1A1JA

Radr (zif268 variant) zinc finger-dna complex (gcgt site)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
84
structure length
84
Chain Sequence
RPYACPVESCDRRFSRSADLTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*CP*GP*T)-3')
publication title High-resolution structures of variant Zif268-DNA complexes: implications for understanding zinc finger-DNA recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 25
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 1997-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1jA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1jA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1jA03
2LO3A 2YTPA 2YRHA 5KL2A 2GLIA 4R2DA 1DGCA 1X6HA 2R1FA 2EMKA 2EMHA 1WJPA 2EM4A 5KL3A 1A1JA 3UK3C 2EPXA 2EM2A 2YRKA 2EJ4A 2ELZA 2EM8A 2GHFA 2EN8A 2EOQA 1A1GA 1MEYC 2DLQA 2EMBA 2DMIA 1A1FA 2CSHA 2EOXA 2EPAA 2EM9A 1TF6A 2JP9A 2EM6A 1BB8A 2EORA 2BB8A 2EMFA 2YTEA 2YRMA 2PRTA 1A1HA 4R2SA 3VHTB 5KL6A 2EOJA 2I13A 2WBTA 2A25A 1X6FA 2EOHA 4X9JA 2EPRA 2EOSA 4F2JC 1AAYA 2EN7A 2EOEA 2EPUA 1JK1A 2EM7A 2EM0A 2LT7A 2EMGA 1F2IG 4R2CA 2YSPA 2EN6A 2EN1A 2EOYA 4R2QA 2EQ0A 2JPAA 4R2RA 2D9HA 1X6EA 2EOMA 2HGHA 5KL4A 2ELYA 2EQ3A 2VRDA 4R2AA 4GZNC 2EMWA 2YTQA 1X5WA 1TN9A 3EPHA 2EL4A 4F6MA 1A1KA 2MDGA 1TF3A 2EOOA 1RMDA 2EPPA 2YTDA 2NABA 2LVHA 5KL5A 5KL7A 2MKNA 3MHHC 2EL5A 3EPLA 1G2DC 1BBOA 2EM3A 2EMZA 2EP3A 3MHSC 2EMCA 2EPCA 1YSAC 2ENHA 4WSGA 2LCEA 1YUJA 2DGCA 2ENCA 2DLKA 2EMXA 3EPKA 2YTIA 2EN3A 2YTGA 1NCSA 1Z1BA 2EE8A 2YTOA 1KJKA 4F6NA 2WBSA 2EN4A 2E72A 2RSIA 2YSOA 2YTNA 2EMAA 2EMLA 2EOFA 2J7JA 4IS1C 4IJDA 2DRPA 1B69A 2YU8A 2EOIA 1YUIA 1P47A 2EM5A 2EMIA 2CTDA 2EN2A 3M99B 4R2EA 2EL6A 2EMYA 2EOZA 1UN6B 2ADRA 4M9VC 1UBDC 2WCC3 2RPCA 4FK5C 2YTFA 4R2PA 3EPJA 1X3CA 2EQ1A 1ZAAC 1A1IA 2ENAA 1JK2A 1G2FC 2CT1A 2MKDA 2YTJA 2YU5A 2EPZA 1ZU1A 1ZR9A 1A1LA 2LV2A 1LLMC 2M9AA 2WBUA
chains in the Genus database with same CATH superfamily
