1WHNA

Solution structure of the dsrbd from hypothetical protein bab26260
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
128
structure length
128
Chain Sequence
GSSGSSGSGIIKMAIRFDRRAYPPQITPKMCLLEWCRREKLPQPVYETVQRTIDRMFCSVVTVAEQKYQSTLWDKSKKLAEQTAAIVCLRSQGLPEGRLGEESPSLNKRKREAPDQDPGGPRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords hypothetical protein RIKEN cDNA 2310016K04
publication title Solution structure of the dsRBD from hypothetical protein BAB26260
rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 14
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1whnA01
4DR3E 4DV0E 2HHHE 2F4VE 4JI2E 2LJHA 1O0WA 2LTRA 2E5LE 2NUGA 3P1XA 1WHQA 1YYKA 2B7VA 4LF5E 1QU6A 1YYWA 1T4OA 3T1HE 1HR0E 4LFAE 2JVAA 1XNQE 2L3JA 4X66E 3ADIA 4DV1E 1N36E 4JYAE 2L2KB 2KHXA 4NXME 2B7TA 4JV5E 2DMYA 3ADGA 3C4BA 2VQFE 1T4LB 2N3HA 4X62E 1XMOE 3OTOE 1XNRE 1IBLE 3T1YE 1YYOA 4JI5E 4LF7E 1DI2A 1X48A 2RS7A 4JI6E 1N33E 1FKAE 4KHPE 1UILA 2UXBE 2UXDE 2UUCE 2L2NA 4X64E 2DIXA 1YZ9A 2EZ6A 3ADJA 2UUBE 4YHHE 4M30A 4B3ME 4DV3E 1X47A 2N3GA 2RTXA 4B3TE 4DR4E 2RSMA 2NUFA 4B3RE 2L3CA 1N32E 2VQEE 1J26A 4DV4E 2L33A 4LFCE 1T4NA 5LMNE 4DR2E 1HNWE 3ADLA 3HTXA 4YY3E 4LFBE 4WFTA 4LF6E 4LF4E 1GQEA 4OX9E 4DR5E 4K0KE 4JI4E 4DKKA 4GKJE 4X65E 1PKPA 2LUQA 3C4TA 2CPNA 4X8WA 4JI3E 4LF8E 2RS6A 2YT4A 5LMUE 2IHR1 4DV2E 1EKZA 1IBME 4B3SE 2UXCE 3LLHA 2LUPB 4JI8E 1RQ0A 4DUZE 5BR8E 4OOGC 4JI1E 4NXNE 1HNZE 1WHNA 4DV7E 2LTSA 4M2ZA 1FJGE 4WYQB 3VYYA 1HNXE 4AQYE 4LF9E 2LRSA 1XMQE 4DUYE 4DR1E 2B3TB 4JI0E 3VYXA 5CFFE 1STUA 4DR6E 2JY9A 1X49A 2MDRA 4JI7E 2UU9E 4DV6E 1RC7A 1J5EE 2L2MA 2DB2A 5IWAE 2NUEA 4DR7E 4GKKE 1UHZA 2LBSB 1ZBTA 2NA2A 1N34E 2UUAE 3J7Yp 1I94E 2ZM6E 1IBKE 4DV5E
chains in the Genus database with same CATH superfamily
2EMCA 2WZOA 4P7DA 2R1FA 4DR3E 2HHHE 2EOFA 2F4VE 4JI2E 2LTRA 4X9JA 4Q35B 2JR1A 4F54A 5A6BD 1YYWA 1NEIA 3IWBA 4WPYA 4R2EA 1MEYC 2V85A 2YPNA 2GLIA 2EM3A 3ADIA 1N36E 2KHXA 1BB8A 4JV5E 1AAYA 2LCEA 2LT7A 2LV2A 1TF6A 2EPMX 1TN9A 2ENHA 1A1GA 3T1YE 2JXPA 2YTGA 2A25A 4FK5C 1X48A 4RH8A 1N33E 1FKAE 1A1HA 3JTZA 5KL5A 3BBGA 1JK2A 2BBGA 1IQOA 2UUCE 1LLMC 1YZ9A 4M0VA 1YUIA 2EMWA 3ADJA 