1WHNA

Solution structure of the dsrbd from hypothetical protein bab26260
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
128
structure length
128
Chain Sequence
GSSGSSGSGIIKMAIRFDRRAYPPQITPKMCLLEWCRREKLPQPVYETVQRTIDRMFCSVVTVAEQKYQSTLWDKSKKLAEQTAAIVCLRSQGLPEGRLGEESPSLNKRKREAPDQDPGGPRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords hypothetical protein RIKEN cDNA 2310016K04
publication title Solution structure of the dsRBD from hypothetical protein BAB26260
rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 14
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1whnA01
2UXCE 4JI8E 1YYKA 1HR0E 2L2MA 2EZ6A 1ZBTA 4DR4E 1YYOA 1N36E 2B3TB 2N3HA 4KHPE 1T4OA 1N33E 4JI2E 4DV7E 2JVAA 1IBLE 4DV6E 4GKJE 1FKAE 3C4BA 1X47A 1O0WA 4LF9E 4JI5E 4DV2E 4LFBE 4DV4E 1RQ0A 1DI2A 2LUPB 4WYQB 3T1YE 2LTRA 4JV5E 2DMYA 5LMNE 4DR2E 3T1HE 2VQEE 3ADLA 2CPNA 1WHQA 3OTOE 4X66E 2B7VA 2VQFE 2UXBE 4JI7E 4AQYE 1XMOE 4DV5E 1N32E 4DR3E 1XMQE 4DV0E 4B3TE 2UUAE 2NUGA 1YZ9A 4OOGC 1STUA 1GQEA 1RC7A 2RTXA 3J7Yp 4DR5E 1IBME 4X8WA 2L2KB 1HNXE 3ADJA 4DR7E 4LFAE 4DR6E 4LFCE 4NXME 4JI1E 2MDRA 4DV1E 4X62E 4NXNE 4GKKE 4DV3E 1QU6A 4YHHE 1IBKE 2UU9E 2L33A 4LF5E 3VYXA 4DKKA 4LF7E 1FJGE 2KHXA 2IHR1 3ADIA 2LUQA 4WFTA 2LTSA 4K0KE 4B3RE 4M30A 1HNWE 4B3SE 4B3ME 2F4VE 2JY9A 2LJHA 2NA2A 3ADGA 2NUFA 2B7TA 2RSMA 2UUBE 5IWAE 1X49A 4DUYE 4YY3E 3VYYA 1UILA 4JI6E 2RS7A 4M2ZA 4X65E 1J5EE 1HNZE 3P1XA 2ZM6E 2DIXA 1PKPA 3LLHA 2L3CA 2RS6A 2YT4A 2UUCE 2L2NA 1N34E 4LF4E 2HHHE 4JI3E 4OX9E 1YYWA 4JI4E 1I94E 4DUZE 4JYAE 5BR8E 1T4LB 4LF6E 2UXDE 1XNQE 2E5LE 1UHZA 4DR1E 1XNRE 1J26A 2LRSA 4JI0E 3C4TA 2DB2A 2NUEA 1T4NA 4LF8E 5LMUE 1WHNA 1X48A 1EKZA 2N3GA 3HTXA 2LBSB 2L3JA 4X64E 5CFFE
chains in the Genus database with same CATH superfamily
4IS1C 4R2QA 2EZ6A 1ZBTA 1F2IG 5T6JA 1YYOA 5LL6R 2EP3A 3BF2A 3IWDA 5AE2A 3DF6A 1A1KA 4DV6E 2EOJA 2M9AA 5A6JA 3VHTB 1X47A 2YWQA 1A1IA 2JOBA 2YTJA 4LFBE 1NEIA 2DMIA 4WYQB 1EH6A 4L8NA 4JV5E 4WPYA 2CT1A 5LMNE 5A2QC 2V83A 1PJTA 1T38A 2ODRD 2EPNA 3ADLA 3OTOE 2B7VA 1YPNA 2YTGA 1RMDA 2ADRA 4IJDA 1N3GA 5A6BD 4R2CA 1XMQE 4F9BB 4OOGC 1EH7A 4X64E 2EMHA 5AC4A 1EH8A 1A1HA 1L4SA 2KOUA 