2LRSA 4RHBB 5LMNE 1YPNA 1DGCA 2L33A 5A6AA 1FJGE 4DR4E 2E1MA 5AE1A 2F4VE 2EMHA 3BIDA 4JI8E 3J80C 2EPXA 1IQSA 2EM2A 2YRKA 4JI0E 4P78A 2ELZA 1IBLE 1T39A 4P7DA 1T4LB 1HNWE 3EQ1A 2L8TA 2KOUA 1MEYC 2DMIA 1HNZE 1FKAE 2CPNA 3OMLA 2EPAA 4JV5E 4LF6E 2M7QA 2EORA 2YRMA 2PRTA 1A1HA 4JI5E 4Q35B 2JY9A 3VHTB 3J81C 3C4TA 1WRJA 1T38A 4X8WA 2IHR1 1STUA 2EPRA 2EOSA 2EPUA 2EOEA 2EPKX 2JWOA 1JK1A 2EM7A 3VYXA 2BBGA 2EMGA 1F2IG 3AV0A 2YSPA 4ZYEA 2WZOA 4LTYA 2LJUA 2EOYA 2EQ0A 1X6EA 1AH5A 2EOMA 2HGHA 1PKPA 3HTXA 4R8OA 4YHHE 5A2QC 4GZNC 4R2AA 2L92A 4M2ZA 1X5WA 4O24A 4ZYGA 4DV3E 4DR5E 1IBKE 4DV0E 1TF3A 1J5EE 2YTDA 2NABA 4R03A 2YPNA 2JVAA 1QU6A 2K4VA 2EP3A 1HR0E 5AC5A 4L5NC 5BR8E 5FLXC 3AUZA 2LCEA 4K0KE 1MGTA 4M30A 4DR3E 2R76A 4NHRA 4B3TE 2EN3A 4KWYA 1NCSA 4JYAE 4BMJA 2WBSA 2YTNA 2UUCE 2EOFA 4HEIA 3P1XA 4DUZE 4LFCE 2HJJA 1PJTA 2EOIA 2EMIA 1XMQE 2CTDA 4AQYE 2EOZA 4WSPA 2V89A 3IWDA 2RS6A 2RPCA 1UILA 4LF9E 1L4SA 2YTFA 5DNYA 2LUPB 2V87A 2JOXA 1N32E 4OX9E 2YWQA 3DJWA 2MC5A 4L8NA 2I9IA 2VQEE 4N4RB 2LO3A 2ODRD 4KZSA 4F9AB 2YRHA 2GLIA 4BC7A 4DR7E 2G7HA 1IMUA 4JI4E 4RH8A 1PJSA 4WXCA 1N33E 4TUGA 2GHFA 2EN8A 3DF6A 1A1GA 2DLQA 1GTKA 3C4BA 2EOXA 1BB8A 4ZYDA 5LMUE 2LE2A 2V85A 2A25A 4X9JA 1YYWA 2EPMX 5LL6R 4F2JC 3LLHA 1EH8A 2LT7A 4DV5E 1SR9A 4YY3E 2YZTA 2D9HA 2LTRA 4LU9A 2EQ3A 4O5GA 2LTSA 3BF2A 5AASA 2ZM6E 3OTOE 2EMWA 4WPYA 2B7VA 5TSEA 1RQ0A 1PJQA 4DR2E 1XNQE 4F6MA 2EZ6A 2JR1A 5KL7A 5KL5A 3JU0A 5LLQA 2EM3A 2EMZA 3F6HA 1T4NA 3MHSC 2VE7C 3IWCA 2EPCA 1YSAC 4WSGA 2DLKA 2YTIA 5F3WA 4B3SE 2YTGA 3ADIA 2YTOA 4LF5E 1KJKA 1X49A 1WHNA 3ADJA 2RSIA 3QG5C 1GQEA 1ZBQA 2EMLA 2V86A 4BHCA 2UXDE 5A69A 3KZYA 1P47A 4MLQA 2EN2A 2JOBA 2Q8UA 4R2EA 2EL6A 5AC4A 1UBDC 2WCC3 1WHQA 2FTXB 1X3CA 2EQ1A 1A1IA 2ODRC 2B9DA 3KWRA 1XMOE 2CT1A 2MKDA 2VF1A 2EPZA 4NZVA 3HPZA 1A1LA 4X66E 2M9AA 3T1HE 1T4OA 2YTPA 5AE3A 5KL2A 4R2DA 1X6HA 2EMKA 5A6BD 2NA2A 3HPSA 4O4KA 1ZBTA 2EM4A 2UXCE 3THNA 3TQMA 1IBME 5IV8B 5A6BA 2DMYA 1PDAA 4DR1E 3F6GA 4LFBE 5T6JA 2EM8A 1YZ9A 1UHZA 2EOQA 2B7TA 1DI2A 2L3CA 1A1FA 2CSHA 3FIGA 2EM9A 4DV4E 2JP9A 4GKKE 2I13A 2EOJA 