4Q28A 1UN6B 3THNA 4YHHE 4B3ME 4DV3E 1WJPA 2RTXA 4B3TE 2RSMA 3ECRA 4B3RE 2EOJA 3EPLA 2VQEE 4R2SA 1EH7A 1X6FA 3EPJA 1PJQA 2RQLA 2L33A 2NABA 4GEQB 1ZAAC 1T4NA 5IXMB 4YY3E 1G2FC 4LF4E 1GQEA 4DR5E 4K0KE 2RPCA 2ODRC 5TSEA 2LUQA 4X8WA 4TUGA 2CPNA 1PDAA 2MKNA 2EP3A 5LLQA 2IHR1 4O24A 2UXCE 3MHSC 2LUPB 1RQ0A 5BR8E 4TUIA 2J7JA 4OOGC 1HNZE 2EOEA 3TQMA 4DV7E 2LO3A 2EPNA 4WYQB 2EPRA 4AQYE 4LF9E 2LMZA 4DUYE 4JI0E 2EMIA 5CFFE 1STUA 4IS1C 4R2CA 4BCAA 1T39A 5AE2A 2M7QA 4DV6E 1RC7A 2L2MA 1IMUA 5IWAE 1ZR9A 1UHZA 2NA2A 1N34E 2YTNA 3M99B 4BBYA 2KOUA 1I94E 2G7HA 2YRHA 4F2JC 1L4SA 4DV0E 2JOXA 3AV0A 3HXLA 4BS9A 2EL4A 1O0WA 2E5LE 2JP9A 2EPLX 3P1XA 1G2DC 4F9BB 2EOOA 3C6KA 3MHHC 3ZOQB 3L00A 2MKDA 4WSGA 1XNQE 4X66E 5KL4A 2EOYA 2EN2A 2B7TA 2V88A 2WBTA 2EQ0A 2DMYA 3C4BA 3IWCA 5A6AA 2M9AA 1ZU1A 2N8XA 2N3HA 2YTIA 1XMOE 5KL3A 3OTOE 2YTJA 1XNRE 1IBLE 2YU5A 2EMYA 2YTDA 4HEIA 4KHPE 3QG5C 2UXDE 2MDGA 3KZZA 4BHCA 1P47A 2EM7A 1MGTA 4BC9A 3F6GA 1A1JA 2EPKX 2WCC3 4HTGA 5A2QC 2NUFA 3JAMC 1YPNA 2V87A 2EM6A 2EMZA 3C6MA 4F9CB 2EPAA 2FTXB 1HNWE 2MC6A 2EMKA 4LU9A 3RMPA 2EQ1A 2EQ3A 2M4IA 1X6EA 2EN4A 4X65E 1PKPA 2R76A 4LF8E 4JI3E 5IV8B 2V83A 4NHRA 2RS6A 5IT9C 2EMHA 2L6MA 2EL6A 1EKZA 4WSPA 1SFEA 2E72A 5T6JA 5KL2A 4JI1E 4LTYA 2KONA 4NXNE 1WHNA 1BBGA 1WRJA 4J8ZA 1XMQE 2EN6A 2B3TB 4DR1E 1YUJA 5AASA 3VYXA 2EMAA 4DR6E 2YSOA 1F2IG 1X49A 2HJJA 2CSHA 2EOMA 4R03A 4MLQA 1J5EE 4GKKE 2YTFA 1UBDC 2ENCA 2EMLA 1WXRA 3VHTB 3J7Yp 5ADZA 2ZM6E 2YZTA 3JU0A 2EOQA 3VK6A 2EM2A 2LJHA 2NUGA 1A1LA 1SR9A 1B69A 1WHQA 1YYKA 2B7VA 2FGGA 2EOIA 4ZYHA 3J81C 2YWQA 1A1FA 1YFHA 4R2PA 2JVAA 1HR0E 4R2DA 3HPZA 4LFAE 4RHBB 4DV1E 2EE8A 3THOB 4JYAE 3DF6A 5AC5A 2VRDA 3ADGA 3AUZA 5KL7A 3BIDA 5A69A 5A6BA 2DSYA 4LF7E 2RS7A 4N4RB 1YSAC 4O5GA 2JWOA 2L2NA 4X64E 2EOZA 3BGHA 5A6JA 2DIXA 2EZ6A 3BF2A 2DRPA 4M30A 1AH5A 4F9AB 1X47A 3DJWA 4DR4E 4WXCA 3FIGA 2L3CA 4P78A 4WX9A 2EN3A 4DV4E 2D9HA 5LMNE 4DR2E 1KJKA 3HTXA 4WFTA 1JK1A 4LF6E 4OX9E 4O43A 3F6HA 1X3CA 3EPHA 3H09A 4DKKA 1NCSA 3MSWA 2EPUA 4DV2E 2E1MA 4B3SE 4F6NA 3LLHA 2DMIA 4JI8E 2WBUA 4DUZE 4I8OA 5AE1A 2V89A 5KL6A 2HC5A 2LTSA 4M2ZA 2ELYA 2LRSA 2CT1A 2DLQA 1A1IA 5FLXC 2EM5A 2FV4B 2HGHA 1Z1BA 