1X6EA 4LFAE 3HPZA 2MDRA 3C6KA 1X5WA 2DSYA 2EPCA 3HXLA 1WRJA 3UK3C 2EMLA 2EE8A 4DKKA 2EOXA 1MEYC 2KHXA 4LF7E 1B69A 4WFTA 4B3RE 1HNWE 2ELYA 4WSPA 2EM9A 2EN7A 2LCEA 1X49A 3MHHC 2EM4A 2HJJA 3C6MA 3KZYA 5A69A 1A1LA 1J5EE 2EMIA 3TQMA 1PKPA 2EPOA 5LLQA 2YT4A 1T39A 2UUCE 1N34E 4WXCA 2EM7A 2YRKA 1I94E 5AE1A 4O43A 3AV0A 1Z1BA 5F3WA 1UHZA 2EOFA 2YZTA 2DB2A 2V89A 4R2DA 2NUEA 5KL4A 3VK6A 2R1FA 2EM2A 4LTYA 4BBYA 3J81C 1X3CA 2LV2A 4F9AB 1MGTA 3THNA 1HR0E 2EL5A 4NZVA 5IXMB 4DR4E 2EM5A 2LVHA 2B3TB 2N3HA 1GTKA 1T4OA 4R2AA 1JK2A 1N33E 4Q35B 2EPRA 2EORA 2JVAA 2G7HA 2EM0A 3C4BA 3IWBA 1GZ6A 3THOB 1IQOA 4M9VC 2EN2A 4DV2E 4BS9A 2FV4B 3T1YE 2LTRA 2YSPA 2DMYA 4X9JA 2R76A 2V85A 2WBUA 1AH5A 2EMWA 4MLQA 2CPNA 1G2FC 4R2SA 1AAYA 2WBSA 2EMZA 4AQYE 1XMOE 4DV5E 4DR3E 2EWLA 1IQSA 4FK5C 2V87A 2UUAE 2ENAA 2EOMA 1YZ9A 2EPAA 1GQEA 3EPHA 1JK1A 2EOIA 2EPUA 3K6QA 4X8WA 2L6MA 2VF1A 4MLVA 4P78A 4DR6E 4ZYDA 2EOHA 2F8BA 4NXME 1WXRA 2DGCA 2EOOA 4NXNE 4BC9A 3BBGA 2Q8UA 2B9DA 2EL6A 1DGCA 4O4KA 3QG5C 1IBKE 2EL4A 4K0KE 4M30A 5A6AA 4B3ME 1IMUA 1A1FA 2EMAA 2JY9A 2LJHA 2A25A 4Q28A 2GHFA 2JYAA 1X6FA 1UILA 2BBGA 4JI6E 2RS7A 3ECRA 2JPAA 4X65E 2EN6A 4KZSA 1HNZE 3P1XA 2PRTA 2ZM6E 3M99B 2L3CA 2RS6A 2HHHE 4OX9E 3EQ1A 4TUGA 2I13A 4DUZE 4JYAE 4J8ZA 2E5LE 2V88A 4DR1E 2RPCA 1J26A 2LRSA 3C4TA 2YU8A 2CTDA 2YTOA 4LU9A 2EOQA 5A6BA 4LF8E 3JTZA 5LMUE 4TUIA 2EM8A 2EOYA 2EQ1A 2L3JA 2WZOA 3F6HA 4JI8E 4R03A 2YTQA 1YYKA 4P7DA 2FGGA 4WXDA 2EQ3A 2K4VA 2EOEA 2N8XA 5AE3A 2K7IA 3DJWA 3IWCA 4DV7E 3MSWA 1IBLE 4GKJE 3H09A 4NHRA 4WX9A 1O0WA 1YUIA 4LF9E 4JI5E 4DV4E 4WSGA 1SFEA 1DI2A 2ODRC 1ZAAC 1PJSA 1UN6B 4M0VA 5KL3A 3T1HE 2VQEE 1WHQA 2E72A 4R8OA 4BC7A 3JAMC 4JI7E 5DNYA 2EOZA 2MKDA 2D9HA 1YFHA 2V86A 4DV0E 5KL6A 1ZBQA 2I9IA 2MKNA 4F9CB 4DMIA 1PJQA 5A6KA 3J7Yp 4DR5E 1HNXE 4BMJA 3ZOQB 3MHSC 4GEQB 2RSIA 4X62E 2YTEA 2EQ0A 4DV3E 5KL5A 2YTFA 4YHHE 2GPIA 2UU9E 2L33A 4LF5E 3VYXA 3ADIA 1FJGE 1KJKA 2EN3A 2YU5A 2EMKA 4RHBB 1PDAA 2EMFA 2M4IA 5IWAE 2EPLX 5TSEA 4DUYE 3F6GA 3VYYA 2LO3A 2EMBA 1BB8A 1YSAC 2HGHA 1ZU1A 3LLHA 3EPLA 4R2EA 1ZR9A 1TN9A 2H36X 4GZNC 2RQLA 1YYWA 2JWOA 2FTXB 2YTNA 4O24A 3HQ1A 2YRMA 5BR8E 4LF6E 1XNRE 4F6NA 4JI0E 2WBTA 