2L6MA 1N3GA 4JI2E 2RSMA 4GEQB 2FGGA 2EM0A 4R2CA 2L2KB 2V8QB 2UU9E 2UXBE 2EN1A 2JPAA 1EH6A 1N34E 4DR6E 3H09A 2H36X 2ELYA 1SFEA 2VRDA 4BS9A 2N3HA 2YTQA 4DUYE 1TN9A 3EPHA 4F54A 2MC6A 4DKKA 2EL4A 5IT9C 2DIXA 4DV6E 4LF8E 5IWAE 1YYOA 1A1KA 1I94E 1RMDA 2EPPA 2LVHA 1WXRA 2DB2A 2MKNA 3L00A 1BBOA 3RMPA 3ADGA 2FV4B 2EMCA 2DGCA 4MLVA 2ENCA 2M4IA 3BGHA 1XNRE 3ZOQB 1Z1BA 2EE8A 5A6KA 4BHBA 1EKZA 4JI7E 2KHXA 2EPLX 2KONA 2EMAA 2J7JA 4O43A 4TUIA 3C6KA 4WX9A 4JI6E 1B69A 2YU8A 3HQ1A 1YUIA 4F9BB 2EM5A 5AE2A 2GPIA 3M99B 2EMYA 1GZ6A 3J7Yp 1DQ3A 2ADRA 4M9VC 2M1SA 3KZZA 2LUQA 4FK5C 1O0WA 4R2PA 3EPJA 1X48A 1ZAAC 2V83A 2ENAA 2L2NA 1G2FC 2YTJA 2YU5A 2EPNA 4JI1E 1ZU1A 4X65E 3VYYA 2NUFA 2LV2A 1LLMC 3HXLA 4ZYHA 3BBGA 2LBSB 2N8XA 2DSYA 2R1FA 4DV2E 3K6QA 2HHHE 1WJPA 1NEIA 5KL3A 1A1JA 2L3JA 3UK3C 4WXDA 2VQFE 2LMZA 1HNXE 3J7AG 2EJ4A 3JAMC 2EMBA 3VK6A 4WFTA 1TF6A 4J8ZA 2YT4A 2EM6A 2YTEA 2BB8A 2EMFA 3THOB 4R2SA 5KL6A 2UUBE 2WBTA 2EOHA 1X6FA 4DV1E 4LF4E 2EWLA 3IWBA 4WYQB 2N3GA 3JTZA 4OOGC 1AAYA 2EN7A 2B3TB 4X64E 2JXPA 2RQLA 2EN6A 4R2QA 4DMIA 4R2RA 5ADZA 5KL4A 4X62E 3LMLA 2LJHA 1YFHA 4B3ME 2UUAE 1J26A 4LF7E 4GKJE 4BC9A 4B3RE 2MDGA 2EOOA 2JYAA 2RS7A 3C6MA 4I8OA 1YYKA 1X47A 4NXME 3MHHC 2EL5A 3MSWA 4BBYA 3EPLA 1G2DC 4KHPE 1RC7A 1IQOA 5A6JA 1YUJA 2ENHA 2EMXA 3EPKA 3ECRA 5CFFE 4JI3E 1QNTA 4F6NA 4M0VA 5IXMB 2EN4A 2E72A 2YSOA 2V88A 3ADLA 2HC5A 4IS1C 4Q28A 4IJDA 4HTGA 2DRPA 2L2MA 1KYQA 1EH7A 4BCAA 4F9CB 3T1YE 2NUEA 4LFAE 1BBGA 1N36E 1UN6B 2K7IA 4NXNE 2EPOA 2F8BA 2RTXA 2E5LE 1JK2A 2MDRA 2NUGA 1ZR9A 4DV7E 2WBUA
chains in the Genus database with same CATH topology
2LO3A 2YTPA 2YRHA 5KL2A 2GLIA 4R2DA 1DGCA 1X6HA 2R1FA 2EMKA 2EMHA 1WJPA 2EM4A 5KL3A 1A1JA 3UK3C 2EPXA 2EM2A 2YRKA 2EJ4A 2ELZA 2EM8A 2GHFA 2EN8A 2EOQA 1A1GA 1MEYC 2DLQA 2EMBA 2DMIA 1A1FA 2CSHA 2EOXA 2EPAA 2EM9A 1TF6A 2JP9A 2EM6A 1BB8A 2EORA 2BB8A 2EMFA 2YTEA 2YRMA 2PRTA 1A1HA 4R2SA 3VHTB 5KL6A 2EOJA 2I13A 2WBTA 2A25A 1X6FA 2EOHA 4X9JA 2EPRA 2EOSA 4F2JC 1AAYA 2EN7A 2EOEA 2EPUA 1JK1A 2EM7A 2EM0A 