2MC5A 2I13A 3LMLA 5AE3A 4BC7A 3IWDA 2UU9E 2B9DA 2DB2A 2NUEA 2EJ4A 2EN7A 4MLVA 2WBSA 2JOBA 2UUAE 1A1KA 1KYQA 1IBKE 2I9IA 2EM9A 4DV5E 2DGCA 4IJDA 2LE2A 4GZNC 2YTPA 2EM0A 2K7IA 4DMIA 4R2AA 4LF5E 1QU6A 2L92A 2L8TA 1T4OA 3T1HE 2EPOA 4KZSA 2EL5A 2GPIA 2L3JA 2L2KB 4F6MA 4NXME 2JYAA 2VQFE 5DNYA 2EMGA 1T4LB 4X62E 2EM8A 2EOSA 3KZYA 2VF1A 1EH6A 2EOXA 4R8OA 4ZYGA 2LVHA 4O4KA 1TF3A 1RMDA 4ZYEA 1GZ6A 2YTQA 1YYOA 2ADRA 4JI5E 2EMFA 1DGCA 4JI6E 1DI2A 2CTDA 1UILA 2RSIA 2UXBE 2EWLA 3HPSA 1X6HA 3K6QA 5F3WA 2H36X 4R2QA 2YU8A 2ENAA 2UUBE 1ZBQA 4WXDA 3EPKA 2EPZA 2DLKA 2M1SA 2JPAA 2N3GA 2PRTA 3J80C 1N32E 1BBOA 1J26A 2EN8A 2LJUA 2ODRD 4LFCE 3J7AG 3ADLA 4LFBE 2EORA 2VE7C 4M9VC 1GTKA 3OMLA 1QNTA 2V86A 4JI4E 4GKJE 3C4TA 1PJTA 4NZVA 2YT4A 5LMUE 1IBME 2YSPA 2YTOA 2YTEA 2EN1A 2YRKA 2EMBA 5A6KA 1FJGE 2K4VA 3VYYA 1HNXE 2Q8UA 2EM4A 2F8BA 5LL6R 2GHFA 4L8NA 4ZYDA 2JY9A 1EH8A 2V8QB 2EPPA 1N3GA 5AC4A 2EOHA 4KWYA 2MDRA 4JI7E 3HQ1A 2EPXA 1PJSA 4R2RA 3KWRA 3EQ1A 4L5NC 4DR7E 2BB8A 2YRMA 2LBSB 1ZBTA 2ELZA 4BMJA 1T38A 4BHBA 3UK3C 2EMXA 1DQ3A 1IQSA 1X5WA 2EPCA
chains in the Genus database with same CATH topology
2WZOA 2LE2A 4P7DA 4DR3E 3VK6A 2JOXA 4DV0E 3AV0A 2HHHE 2F4VE 4JI2E 2LJHA 3HXLA 4BS9A 1O0WA 2LTRA 2E5LE 2NUGA 3P1XA 1SR9A 4F9BB 1WHQA 4DMIA 2JR1A 1YYKA 2B7VA 4LF5E 1QU6A 2L92A 3ZOQB 2FGGA 2L8TA 4F54A 1YYWA 1T4OA 3T1HE 3IWBA 4WPYA 3J81C 4KZSA 2V85A 1HR0E 4LFAE 2JVAA 1XNQE 2L3JA 3HPZA 4X66E 3ADIA 4DV1E 1N36E 4JYAE 2L2KB 2KHXA 3DF6A 4NXME 2B7TA 2V88A 4JV5E 3IWCA 2DMYA 3ADGA 3C4BA 2VQFE 5DNYA 1T4LB 2N3HA 4X62E 1XMOE 3AUZA 3OTOE 2VF1A 4R8OA 1XNRE 1IBLE 3T1YE 1GZ6A 2DSYA 1YYOA 4JI5E 4LF7E 1DI2A 1X48A 2RS7A 4JI6E 1N33E 1FKAE 3JTZA 4KHPE 1UILA 4DV5E 2UXBE 2EWLA 2UXDE 2UUCE 2JWOA 2L2NA 4X64E 3HPSA 3K6QA 2DIXA 5F3WA 2H36X 4M0VA 1YZ9A 2EZ6A 4Q28A 3ADJA 2UUBE 1ZBQA 4YHHE 4M30A 4B3ME 4BC9A 3F6GA 1X47A 2M1SA 4F9AB 2N3GA 2RTXA 3DJWA 4DV3E 4B3TE 2RSMA 4DR4E 5A2QC 2NUFA 3FIGA 4B3RE 3J80C 4P78A 2L3CA 2VQEE 1N32E 3JAMC 1J26A 2V87A 4DV4E 2ODRD 2L33A 4GEQB 4LFCE 1T4NA 5LMNE 4DR2E 3J7AG 4F9CB 2FTXB 1HNWE 3ADLA 3HTXA 4YY3E 2MC6A 4LFBE 4WFTA 4LF6E 4LF4E 1GQEA 4LU9A 4OX9E 2VE7C 3RMPA 3F6HA 4DR5E 2M4IA 