5IV8B 2EPKX 2JR1A 3JU0A 2DLQA 4I8OA 4KWYA 1A1GA 2YSOA 5KL2A 1WHNA 1X48A 1EKZA 2YTDA 2UXBE 1WJPA 5FLXC 2UXCE 2M7QA 5AC5A 2DLKA 3J80C 2L2MA 1LLMC 2YPNA 3BIDA 1TF3A 2EPMX 1P47A 1N36E 4KHPE 2YTPA 4JI2E 2EJ4A 1FKAE 2EMGA 2LJUA 1DQ3A 1KYQA 1TF6A 1G2DC 1RQ0A 2LUPB 2HC5A 4BHCA 2EN8A 4DR2E 4R2PA 1NCSA 2EPPA 4X66E 2VQFE 2EMCA 1BBGA 2VRDA 1SR9A 2CSHA 2YRHA 2EN4A 1N32E 2E1MA 2LT7A 1UBDC 4B3TE 2NUGA 4F54A 2L8TA 2EM6A 4BCAA 1A1JA 2DRPA 1STUA 3HPSA 1RC7A 4R2RA 3RMPA 2EMYA 2RTXA 2LMZA 1IBME 2L2KB 2VE7C 3ADJA 2EN1A 4HEIA 4DR7E 4LFCE 4JI1E 2L92A 4DV1E 2YTIA 1YUJA 2JOXA 4GKKE 1QU6A 2MC6A 2EPXA 2IHR1 2LUQA 4L5NC 2EMXA 2LTSA 2JP9A 3KZZA 2EOSA 2J7JA 5ADZA 4B3SE 4BHBA 2F4VE 3ADGA 2NA2A 2ENHA 2NUFA 2B7TA 2RSMA 2UUBE 2EPZA 3KWRA 4YY3E 4N4RB 1BBOA 3J7AG 4RH8A 4M2ZA 3EPJA 1QNTA 2DIXA 3BGHA 2ENCA 5AASA 2NABA 2BB8A 4ZYEA 2L2NA 4LF4E 4JI3E 1X6HA 4ZYGA 4JI4E 3FIGA 4HTGA 5IT9C 1T4LB 2UXDE 1XNQE 2MDGA 2ELZA 4F6MA 4F2JC 2JXPA 4ZYHA 2LE2A 2GLIA 3LMLA 4O5GA 2KONA 1T4NA 2V8QB 3AUZA 3L00A 2N3GA 3EPKA 3HTXA 5KL7A 2WCC3 2LBSB 2M1SA 2MC5A 3OMLA 2EM3A 5CFFE
chains in the Genus database with same CATH topology
2UXCE 2M7QA 4JI8E 4R03A 4F9AB 1YYKA 1HR0E 4P7DA 3J80C 2FGGA 2L2MA 1ZBTA 2EZ6A 5T6JA 4DR4E 2K4VA 1YYOA 1N36E 2B3TB 2N3HA 5LL6R 1T4OA 3IWDA 4KHPE 5AE2A 1N33E 5AE3A 3DF6A 4JI2E 3DJWA 3IWCA 4DV7E 3MSWA 2JVAA 1IBLE 2G7HA 4DV6E 3IWBA 3C4BA 1FKAE 3H09A 1GZ6A 4GKJE 1X47A 1DQ3A 1O0WA 4LF9E 4JI5E 2JOBA 4DV2E 4BS9A 4DV4E 1RQ0A 2FV4B 4LFBE 1DI2A 2LUPB 4WYQB 3T1YE 4L8NA 2LTRA 4JV5E 2ODRC 4WPYA 2DMYA 2V85A 5LMNE 5A2QC 2V83A 4M0VA 2ODRD 4DR2E 3T1HE 2VQEE 3ADLA 2CPNA 1WHQA 3OTOE 4X66E 4R8OA 2B7VA 4BC7A 2VQFE 2UXBE 3JAMC 4JI7E 4BBYA 4AQYE 5DNYA 1SR9A 1XMOE 4DV5E 1N32E 2E1MA 4DR3E 2EWLA 4F9BB 1XMQE 2V86A 4DV0E 4B3TE 2V87A 2UUAE 2NUGA 4F54A 2L8TA 4BCAA 1YZ9A 4OOGC 1STUA 3HPSA 1GQEA 1ZBQA 1RC7A 4F9CB 4DMIA 4X64E 3RMPA 2RTXA 2LMZA 3J7Yp 3K6QA 4DR5E 1IBME 4X8WA 2L2KB 2KOUA 2VE7C 3ADJA 2L6MA 1HNXE 2VF1A 4DR7E 4LFAE 4P78A 4BMJA 3ZOQB 4LFCE 4GEQB 4DR6E 2F8BA 4NXME 4JI1E 3HPZA 2MDRA 2L92A 1WXRA 4DV1E 4X62E 4NXNE 2DSYA 4BC9A 2JOXA 4GKKE 2B9DA 3HXLA 4DV3E 1QU6A 4YHHE 1IBKE 2UU9E 2L33A 4LF5E 3VYXA 2MC6A 4DKKA 