2LT7A 2EMGA 1F2IG 4R2CA 2YSPA 2EN6A 2EN1A 2EOYA 4R2QA 2EQ0A 2JPAA 4R2RA 2D9HA 1X6EA 2EOMA 2HGHA 5KL4A 2ELYA 2EQ3A 2VRDA 4R2AA 4GZNC 2EMWA 2YTQA 1X5WA 1TN9A 3EPHA 2EL4A 4F6MA 1A1KA 2MDGA 1TF3A 2EOOA 1RMDA 2EPPA 2YTDA 2NABA 2LVHA 5KL5A 5KL7A 2MKNA 3MHHC 2EL5A 3EPLA 1G2DC 1BBOA 2EM3A 2EMZA 2EP3A 3MHSC 2EMCA 2EPCA 1YSAC 2ENHA 4WSGA 2LCEA 1YUJA 2DGCA 2ENCA 2DLKA 2EMXA 3EPKA 2YTIA 2EN3A 2YTGA 1NCSA 1Z1BA 2EE8A 2YTOA 1KJKA 4F6NA 2WBSA 2EN4A 2E72A 2RSIA 2YSOA 2YTNA 2EMAA 2EMLA 2EOFA 2J7JA 4IS1C 4IJDA 2DRPA 1B69A 2YU8A 2EOIA 1YUIA 1P47A 2EM5A 2EMIA 2CTDA 2EN2A 3M99B 4R2EA 2EL6A 2EMYA 2EOZA 1UN6B 2ADRA 4M9VC 1UBDC 2WCC3 2RPCA 4FK5C 2YTFA 4R2PA 3EPJA 1X3CA 2EQ1A 1ZAAC 1A1IA 2ENAA 1JK2A 1G2FC 2CT1A 2MKDA 2YTJA 2YU5A 2EPZA 1ZU1A 1ZR9A 1A1LA 2LV2A 1LLMC 2M9AA 2WBUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LO3 A;  2YTP A;  2YRH A;  5KL2 A;  2GLI A;  4R2D A;  1DGC A;  1X6H A;  2R1F A;  2EMK A;  2EMH A;  1WJP A;  2EM4 A;  5KL3 A;  1A1J A;  3UK3 C;  2EPX A;  2EM2 A;  2YRK A;  2EJ4 A;  2ELZ A;  2EM8 A;  2GHF A;  2EN8 A;  2EOQ A;  1A1G A;  1MEY C;  2DLQ A;  2EMB A;  2DMI A;  1A1F A;  2CSH A;  2EOX A;  2EPA A;  2EM9 A;  1TF6 A;  2JP9 A;  2EM6 A;  1BB8 A;  2EOR A;  2BB8 A;  2EMF A;  2YTE A;  2YRM A;  2PRT A;  1A1H A;  4R2S A;  3VHT B;  5KL6 A;  2EOJ A;  2I13 A;  2WBT A;  2A25 A;  1X6F A;  2EOH A;  4X9J A;  2EPR A;  2EOS A;  4F2J C;  1AAY A;  2EN7 A;  2EOE A;  2EPU A;  1JK1 A;  2EM7 A;  2EM0 A;  2LT7 A;  2EMG A;  1F2I G;  4R2C A;  2YSP A;  2EN6 A;  2EN1 A;  2EOY A;  4R2Q A;  2EQ0 A;  2JPA A;  4R2R A;  2D9H A;  1X6E A;  2EOM A;  2HGH A;  5KL4 A;  2ELY A;  2EQ3 A;  2VRD A;  4R2A A;  4GZN C;  2EMW A;  2YTQ A;  1X5W A;  1TN9 A;  3EPH A;  2EL4 A;  4F6M A;  1A1K A;  2MDG A;  1TF3 A;  2EOO A;  1RMD A;  2EPP A;  2YTD A;  2NAB A;  2LVH A;  5KL5 A;  5KL7 A;  2MKN A;  3MHH C;  2EL5 A;  3EPL A;  1G2D C;  1BBO A;  2EM3 A;  2EMZ A;  2EP3 A;  3MHS C;  2EMC A;  2EPC A;  1YSA C;  2ENH A;  4WSG A;  2LCE A;  1YUJ A;  2DGC A;  2ENC