3OMLA 2V86A 4K0KE 3H09A 4JI4E 4DKKA 4GKJE 2ODRC 4X65E 1PKPA 2LUQA 3C4TA 2CPNA 3MSWA 4X8WA 4TUGA 4JI3E 4LF8E 2V83A 2RS6A 2YT4A 5LMUE 5IT9C 2IHR1 4DV2E 2E1MA 2L6MA 1EKZA 1IBME 4WSPA 4B3SE 3LLHA 2LUPB 2UXCE 4JI8E 5T6JA 1RQ0A 4DUZE 5BR8E 4TUIA 4I8OA 4OOGC 5AE1A 4JI1E 4LTYA 2KONA 4NXNE 1HNZE 2V89A 1I94E 1WHNA 4DV7E 2LTSA 4M2ZA 1FJGE 2K4VA 4WYQB 3VYYA 1HNXE 4J8ZA 4AQYE 4LF9E 2LMZA 2LRSA 4DUYE 2F8BA 1XMQE 4DR1E 2B3TB 5LL6R 4JI0E 5AASA 5FLXC 3VYXA 4L8NA 5CFFE 1STUA 2FV4B 4DR6E 2JY9A 1X49A 2MC5A 2V8QB 4BCAA 3LMLA 5AE3A 2MDRA 4JI7E 4BC7A 3HQ1A 3IWDA 5AE2A 2B9DA 2M7QA 4R03A 4DV6E 1RC7A 2UU9E 1J5EE 3KWRA 2L2MA 2DB2A 4L5NC 5IWAE 2NUEA 4DR7E 4GKKE 1UHZA 2LBSB 1ZBTA 2NA2A 4BMJA 1N34E 2JOBA 2UUAE 1WXRA 4BBYA 1DQ3A 3J7Yp 5ADZA 2KOUA 2ZM6E 1IBKE 2YZTA 3JU0A 2G7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR3 E;  4DV0 E;  2HHH E;  2F4V E;  4JI2 E;  2LJH A;  1O0W A;  2LTR A;  2E5L E;  2NUG A;  3P1X A;  1WHQ A;  1YYK A;  2B7V A;  4LF5 E;  1QU6 A;  1YYW A;  1T4O A;  3T1H E;  1HR0 E;  4LFA E;  2JVA A;  1XNQ E;  2L3J A;  4X66 E;  3ADI A;  4DV1 E;  1N36 E;  4JYA E;  2L2K B;  2KHX A;  4NXM E;  2B7T A;  4JV5 E;  2DMY A;  3ADG A;  3C4B A;  2VQF E;  1T4L B;  2N3H A;  4X62 E;  1XMO E;  3OTO E;  1XNR E;  1IBL E;  3T1Y E;  1YYO A;  4JI5 E;  4LF7 E;  1DI2 A;  1X48 A;  2RS7 A;  4JI6 E;  1N33 E;  1FKA E;  4KHP E;  1UIL A;  2UXB E;  2UXD E;  2UUC E;  2L2N A;  4X64 E;  2DIX A;  1YZ9 A;  2EZ6 A;  3ADJ A;  2UUB E;  4YHH E;  4M30 A;  4B3M E;  4DV3 E;  1X47 A;  2N3G A;  2RTX A;  4B3T E;  4DR4 E;  2RSM A;  2NUF A;  4B3R E;  2L3C A;  1N32 E;  2VQE E;  1J26 A;  4DV4 E;  2L33 A;  4LFC E;  1T4N A;  5LMN E;  4DR2 E;  1HNW E;  3ADL A;  3HTX A;  4YY3 E;  4LFB E;  4WFT A;  4LF6 E;  4LF4 E;  1GQE A;  4OX9 E;  4DR5 E;  4K0K E;  4JI4 E;  4DKK A;  4GKJ E;  4X65 E;  1PKP A;  2LUQ A;  3C4T A;  2CPN A;  4X8W A;  4JI3 E;  4LF8 E;  2RS6 A;  2YT4 A;  5LMU E;  2IHR 1;  4DV2 E;  1EKZ A;  1IBM E;  4B3S E;  2UXC E;  3LLH A;  2LUP B;  4JI8 E;  1RQ0 A;  4DUZ E;  5BR8 E;  4OOG C;  4JI1 E;  4NXN E;  1HNZ E;  1WHN A;  4DV7 E;  2LTS A;  4M2Z A;  1FJG E;  4WYQ B;  3VYY A;  1HNX E;  4AQY E;  4LF9 E;  2LRS A;  1XMQ E;  4DUY E;  4DR1 E;  2B3T B;  4JI0 E;  3VYX A;  5CFF E;  1STU A;  4DR6 E;  2JY9 A;  1X49 A;  2MDR A;  4JI7 E;  2UU9 E;  4DV6 E;  1RC7 A;  1J5E E;  2L2M A;  2DB2 A;  5IWA E;  2NUE A;  4DR7 E;  4GKK E;  1UHZ A;  2LBS B;  1ZBT A;  2NA2 A;  1N34 E;  2UUA E;  3J7Y p;  1I94 E;  2ZM6 E;  1IBK E;  4DV5 E; 