4LF7E 2KHXA 2IHR1 1FJGE 2LUQA 3ADIA 4L5NC 2LTSA 4WFTA 4K0KE 4B3RE 4M30A 1HNWE 5ADZA 4B3SE 4B3ME 2F4VE 2JY9A 2LJHA 2NA2A 3ADGA 4WSPA 2B7TA 2RSMA 2NUFA 2UUBE 2M4IA 5IWAE 4Q28A 1X49A 4DUYE 3F6GA 3KWRA 4YY3E 3VYYA 1UILA 4JI6E 3J7AG 2RS7A 4M2ZA 4X65E 1J5EE 4KZSA 1HNZE 3P1XA 2ZM6E 2DIXA 1PKPA 3LLHA 5AASA 2H36X 2L3CA 2RS6A 2YT4A 2UUCE 2L2NA 1N34E 4LF4E 2HHHE 4JI3E 2JWOA 4OX9E 4TUGA 1YYWA 4JI4E 1I94E 2FTXB 3FIGA 4DUZE 5AE1A 3AV0A 3HQ1A 4JYAE 5IT9C 5BR8E 1T4LB 4LF6E 5F3WA 2UXDE 4J8ZA 2E5LE 1XNQE 1UHZA 2V88A 2YZTA 4DR1E 1XNRE 1J26A 2LRSA 4JI0E 3C4TA 2DB2A 4LU9A 2JR1A 2V89A 3JU0A 2LE2A 3LMLA 4I8OA 2NUEA 2KONA 1T4NA 2V8QB 3AUZA 4LF8E 3J81C 3JTZA 5LMUE 4TUIA 1WHNA 1X48A 1EKZA 2N3GA 3HTXA 3VK6A 2LBSB 4LTYA 2L3JA 2WZOA 2M1SA 2MC5A 3OMLA 3F6HA 5CFFE 5FLXC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXC E;  4JI8 E;  1YYK A;  1HR0 E;  2L2M A;  2EZ6 A;  1ZBT A;  4DR4 E;  1YYO A;  1N36 E;  2B3T B;  2N3H A;  4KHP E;  1T4O A;  1N33 E;  4JI2 E;  4DV7 E;  2JVA A;  1IBL E;  4DV6 E;  4GKJ E;  1FKA E;  3C4B A;  1X47 A;  1O0W A;  4LF9 E;  4JI5 E;  4DV2 E;  4LFB E;  4DV4 E;  1RQ0 A;  1DI2 A;  2LUP B;  4WYQ B;  3T1Y E;  2LTR A;  4JV5 E;  2DMY A;  5LMN E;  4DR2 E;  3T1H E;  2VQE E;  3ADL A;  2CPN A;  1WHQ A;  3OTO E;  4X66 E;  2B7V A;  2VQF E;  2UXB E;  4JI7 E;  4AQY E;  1XMO E;  4DV5 E;  1N32 E;  4DR3 E;  1XMQ E;  4DV0 E;  4B3T E;  2UUA E;  2NUG A;  1YZ9 A;  4OOG C;  1STU A;  1GQE A;  1RC7 A;  2RTX A;  3J7Y p;  4DR5 E;  1IBM E;  4X8W A;  2L2K B;  1HNX E;  3ADJ A;  4DR7 E;  4LFA E;  4DR6 E;  4LFC E;  4NXM E;  4JI1 E;  2MDR A;  4DV1 E;  4X62 E;  4NXN E;  4GKK E;  4DV3 E;  1QU6 A;  4YHH E;  1IBK E;  2UU9 E;  2L33 A;  4LF5 E;  3VYX A;  4DKK A;  4LF7 E;  1FJG E;  2KHX A;  2IHR 1;  3ADI A;  2LUQ A;  4WFT A;  2LTS A;  4K0K E;  4B3R E;  4M30 A;  1HNW E;  4B3S E;  4B3M E;  2F4V E;  2JY9 A;  2LJH A;  2NA2 A;  3ADG A;  2NUF A;  2B7T A;  2RSM A;  2UUB E;  5IWA E;  1X49 A;  4DUY E;  4YY3 E;  3VYY A;  1UIL A;  4JI6 E;  2RS7 A;  4M2Z A;  4X65 E;  1J5E E;  1HNZ E;  3P1X A;  2ZM6 E;  2DIX A;  1PKP A;  3LLH A;  2L3C A;  2RS6 A;  2YT4 A;  2UUC E;  2L2N A;  1N34 E;  4LF4 E;  2HHH E;  4JI3 E;  4OX9 E;  1YYW A;  4JI4 E;  1I94 E;  4DUZ E;  4JYA E;  5BR8 E;  1T4L B;  4LF6 E;  2UXD E;  1XNQ E;  2E5L E;  1UHZ A;  4DR1 E;  1XNR E;  1J26 A;  2LRS A;  4JI0 E;  3C4T A;  2DB2 A;  2NUE A;  1T4N A;  4LF8 E;  5LMU E;  1WHN A;  1X48 A;  1EKZ A;  2N3G A;  3HTX A;  2LBS B;  2L3J A;  4X64 E;  5CFF E; 