A;  2DLK A;  2EMX A;  3EPK A;  2YTI A;  2EN3 A;  2YTG A;  1NCS A;  1Z1B A;  2EE8 A;  2YTO A;  1KJK A;  4F6N A;  2WBS A;  2EN4 A;  2E72 A;  2RSI A;  2YSO A;  2YTN A;  2EMA A;  2EML A;  2EOF A;  2J7J A;  4IS1 C;  4IJD A;  2DRP A;  1B69 A;  2YU8 A;  2EOI A;  1YUI A;  1P47 A;  2EM5 A;  2EMI A;  2CTD A;  2EN2 A;  3M99 B;  4R2E A;  2EL6 A;  2EMY A;  2EOZ A;  1UN6 B;  2ADR A;  4M9V C;  1UBD C;  2WCC 3;  2RPC A;  4FK5 C;  2YTF A;  4R2P A;  3EPJ A;  1X3C A;  2EQ1 A;  1ZAA C;  1A1I A;  2ENA A;  1JK2 A;  1G2F C;  2CT1 A;  2MKD A;  2YTJ A;  2YU5 A;  2EPZ A;  1ZU1 A;  1ZR9 A;  1A1L A;  2LV2 A;  1LLM C;  2M9A A;  2WBU A; 
#chains in the Genus database with same CATH topology
 2LRS A;  4RHB B;  5LMN E;  1YPN A;  1DGC A;  2L33 A;  5A6A A;  1FJG E;  4DR4 E;  2E1M A;  5AE1 A;  2F4V E;  2EMH A;  3BID A;  4JI8 E;  3J80 C;  2EPX A;  1IQS A;  2EM2 A;  2YRK A;  4JI0 E;  4P78 A;  2ELZ A;  1IBL E;  1T39 A;  4P7D A;  1T4L B;  1HNW E;  3EQ1 A;  2L8T A;  2KOU A;  1MEY C;  2DMI A;  1HNZ E;  1FKA E;  2CPN A;  3OML A;  2EPA A;  4JV5 E;  4LF6 E;  2M7Q A;  2EOR A;  2YRM A;  2PRT A;  1A1H A;  4JI5 E;  4Q35 B;  2JY9 A;  3VHT B;  3J81 C;  3C4T A;  1WRJ A;  1T38 A;  4X8W A;  2IHR 1;  1STU A;  2EPR A;  2EOS A;  2EPU A;  2EOE A;  2EPK X;  2JWO A;  1JK1 A;  2EM7 A;  3VYX A;  2BBG A;  2EMG A;  1F2I G;  3AV0 A;  2YSP A;  4ZYE A;  2WZO A;  4LTY A;  2LJU A;  2EOY A;  2EQ0 A;  1X6E A;  1AH5 A;  2EOM A;  2HGH A;  1PKP A;  3HTX A;  4R8O A;  4YHH E;  5A2Q C;  4GZN C;  4R2A A;  2L92 A;  4M2Z A;  1X5W A;  4O24 A;  4ZYG A;  4DV3 E;  4DR5 E;  1IBK E;  4DV0 E;  1TF3 A;  1J5E E;  2YTD A;  2NAB A;  4R03 A;  2YPN A;  2JVA A;  1QU6 A;  2K4V A;  2EP3 A;  1HR0 E;  5AC5 A;  4L5N C;  5BR8 E;  5FLX C;  3AUZ A;  2LCE A;  4K0K E;  1MGT A;  4M30 A;  4DR3 E;  2R76 A;  4NHR A;  4B3T E;  2EN3 A;  4KWY A;  1NCS A;  4JYA E;  4BMJ A;  2WBS A;  2YTN A;  2UUC E;  2EOF A;  4HEI A;  3P1X A;  4DUZ E;  4LFC E;  2HJJ A;  1PJT A;  2EOI A;  2EMI A;  1XMQ E;  2CTD A;  4AQY E;  