1X48 A;  2WZO A;  2L6M A;  4WSP A;  4F9A B;  5LL6 R;  2LUP B;  4NXN E;  4BCA A;  2E5L E;  1HR0 E;  2RS7 A;  4GKJ E;  1WHQ A;  4BMJ A;  4AQY E;  1GZ6 A;  2L2M A;  3HXL A;  1O0W A;  2LE2 A;  5AE2 A;  4M30 A;  5ADZ A;  2M7Q A;  3KWR A;  4X66 E;  4JI3 E;  2JOX A;  2B3T B;  2F4V E;  3DF6 A;  2KHX A;  5AE3 A;  1T4N A;  1I94 E;  2V85 A;  4Q28 A;  2V83 A;  3RMP A;  4K0K E;  2FTX B;  4BC9 A;  4F9C B;  3HQ1 A;  4M2Z A;  4GKK E;  4LF9 E;  1YZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...