#chains in the Genus database with same CATH topology
 4IS1 C;  4R2Q A;  2EZ6 A;  1ZBT A;  1F2I G;  5T6J A;  1YYO A;  5LL6 R;  2EP3 A;  3BF2 A;  3IWD A;  5AE2 A;  3DF6 A;  1A1K A;  4DV6 E;  2EOJ A;  2M9A A;  5A6J A;  3VHT B;  1X47 A;  2YWQ A;  1A1I A;  2JOB A;  2YTJ A;  4LFB E;  1NEI A;  2DMI A;  4WYQ B;  1EH6 A;  4L8N A;  4JV5 E;  4WPY A;  2CT1 A;  5LMN E;  5A2Q C;  2V83 A;  1PJT A;  1T38 A;  2ODR D;  2EPN A;  3ADL A;  3OTO E;  2B7V A;  1YPN A;  2YTG A;  1RMD A;  2ADR A;  4IJD A;  1N3G A;  5A6B D;  4R2C A;  1XMQ E;  4F9B B;  4OOG C;  1EH7 A;  4X64 E;  2EMH A;  5AC4 A;  1EH8 A;  1A1H A;  1L4S A;  2KOU A;  1X6E A;  4LFA E;  3HPZ A;  2MDR A;  3C6K A;  1X5W A;  2DSY A;  2EPC A;  3HXL A;  1WRJ A;  3UK3 C;  2EML A;  2EE8 A;  4DKK A;  2EOX A;  1MEY C;  2KHX A;  4LF7 E;  1B69 A;  4WFT A;  4B3R E;  1HNW E;  2ELY A;  4WSP A;  2EM9 A;  2EN7 A;  2LCE A;  1X49 A;  3MHH C;  2EM4 A;  2HJJ A;  3C6M A;  3KZY A;  5A69 A;  1A1L A;  1J5E E;  2EMI A;  3TQM A;  1PKP A;  2EPO A;  5LLQ A;  2YT4 A;  1T39 A;  2UUC E;  1N34 E;  4WXC A;  2EM7 A;  2YRK A;  1I94 E;  5AE1 A;  4O43 A;  3AV0 A;  1Z1B A;  5F3W A;  1UHZ A;  2EOF A;  2YZT A;  2DB2 A;  2V89 A;  4R2D A;  2NUE A;  5KL4 A;  3VK6 A;  2R1F A;  2EM2 A;  4LTY A;  4BBY A;  3J81 C;  1X3C A;  2LV2 A;  4F9A B;  1MGT A;  3THN A;  1HR0 E;  2EL5 A;  4NZV A;  5IXM B;  4DR4 E;  2EM5 A;  2LVH A;  2B3T B;  2N3H A;  1GTK A;  1T4O A;  4R2A A;  1JK2 A;  1N33 E;  4Q35 B;  2EPR A;  2EOR A;  2JVA A;  2G7H A;  2EM0 A;  3C4B A;  3IWB A;  1GZ6 A;  3THO B;  1IQO A;  4M9V C;  2EN2 A;  4DV2 E;  4BS9 A;  2FV4 B;  3T1Y E;  2LTR A;  2YSP A;  2DMY A;  4X9J A;  2R76 A;  2V85 A;  2WBU A;  1AH5 A;  2EMW A;  4MLQ A;  2CPN A;  1G2F C;  4R2S A;  1AAY A;  2WBS A;  2EMZ A;  4AQY E;  1XMO E;  4DV5 E;  4DR3 E;  2EWL A;  1IQS A;  4FK5 C;  2V87 A;  2UUA