#chains in the Genus database with same CATH topology
 2EMC A;  2WZO A;  4P7D A;  2R1F A;  4DR3 E;  2HHH E;  2EOF A;  2F4V E;  4JI2 E;  2LTR A;  4X9J A;  4Q35 B;  2JR1 A;  4F54 A;  5A6B D;  1YYW A;  1NEI A;  3IWB A;  4WPY A;  4R2E A;  1MEY C;  2V85 A;  2YPN A;  2GLI A;  2EM3 A;  3ADI A;  1N36 E;  2KHX A;  1BB8 A;  4JV5 E;  1AAY A;  2LCE A;  2LT7 A;  2LV2 A;  1TF6 A;  2EPM X;  1TN9 A;  2ENH A;  1A1G A;  3T1Y E;  2JXP A;  2YTG A;  2A25 A;  4FK5 C;  1X48 A;  4RH8 A;  1N33 E;  1FKA E;  1A1H A;  3JTZ A;  5KL5 A;  3BBG A;  1JK2 A;  2BBG A;  1IQO A;  2UUC E;  1LLM C;  1YZ9 A;  4M0V A;  1YUI A;  2EMW A;  3ADJ A;  4Q28 A;  1UN6 B;  3THN A;  4YHH E;  4B3M E;  4DV3 E;  1WJP A;  2RTX A;  4B3T E;  2RSM A;  3ECR A;  4B3R E;  2EOJ A;  3EPL A;  2VQE E;  4R2S A;  1EH7 A;  1X6F A;  3EPJ A;  1PJQ A;  2RQL A;  2L33 A;  2NAB A;  4GEQ B;  1ZAA C;  1T4N A;  5IXM B;  4YY3 E;  1G2F C;  4LF4 E;  1GQE A;  4DR5 E;  4K0K E;  2RPC A;  2ODR C;  5TSE A;  2LUQ A;  4X8W A;  4TUG A;  2CPN A;  1PDA A;  2MKN A;  2EP3 A;  5LLQ A;  2IHR 1;  4O24 A;  2UXC E;  3MHS C;  2LUP B;  1RQ0 A;  5BR8 E;  4TUI A;  2J7J A;  4OOG C;  1HNZ E;  2EOE A;  3TQM A;  4DV7 E;  2LO3 A;  2EPN A;  4WYQ B;  2EPR A;  4AQY E;  4LF9 E;  2LMZ A;  4DUY E;  4JI0 E;  2EMI A;  5CFF E;  1STU A;  4IS1 C;  4R2C A;  4BCA A;  1T39 A;  5AE2 A;  2M7Q A;  4DV6 E;  1RC7 A;  2L2M A;  1IMU A;  5IWA E;  1ZR9 A;  1UHZ A;  2NA2 A;  1N34 E;  2YTN A;  3M99 B;  4BBY A;  2KOU A;  1I94 E;  2G7H A;  2YRH A;  4F2J C;  1L4S A;  4DV0 E;  2JOX A;  3AV0 A;  3HXL A;  4BS9 A;  2EL4 A;  1O0W A;  2E5L E;  2JP9 A;  2EPL X;  3P1X A;  1G2D C;  4F9B B;  2EOO A;  3C6K A;  3MHH C;  3ZOQ B;  3L00 A;  2MKD A;  4WSG A;  1XNQ E;  4X66 E;  5KL4 A;  2EOY A;  2EN2 A;  2B7T A;  2V88 A;  2WBT A;  2EQ0 A;  2DMY A;  3C4B A;  3IWC A;  5A6A A;  2M9A A;  1ZU1 