2EOZ A;  4WSP A;  2V89 A;  3IWD A;  2RS6 A;  2RPC A;  1UIL A;  4LF9 E;  1L4S A;  2YTF A;  5DNY A;  2LUP B;  2V87 A;  2JOX A;  1N32 E;  4OX9 E;  2YWQ A;  3DJW A;  2MC5 A;  4L8N A;  2I9I A;  2VQE E;  4N4R B;  2LO3 A;  2ODR D;  4KZS A;  4F9A B;  2YRH A;  2GLI A;  4BC7 A;  4DR7 E;  2G7H A;  1IMU A;  4JI4 E;  4RH8 A;  1PJS A;  4WXC A;  1N33 E;  4TUG A;  2GHF A;  2EN8 A;  3DF6 A;  1A1G A;  2DLQ A;  1GTK A;  3C4B A;  2EOX A;  1BB8 A;  4ZYD A;  5LMU E;  2LE2 A;  2V85 A;  2A25 A;  4X9J A;  1YYW A;  2EPM X;  5LL6 R;  4F2J C;  3LLH A;  1EH8 A;  2LT7 A;  4DV5 E;  1SR9 A;  4YY3 E;  2YZT A;  2D9H A;  2LTR A;  4LU9 A;  2EQ3 A;  4O5G A;  2LTS A;  3BF2 A;  5AAS A;  2ZM6 E;  3OTO E;  2EMW A;  4WPY A;  2B7V A;  5TSE A;  1RQ0 A;  1PJQ A;  4DR2 E;  1XNQ E;  4F6M A;  2EZ6 A;  2JR1 A;  5KL7 A;  5KL5 A;  3JU0 A;  5LLQ A;  2EM3 A;  2EMZ A;  3F6H A;  1T4N A;  3MHS C;  2VE7 C;  3IWC A;  2EPC A;  1YSA C;  4WSG A;  2DLK A;  2YTI A;  5F3W A;  4B3S E;  2YTG A;  3ADI A;  2YTO A;  4LF5 E;  1KJK A;  1X49 A;  1WHN A;  3ADJ A;  2RSI A;  3QG5 C;  1GQE A;  1ZBQ A;  2EML A;  2V86 A;  4BHC A;  2UXD E;  5A69 A;  3KZY A;  1P47 A;  4MLQ A;  2EN2 A;  2JOB A;  2Q8U A;  4R2E A;  2EL6 A;  5AC4 A;  1UBD C;  2WCC 3;  1WHQ A;  2FTX B;  1X3C A;  2EQ1 A;  1A1I A;  2ODR C;  2B9D A;  3KWR A;  1XMO E;  2CT1 A;  2MKD A;  2VF1 A;  2EPZ A;  4NZV A;  3HPZ A;  1A1L A;  4X66 E;  2M9A A;  3T1H E;  1T4O A;  2YTP A;  5AE3 A;  5KL2 A;  4R2D A;  1X6H A;  2EMK A;  5A6B D;  2NA2 A;  3HPS A;  4O4K A;  1ZBT A;  2EM4 A;  2UXC E;  3THN A;  3TQM A;  1IBM E;  5IV8 B;  5A6B A;  2DMY A;  1PDA A;  4DR1 E;  3F6G A;  4LFB E;  5T6J A;  2EM8 A;  1YZ9 A;  1UHZ A;  2EOQ A;  2B7T A;  1DI2 A;  2L3C A;  1A1F A;  2CSH A;  3FIG A;  2EM9 A;  4DV4 E;  2JP9 A;  4GKK E;  2I13 A;  2EOJ A;  2L6M A;  1N3G A;  4JI2 E;  2RSM A;  4GEQ B;  2FGG A;  2EM0 A;  4R2C A;  2L2K B;  2V8Q B;  2UU9 E;  2UXB E;  2EN1 A;  2JPA A;  1EH6 A;  1N34 E;  4DR6 E;  3H09 A;  2H36 X;  2ELY A;  1SFE A;  2VRD A;  4BS9 A;  