E;  2ENA A;  2EOM A;  1YZ9 A;  2EPA A;  1GQE A;  3EPH A;  1JK1 A;  2EOI A;  2EPU A;  3K6Q A;  4X8W A;  2L6M A;  2VF1 A;  4MLV A;  4P78 A;  4DR6 E;  4ZYD A;  2EOH A;  2F8B A;  4NXM E;  1WXR A;  2DGC A;  2EOO A;  4NXN E;  4BC9 A;  3BBG A;  2Q8U A;  2B9D A;  2EL6 A;  1DGC A;  4O4K A;  3QG5 C;  1IBK E;  2EL4 A;  4K0K E;  4M30 A;  5A6A A;  4B3M E;  1IMU A;  1A1F A;  2EMA A;  2JY9 A;  2LJH A;  2A25 A;  4Q28 A;  2GHF A;  2JYA A;  1X6F A;  1UIL A;  2BBG A;  4JI6 E;  2RS7 A;  3ECR A;  2JPA A;  4X65 E;  2EN6 A;  4KZS A;  1HNZ E;  3P1X A;  2PRT A;  2ZM6 E;  3M99 B;  2L3C A;  2RS6 A;  2HHH E;  4OX9 E;  3EQ1 A;  4TUG A;  2I13 A;  4DUZ E;  4JYA E;  4J8Z A;  2E5L E;  2V88 A;  4DR1 E;  2RPC A;  1J26 A;  2LRS A;  3C4T A;  2YU8 A;  2CTD A;  2YTO A;  4LU9 A;  2EOQ A;  5A6B A;  4LF8 E;  3JTZ A;  5LMU E;  4TUI A;  2EM8 A;  2EOY A;  2EQ1 A;  2L3J A;  2WZO A;  3F6H A;  4JI8 E;  4R03 A;  2YTQ A;  1YYK A;  4P7D A;  2FGG A;  4WXD A;  2EQ3 A;  2K4V A;  2EOE A;  2N8X A;  5AE3 A;  2K7I A;  3DJW A;  3IWC A;  4DV7 E;  3MSW A;  1IBL E;  4GKJ E;  3H09 A;  4NHR A;  4WX9 A;  1O0W A;  1YUI A;  4LF9 E;  4JI5 E;  4DV4 E;  4WSG A;  1SFE A;  1DI2 A;  2ODR C;  1ZAA C;  1PJS A;  1UN6 B;  4M0V A;  5KL3 A;  3T1H E;  2VQE E;  1WHQ A;  2E72 A;  4R8O A;  4BC7 A;  3JAM C;  4JI7 E;  5DNY A;  2EOZ A;  2MKD A;  2D9H A;  1YFH A;  2V86 A;  4DV0 E;  5KL6 A;  1ZBQ A;  2I9I A;  2MKN A;  4F9C B;  4DMI A;  1PJQ A;  5A6K A;  3J7Y p;  4DR5 E;  1HNX E;  4BMJ A;  3ZOQ B;  3MHS C;  4GEQ B;  2RSI A;  4X62 E;  2YTE A;  2EQ0 A;  4DV3 E;  5KL5 A;  2YTF A;  4YHH E;  2GPI A;  2UU9 E;  2L33 A;  4LF5 E;  3VYX A;  3ADI A;  1FJG E;  1KJK A;  2EN3 A;  2YU5 A;  2EMK A;  4RHB B;  1PDA A;  2EMF A;  2M4I A;  5IWA E;  2EPL X;  5TSE A;  4DUY E;  3F6G A;  3VYY A;  2LO3 A;  2EMB A;  1BB8 A;  1YSA C;  2HGH A;  1ZU1 A;  3LLH A;  3EPL A;  4R2E A;  1ZR9 A;  1TN9 A;  2H36 X;  4GZN C;  2RQL A;  1YYW A;  2JWO A;  2FTX B;  2YTN A;  4O24 A;  3HQ1 A;  2YRM A;  5BR8 E;  4LF6 E;  1XNR E;  4F6N A;  4JI0 E;  2WBT A;  5IV8 B;  2EPK X;  2JR1 A;  3JU0 A;  2DLQ A;  4I8O A;  4KWY A;  1A1G A;  2YSO A;  5KL2 A;  1WHN A;  1X48 A;  1EKZ A;  