A;  2N8X A;  2N3H A;  2YTI A;  1XMO E;  5KL3 A;  3OTO E;  2YTJ A;  1XNR E;  1IBL E;  2YU5 A;  2EMY A;  2YTD A;  4HEI A;  4KHP E;  3QG5 C;  2UXD E;  2MDG A;  3KZZ A;  4BHC A;  1P47 A;  2EM7 A;  1MGT A;  4BC9 A;  3F6G A;  1A1J A;  2EPK X;  2WCC 3;  4HTG A;  5A2Q C;  2NUF A;  3JAM C;  1YPN A;  2V87 A;  2EM6 A;  2EMZ A;  3C6M A;  4F9C B;  2EPA A;  2FTX B;  1HNW E;  2MC6 A;  2EMK A;  4LU9 A;  3RMP A;  2EQ1 A;  2EQ3 A;  2M4I A;  1X6E A;  2EN4 A;  4X65 E;  1PKP A;  2R76 A;  4LF8 E;  4JI3 E;  5IV8 B;  2V83 A;  4NHR A;  2RS6 A;  5IT9 C;  2EMH A;  2L6M A;  2EL6 A;  1EKZ A;  4WSP A;  1SFE A;  2E72 A;  5T6J A;  5KL2 A;  4JI1 E;  4LTY A;  2KON A;  4NXN E;  1WHN A;  1BBG A;  1WRJ A;  4J8Z A;  1XMQ E;  2EN6 A;  2B3T B;  4DR1 E;  1YUJ A;  5AAS A;  3VYX A;  2EMA A;  4DR6 E;  2YSO A;  1F2I G;  1X49 A;  2HJJ A;  2CSH A;  2EOM A;  4R03 A;  4MLQ A;  1J5E E;  4GKK E;  2YTF A;  1UBD C;  2ENC A;  2EML A;  1WXR A;  3VHT B;  3J7Y p;  5ADZ A;  2ZM6 E;  2YZT A;  3JU0 A;  2EOQ A;  3VK6 A;  2EM2 A;  2LJH A;  2NUG A;  1A1L A;  1SR9 A;  1B69 A;  1WHQ A;  1YYK A;  2B7V A;  2FGG A;  2EOI A;  4ZYH A;  3J81 C;  2YWQ A;  1A1F A;  1YFH A;  4R2P A;  2JVA A;  1HR0 E;  4R2D A;  3HPZ A;  4LFA E;  4RHB B;  4DV1 E;  2EE8 A;  3THO B;  4JYA E;  3DF6 A;  5AC5 A;  2VRD A;  3ADG A;  3AUZ A;  5KL7 A;  3BID A;  5A69 A;  5A6B A;  2DSY A;  4LF7 E;  2RS7 A;  4N4R B;  1YSA C;  4O5G A;  2JWO A;  2L2N A;  4X64 E;  2EOZ A;  3BGH A;  5A6J A;  2DIX A;  2EZ6 A;  3BF2 A;  2DRP A;  4M30 A;  1AH5 A;  4F9A B;  1X47 A;  3DJW A;  4DR4 E;  4WXC A;  3FIG A;  2L3C A;  4P78 A;  4WX9 A;  2EN3 A;  4DV4 E;  2D9H A;  5LMN E;  4DR2 E;  1KJK A;  3HTX A;  4WFT A;  1JK1 A;  4LF6 E;  4OX9 E;  4O43 A;  3F6H A;  1X3C A;  3EPH A;  3H09 A;  4DKK A;  1NCS A;  3MSW A;  2EPU A;  4DV2 E;  2E1M A;  4B3S E;  4F6N A;  3LLH A;  2DMI A;  4JI8 E;  2WBU A;  4DUZ E;  4I8O A;  5AE1 A;  2V89 A;  5KL6 A;  2HC5 A;  2LTS A;  4M2Z A;  2ELY A;  2LRS A;  2CT1 A;  2DLQ A;  1A1I A;  5FLX C;  2EM5 A;  2FV4 B;  2HGH A;  1Z1B A;  2MC5 A;  2I13 A;  3LML A;  5AE3 A;  4BC7 A;  3IWD A;  2UU9 E;  2B9D A;  2DB2 A;  2NUE A;  2EJ4 A;  2EN7 A;  4MLV A;  