2N3H A;  2YTQ A;  4DUY E;  1TN9 A;  3EPH A;  4F54 A;  2MC6 A;  4DKK A;  2EL4 A;  5IT9 C;  2DIX A;  4DV6 E;  4LF8 E;  5IWA E;  1YYO A;  1A1K A;  1I94 E;  1RMD A;  2EPP A;  2LVH A;  1WXR A;  2DB2 A;  2MKN A;  3L00 A;  1BBO A;  3RMP A;  3ADG A;  2FV4 B;  2EMC A;  2DGC A;  4MLV A;  2ENC A;  2M4I A;  3BGH A;  1XNR E;  3ZOQ B;  1Z1B A;  2EE8 A;  5A6K A;  4BHB A;  1EKZ A;  4JI7 E;  2KHX A;  2EPL X;  2KON A;  2EMA A;  2J7J A;  4O43 A;  4TUI A;  3C6K A;  4WX9 A;  4JI6 E;  1B69 A;  2YU8 A;  3HQ1 A;  1YUI A;  4F9B B;  2EM5 A;  5AE2 A;  2GPI A;  3M99 B;  2EMY A;  1GZ6 A;  3J7Y p;  1DQ3 A;  2ADR A;  4M9V C;  2M1S A;  3KZZ A;  2LUQ A;  4FK5 C;  1O0W A;  4R2P A;  3EPJ A;  1X48 A;  1ZAA C;  2V83 A;  2ENA A;  2L2N A;  1G2F C;  2YTJ A;  2YU5 A;  2EPN A;  4JI1 E;  1ZU1 A;  4X65 E;  3VYY A;  2NUF A;  2LV2 A;  1LLM C;  3HXL A;  4ZYH A;  3BBG A;  2LBS B;  2N8X A;  2DSY A;  2R1F A;  4DV2 E;  3K6Q A;  2HHH E;  1WJP A;  1NEI A;  5KL3 A;  1A1J A;  2L3J A;  3UK3 C;  4WXD A;  2VQF E;  2LMZ A;  1HNX E;  3J7A G;  2EJ4 A;  3JAM C;  2EMB A;  3VK6 A;  4WFT A;  1TF6 A;  4J8Z A;  2YT4 A;  2EM6 A;  2YTE A;  2BB8 A;  2EMF A;  3THO B;  4R2S A;  5KL6 A;  2UUB E;  2WBT A;  2EOH A;  1X6F A;  4DV1 E;  4LF4 E;  2EWL A;  3IWB A;  4WYQ B;  2N3G A;  3JTZ A;  4OOG C;  1AAY A;  2EN7 A;  2B3T B;  4X64 E;  2JXP A;  2RQL A;  2EN6 A;  4R2Q A;  4DMI A;  4R2R A;  5ADZ A;  5KL4 A;  4X62 E;  3LML A;  2LJH A;  1YFH A;  4B3M E;  2UUA E;  1J26 A;  4LF7 E;  4GKJ E;  4BC9 A;  4B3R E;  2MDG A;  2EOO A;  2JYA A;  2RS7 A;  3C6M A;  4I8O A;  1YYK A;  1X47 A;  4NXM E;  3MHH C;  2EL5 A;  3MSW A;  4BBY A;  3EPL A;  1G2D C;  4KHP E;  1RC7 A;  1IQO A;  5A6J A;  1YUJ A;  2ENH A;  2EMX A;  3EPK A;  3ECR A;  5CFF E;  4JI3 E;  1QNT A;  4F6N A;  4M0V A;  5IXM B;  2EN4 A;  2E72 A;  2YSO A;  2V88 A;  3ADL A;  2HC5 A;  4IS1 C;  4Q28 A;  4IJD A;  4HTG A;  2DRP A;  2L2M A;  1KYQ A;  1EH7 A;  4BCA A;  4F9C B;  3T1Y E;  2NUE A;  4LFA E;  1BBG A;  1N36 E;  1UN6 B;  2K7I A;  4NXN E;  2EPO A;  2F8B A;  2RTX A;  2E5L E;  1JK2 A;  2MDR A;  2NUG A;  1ZR9 A;  4DV7 E;  2WBU A; 