2YTD A;  2UXB E;  1WJP A;  5FLX C;  2UXC E;  2M7Q A;  5AC5 A;  2DLK A;  3J80 C;  2L2M A;  1LLM C;  2YPN A;  3BID A;  1TF3 A;  2EPM X;  1P47 A;  1N36 E;  4KHP E;  2YTP A;  4JI2 E;  2EJ4 A;  1FKA E;  2EMG A;  2LJU A;  1DQ3 A;  1KYQ A;  1TF6 A;  1G2D C;  1RQ0 A;  2LUP B;  2HC5 A;  4BHC A;  2EN8 A;  4DR2 E;  4R2P A;  1NCS A;  2EPP A;  4X66 E;  2VQF E;  2EMC A;  1BBG A;  2VRD A;  1SR9 A;  2CSH A;  2YRH A;  2EN4 A;  1N32 E;  2E1M A;  2LT7 A;  1UBD C;  4B3T E;  2NUG A;  4F54 A;  2L8T A;  2EM6 A;  4BCA A;  1A1J A;  2DRP A;  1STU A;  3HPS A;  1RC7 A;  4R2R A;  3RMP A;  2EMY A;  2RTX A;  2LMZ A;  1IBM E;  2L2K B;  2VE7 C;  3ADJ A;  2EN1 A;  4HEI A;  4DR7 E;  4LFC E;  4JI1 E;  2L92 A;  4DV1 E;  2YTI A;  1YUJ A;  2JOX A;  4GKK E;  1QU6 A;  2MC6 A;  2EPX A;  2IHR 1;  2LUQ A;  4L5N C;  2EMX A;  2LTS A;  2JP9 A;  3KZZ A;  2EOS A;  2J7J A;  5ADZ A;  4B3S E;  4BHB A;  2F4V E;  3ADG A;  2NA2 A;  2ENH A;  2NUF A;  2B7T A;  2RSM A;  2UUB E;  2EPZ A;  3KWR A;  4YY3 E;  4N4R B;  1BBO A;  3J7A G;  4RH8 A;  4M2Z A;  3EPJ A;  1QNT A;  2DIX A;  3BGH A;  2ENC A;  5AAS A;  2NAB A;  2BB8 A;  4ZYE A;  2L2N A;  4LF4 E;  4JI3 E;  1X6H A;  4ZYG A;  4JI4 E;  3FIG A;  4HTG A;  5IT9 C;  1T4L B;  2UXD E;  1XNQ E;  2MDG A;  2ELZ A;  4F6M A;  4F2J C;  2JXP A;  4ZYH A;  2LE2 A;  2GLI A;  3LML A;  4O5G A;  2KON A;  1T4N A;  2V8Q B;  3AUZ A;  3L00 A;  2N3G A;  3EPK A;  3HTX A;  5KL7 A;  2WCC 3;  2LBS B;  2M1S A;  2MC5 A;  3OML A;  2EM3 A;  5CFF E; 
#chains in the Genus database with same CATH homology
 2UXC E;  2M7Q A;  4JI8 E;  4R03 A;  4F9A B;  1YYK A;  1HR0 E;  4P7D A;  3J80 C;  2FGG A;  2L2M A;  1ZBT A;  2EZ6 A;  5T6J A;  4DR4 E;  2K4V A;  1YYO A;  1N36 E;  2B3T B;  2N3H A;  5LL6 R;  1T4O A;  3IWD A;  4KHP E;  5AE2 A;  1N33 E;  5AE3 A;  3DF6 A;  4JI2 E;  3DJW A;  3IWC A;  4DV7 E;  3MSW A;  2JVA A;  1IBL E;  2G7H A;  4DV6 E;  3IWB A;  3C4B A;  1FKA E;  3H09 A;  1GZ6 A;  4GKJ E;  1X47 A;  1DQ3 A;  1O0W A;  4LF9 E;  4JI5 E;  2JOB A;  4DV2 E;  4BS9 A;  4DV4 E;  1RQ0 A;  2FV4 B;  4LFB E;  1DI2 A;  2LUP B;  4WYQ B;  3T1Y E;  4L8N A;  2LTR A;  4JV5 E;  2ODR C;  4WPY A;  2DMY A;  2V85 A;  