2WBS A;  2JOB A;  2UUA E;  1A1K A;  1KYQ A;  1IBK E;  2I9I A;  2EM9 A;  4DV5 E;  2DGC A;  4IJD A;  2LE2 A;  4GZN C;  2YTP A;  2EM0 A;  2K7I A;  4DMI A;  4R2A A;  4LF5 E;  1QU6 A;  2L92 A;  2L8T A;  1T4O A;  3T1H E;  2EPO A;  4KZS A;  2EL5 A;  2GPI A;  2L3J A;  2L2K B;  4F6M A;  4NXM E;  2JYA A;  2VQF E;  5DNY A;  2EMG A;  1T4L B;  4X62 E;  2EM8 A;  2EOS A;  3KZY A;  2VF1 A;  1EH6 A;  2EOX A;  4R8O A;  4ZYG A;  2LVH A;  4O4K A;  1TF3 A;  1RMD A;  4ZYE A;  1GZ6 A;  2YTQ A;  1YYO A;  2ADR A;  4JI5 E;  2EMF A;  1DGC A;  4JI6 E;  1DI2 A;  2CTD A;  1UIL A;  2RSI A;  2UXB E;  2EWL A;  3HPS A;  1X6H A;  3K6Q A;  5F3W A;  2H36 X;  4R2Q A;  2YU8 A;  2ENA A;  2UUB E;  1ZBQ A;  4WXD A;  3EPK A;  2EPZ A;  2DLK A;  2M1S A;  2JPA A;  2N3G A;  2PRT A;  3J80 C;  1N32 E;  1BBO A;  1J26 A;  2EN8 A;  2LJU A;  2ODR D;  4LFC E;  3J7A G;  3ADL A;  4LFB E;  2EOR A;  2VE7 C;  4M9V C;  1GTK A;  3OML A;  1QNT A;  2V86 A;  4JI4 E;  4GKJ E;  3C4T A;  1PJT A;  4NZV A;  2YT4 A;  5LMU E;  1IBM E;  2YSP A;  2YTO A;  2YTE A;  2EN1 A;  2YRK A;  2EMB A;  5A6K A;  1FJG E;  2K4V A;  3VYY A;  1HNX E;  2Q8U A;  2EM4 A;  2F8B A;  5LL6 R;  2GHF A;  4L8N A;  4ZYD A;  2JY9 A;  1EH8 A;  2V8Q B;  2EPP A;  1N3G A;  5AC4 A;  2EOH A;  4KWY A;  2MDR A;  4JI7 E;  3HQ1 A;  2EPX A;  1PJS A;  4R2R A;  3KWR A;  3EQ1 A;  4L5N C;  4DR7 E;  2BB8 A;  2YRM A;  2LBS B;  1ZBT A;  2ELZ A;  4BMJ A;  1T38 A;  4BHB A;  3UK3 C;  2EMX A;  1DQ3 A;  1IQS A;  1X5W A;  2EPC A; 
#chains in the Genus database with same CATH homology
 2WZO A;  2LE2 A;  4P7D A;  4DR3 E;  3VK6 A;  2JOX A;  4DV0 E;  3AV0 A;  2HHH E;  2F4V E;  4JI2 E;  2LJH A;  3HXL A;  4BS9 A;  1O0W A;  2LTR A;  2E5L E;  2NUG A;  3P1X A;  1SR9 A;  4F9B B;  1WHQ A;  4DMI A;  2JR1 A;  1YYK A;  2B7V A;  4LF5 E;  1QU6 A;  2L92 A;  3ZOQ B;  2FGG A;  2L8T A;  4F54 A;  1YYW A;  1T4O A;  3T1H E;  3IWB A;  4WPY A;  3J81 C;  4KZS A;  2V85 A;  1HR0 E;  4LFA E;  2JVA A;  1XNQ E;  2L3J A;  3HPZ A;  4X66 E;  3ADI A;  4DV1 E;  1N36 E;  4JYA E;  2L2K B;  2KHX A;  3DF6 A;  4NXM E;  2B7T A;  2V88 A;  4JV5 E;  3IWC A;  2DMY A;  3ADG A;  3C4B A;  2VQF E;  5DNY A;  1T4L