#chains in the Genus database with same CATH homology
 2LO3 A;  2YTP A;  2YRH A;  5KL2 A;  2GLI A;  4R2D A;  1DGC A;  1X6H A;  2R1F A;  2EMK A;  2EMH A;  1WJP A;  2EM4 A;  5KL3 A;  1A1J A;  3UK3 C;  2EPX A;  2EM2 A;  2YRK A;  2EJ4 A;  2ELZ A;  2EM8 A;  2GHF A;  2EN8 A;  2EOQ A;  1A1G A;  1MEY C;  2DLQ A;  2EMB A;  2DMI A;  1A1F A;  2CSH A;  2EOX A;  2EPA A;  2EM9 A;  1TF6 A;  2JP9 A;  2EM6 A;  1BB8 A;  2EOR A;  2BB8 A;  2EMF A;  2YTE A;  2YRM A;  2PRT A;  1A1H A;  4R2S A;  3VHT B;  5KL6 A;  2EOJ A;  2I13 A;  2WBT A;  2A25 A;  1X6F A;  2EOH A;  4X9J A;  2EPR A;  2EOS A;  4F2J C;  1AAY A;  2EN7 A;  2EOE A;  2EPU A;  1JK1 A;  2EM7 A;  2EM0 A;  2LT7 A;  2EMG A;  1F2I G;  4R2C A;  2YSP A;  2EN6 A;  2EN1 A;  2EOY A;  4R2Q A;  2EQ0 A;  2JPA A;  4R2R A;  2D9H A;  1X6E A;  2EOM A;  2HGH A;  5KL4 A;  2ELY A;  2EQ3 A;  2VRD A;  4R2A A;  4GZN C;  2EMW A;  2YTQ A;  1X5W A;  1TN9 A;  3EPH A;  2EL4 A;  4F6M A;  1A1K A;  2MDG A;  1TF3 A;  2EOO A;  1RMD A;  2EPP A;  2YTD A;  2NAB A;  2LVH A;  5KL5 A;  5KL7 A;  2MKN A;  3MHH C;  2EL5 A;  3EPL A;  1G2D C;  1BBO A;  2EM3 A;  2EMZ A;  2EP3 A;  3MHS C;  2EMC A;  2EPC A;  1YSA C;  2ENH A;  4WSG A;  2LCE A;  1YUJ A;  2DGC A;  2ENC A;  2DLK A;  2EMX A;  3EPK A;  2YTI A;  2EN3 A;  2YTG A;  1NCS A;  1Z1B A;  2EE8 A;  2YTO A;  1KJK A;  4F6N A;  2WBS A;  2EN4 A;  2E72 A;  2RSI A;  2YSO A;  2YTN A;  2EMA A;  2EML A;  2EOF A;  2J7J A;  4IS1 C;  4IJD A;  2DRP A;  1B69 A;  2YU8 A;  2EOI A;  1YUI A;  1P47 A;  2EM5 A;  2EMI A;  2CTD A;  2EN2 A;  3M99 B;  4R2E A;  2EL6 A;  2EMY A;  2EOZ A;  1UN6 B;  2ADR A;  4M9V C;  1UBD C;  2WCC 3;  2RPC A;  4FK5 C;  2YTF A;  4R2P A;  3EPJ A;  1X3C A;  2EQ1 A;  1ZAA C;  1A1I A;  2ENA A;  1JK2 A;  1G2F C;  2CT1 A;  2MKD A;  2YTJ A;  2YU5 A;  2EPZ A;  1ZU1 A;  1ZR9 A;  1A1L A;  2LV2 A;  1LLM C;  2M9A A;  2WBU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...