5LMN E;  5A2Q C;  2V83 A;  4M0V A;  2ODR D;  4DR2 E;  3T1H E;  2VQE E;  3ADL A;  2CPN A;  1WHQ A;  3OTO E;  4X66 E;  4R8O A;  2B7V A;  4BC7 A;  2VQF E;  2UXB E;  3JAM C;  4JI7 E;  4BBY A;  4AQY E;  5DNY A;  1SR9 A;  1XMO E;  4DV5 E;  1N32 E;  2E1M A;  4DR3 E;  2EWL A;  4F9B B;  1XMQ E;  2V86 A;  4DV0 E;  4B3T E;  2V87 A;  2UUA E;  2NUG A;  4F54 A;  2L8T A;  4BCA A;  1YZ9 A;  4OOG C;  1STU A;  3HPS A;  1GQE A;  1ZBQ A;  1RC7 A;  4F9C B;  4DMI A;  4X64 E;  3RMP A;  2RTX A;  2LMZ A;  3J7Y p;  3K6Q A;  4DR5 E;  1IBM E;  4X8W A;  2L2K B;  2KOU A;  2VE7 C;  3ADJ A;  2L6M A;  1HNX E;  2VF1 A;  4DR7 E;  4LFA E;  4P78 A;  4BMJ A;  3ZOQ B;  4LFC E;  4GEQ B;  4DR6 E;  2F8B A;  4NXM E;  4JI1 E;  3HPZ A;  2MDR A;  2L92 A;  1WXR A;  4DV1 E;  4X62 E;  4NXN E;  2DSY A;  4BC9 A;  2JOX A;  4GKK E;  2B9D A;  3HXL A;  4DV3 E;  1QU6 A;  4YHH E;  1IBK E;  2UU9 E;  2L33 A;  4LF5 E;  3VYX A;  2MC6 A;  4DKK A;  4LF7 E;  2KHX A;  2IHR 1;  1FJG E;  2LUQ A;  3ADI A;  4L5N C;  2LTS A;  4WFT A;  4K0K E;  4B3R E;  4M30 A;  1HNW E;  5ADZ A;  4B3S E;  4B3M E;  2F4V E;  2JY9 A;  2LJH A;  2NA2 A;  3ADG A;  4WSP A;  2B7T A;  2RSM A;  2NUF A;  2UUB E;  2M4I A;  5IWA E;  4Q28 A;  1X49 A;  4DUY E;  3F6G A;  3KWR A;  4YY3 E;  3VYY A;  1UIL A;  4JI6 E;  3J7A G;  2RS7 A;  4M2Z A;  4X65 E;  1J5E E;  4KZS A;  1HNZ E;  3P1X A;  2ZM6 E;  2DIX A;  1PKP A;  3LLH A;  5AAS A;  2H36 X;  2L3C A;  2RS6 A;  2YT4 A;  2UUC E;  2L2N A;  1N34 E;  4LF4 E;  2HHH E;  4JI3 E;  2JWO A;  4OX9 E;  4TUG A;  1YYW A;  4JI4 E;  1I94 E;  2FTX B;  3FIG A;  4DUZ E;  5AE1 A;  3AV0 A;  3HQ1 A;  4JYA E;  5IT9 C;  5BR8 E;  1T4L B;  4LF6 E;  5F3W A;  2UXD E;  4J8Z A;  2E5L E;  1XNQ E;  1UHZ A;  2V88 A;  2YZT A;  4DR1 E;  1XNR E;  1J26 A;  2LRS A;  4JI0 E;  3C4T A;  2DB2 A;  4LU9 A;  2JR1 A;  2V89 A;  3JU0 A;  2LE2 A;  3LML A;  4I8O A;  2NUE A;  2KON A;  1T4N A;  2V8Q B;  3AUZ A;  4LF8 E;  3J81 C;  3JTZ A;  5LMU E;  4TUI A;  1WHN A;  1X48 A;  1EKZ A;  2N3G A;  3HTX A;  3VK6 A;  2LBS B;  4LTY A;  2L3J A;  2WZO A;  2M1S A;  2MC5 A;  3OML A;  3F6H A;  5CFF E;  5FLX C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...