B;  2N3H A;  4X62 E;  1XMO E;  3AUZ A;  3OTO E;  2VF1 A;  4R8O A;  1XNR E;  1IBL E;  3T1Y E;  1GZ6 A;  2DSY A;  1YYO A;  4JI5 E;  4LF7 E;  1DI2 A;  1X48 A;  2RS7 A;  4JI6 E;  1N33 E;  1FKA E;  3JTZ A;  4KHP E;  1UIL A;  4DV5 E;  2UXB E;  2EWL A;  2UXD E;  2UUC E;  2JWO A;  2L2N A;  4X64 E;  3HPS A;  3K6Q A;  2DIX A;  5F3W A;  2H36 X;  4M0V A;  1YZ9 A;  2EZ6 A;  4Q28 A;  3ADJ A;  2UUB E;  1ZBQ A;  4YHH E;  4M30 A;  4B3M E;  4BC9 A;  3F6G A;  1X47 A;  2M1S A;  4F9A B;  2N3G A;  2RTX A;  3DJW A;  4DV3 E;  4B3T E;  2RSM A;  4DR4 E;  5A2Q C;  2NUF A;  3FIG A;  4B3R E;  3J80 C;  4P78 A;  2L3C A;  2VQE E;  1N32 E;  3JAM C;  1J26 A;  2V87 A;  4DV4 E;  2ODR D;  2L33 A;  4GEQ B;  4LFC E;  1T4N A;  5LMN E;  4DR2 E;  3J7A G;  4F9C B;  2FTX B;  1HNW E;  3ADL A;  3HTX A;  4YY3 E;  2MC6 A;  4LFB E;  4WFT A;  4LF6 E;  4LF4 E;  1GQE A;  4LU9 A;  4OX9 E;  2VE7 C;  3RMP A;  3F6H A;  4DR5 E;  2M4I A;  3OML A;  2V86 A;  4K0K E;  3H09 A;  4JI4 E;  4DKK A;  4GKJ E;  2ODR C;  4X65 E;  1PKP A;  2LUQ A;  3C4T A;  2CPN A;  3MSW A;  4X8W A;  4TUG A;  4JI3 E;  4LF8 E;  2V83 A;  2RS6 A;  2YT4 A;  5LMU E;  5IT9 C;  2IHR 1;  4DV2 E;  2E1M A;  2L6M A;  1EKZ A;  1IBM E;  4WSP A;  4B3S E;  3LLH A;  2LUP B;  2UXC E;  4JI8 E;  5T6J A;  1RQ0 A;  4DUZ E;  5BR8 E;  4TUI A;  4I8O A;  4OOG C;  5AE1 A;  4JI1 E;  4LTY A;  2KON A;  4NXN E;  1HNZ E;  2V89 A;  1I94 E;  1WHN A;  4DV7 E;  2LTS A;  4M2Z A;  1FJG E;  2K4V A;  4WYQ B;  3VYY A;  1HNX E;  4J8Z A;  4AQY E;  4LF9 E;  2LMZ A;  2LRS A;  4DUY E;  2F8B A;  1XMQ E;  4DR1 E;  2B3T B;  5LL6 R;  4JI0 E;  5AAS A;  5FLX C;  3VYX A;  4L8N A;  5CFF E;  1STU A;  2FV4 B;  4DR6 E;  2JY9 A;  1X49 A;  2MC5 A;  2V8Q B;  4BCA A;  3LML A;  5AE3 A;  2MDR A;  4JI7 E;  4BC7 A;  3HQ1 A;  3IWD A;  5AE2 A;  2B9D A;  2M7Q A;  4R03 A;  4DV6 E;  1RC7 A;  2UU9 E;  1J5E E;  3KWR A;  2L2M A;  2DB2 A;  4L5N C;  5IWA E;  2NUE A;  4DR7 E;  4GKK E;  1UHZ A;  2LBS B;  1ZBT A;  2NA2 A;  4BMJ A;  1N34 E;  2JOB A;  2UUA E;  1WXR A;  4BBY A;  1DQ3 A;  3J7Y p;  5ADZ A;  2KOU A;  2ZM6 E;  1IBK E;  2YZT A;  3JU0 A;  2G7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...