1A1JA

Radr (zif268 variant) zinc finger-dna complex (gcgt site)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
84
structure length
84
Chain Sequence
RPYACPVESCDRRFSRSADLTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*CP*GP*T)-3')
publication title High-resolution structures of variant Zif268-DNA complexes: implications for understanding zinc finger-DNA recognition.
pubmed doi rcsb
source organism Mus musculus
total genus 25
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 1997-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1jA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1jA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1jA03
2WBUA 2EOEA 2YRKA 2EOHA 4R2PA 2YU8A 4IJDA 2YRMA 4F6NA 1A1FA 1Z1BA 2BB8A 5KL3A 1ZAAC 1X6EA 2EPXA 2YTGA 4F6MA 1BB8A 2EM8A 2DLQA 2EM5A 2EMCA 3EPKA 1TN9A 1WJPA 2EQ1A 2EMGA 2EM3A 2A25A 1X6HA 2LV2A 4WSGA 2YTNA 1AAYA 2DRPA 2YSPA 2EOMA 2CTDA 1A1KA 4R2SA 2EN6A 2YTQA 2WCC3 2EOQA 4R2EA 2EM7A 1P47A 2DMIA 1X5WA 2EPUA 2EQ0A 3MHHC 3EPLA 1A1LA 4R2CA 3UK3C 2EMIA 2EMLA 2GLIA 2DLKA 2CSHA 2LO3A 2EPRA 2EN2A 3VHTB 2YSOA 2EPZA 3EPJA 2R1FA 2CT1A 2YTIA 2RPCA 2YTOA 1TF3A 2EMFA 5KL7A 3M99B 1JK2A 2ELZA 2I13A 2YTFA 4R2QA 5KL4A 4F2JC 2LVHA 2EOFA 4IS1C 2MDGA 2LT7A 1DGCA 2ENHA 1KJKA 1UN6B 2NABA 2ELYA 2EOJA 2DGCA 2EOYA 2EOOA 2E72A 1A1JA 2EN8A 2EM4A 2EE8A 1JK1A 1YSAC 2EN4A 2JPAA 5KL6A 2EM2A 2EL5A 2EMHA 2EL4A 1G2DC 1X3CA 2ADRA 1A1GA 1BBOA 2EORA 2ENAA 2EP3A 3EPHA 2EMAA 2EPAA 2EN3A 2EPCA 4X9JA 2HGHA 2RSIA 2EMXA 2YTDA 1LLMC 2GHFA 1ZR9A 5KL5A 1X6FA 2JP9A 1A1HA 2WBSA 1ZU1A 4GZNC 5KL2A 1MEYC 1RMDA 2EL6A 2EM6A 2MKNA 2LCEA 2EOXA 1NCSA 2EMWA 2YTJA 2PRTA 1YUJA 2ENCA 2EOSA 2EMZA 2M9AA 2WBTA 1B69A 3MHSC 1UBDC 2YU5A 1G2FC 2YRHA 2EQ3A 2MKDA 2YTEA 1F2IG 2EPPA 2J7JA 2EM0A 2EOIA 2EMYA 4R2AA 2EMBA 1YUIA 1A1IA 2EM9A 4M9VC 4R2RA 2EMKA 2EJ4A 2VRDA 4R2DA 2EN7A 2YTPA 2EN1A 4FK5C 2D9HA 1TF6A 2EOZA
chains in the Genus database with same CATH superfamily
2JOXA 2YRKA 3KZYA 2EOHA 2YU8A 4F6NA 2EZ6A 4M2ZA 1GZ6A 2BBGA 2HC5A 2V83A 4GEQB 3L00A 1TN9A 1O0WA 2LJUA 4P78A 4Q35B 4DR5E 2DRPA 3J81C 1N34E 1YZ9A 2RSMA 1A1KA 4R2SA 2EN6A 1EH8A 1T4LB 3H09A 2RTXA 1HNWE 4B3ME 2L3CA 1XNQE 2EQ0A 2UUBE 2L2NA 3ADLA 4J8ZA 3UK3C 2ODRC 4DR7E 3VHTB 2M7QA 2CT1A 2R76A 2L33A 1TF3A 3M99B 1JK2A 4DV3E 3HQ1A 4R2QA 1IBLE 5A6BD 5LMNE 2RQLA 5A6JA 2YT4A 4NHRA 1WRJA 2EOFA 3BGHA 5IWAE 2LT7A 2B9DA 4BMJA 2EWLA 1KJKA 2ELYA 2EOJA 2EOYA 2E72A 2EN8A 4K0KE 4RHBB 2FGGA 1BBOA 3HPZA 2ADRA 2JR1A 3FIGA 5A2QC 1A1GA 1HNZE 1EH6A 3VYYA 3DJWA 2EPAA 2EPCA 4X9JA 2I9IA 1X49A 3ECRA 1X6FA 3KWRA 5AC4A 3BBGA 2L2KB 1RMDA 2EM6A 2EMWA 4HEIA 4OOGC 2V87A 2ENCA 4JV5E 2KHXA 4X8WA 3MHSC 4NXNE 2YU5A 2F4VE 3ADIA 2J7JA 4NZVA 4BC9A 4B3TE 2YPNA 3AUZA 1J5EE 1STUA 4WX9A 2YTPA 1WHNA 4ZYDA 2N8XA 3IWCA 3C6MA 3OMLA 1XMOE 5DNYA 2WBUA 1IQSA 1IBME 2DMYA 2YRMA 1Z1BA 2JVAA 4X64E 2VE7C 4O24A 5IXMB 1ZBQA 2EM8A 2DLQA 2VQEE 2EMCA 1WJPA 5LMUE 2EQ1A 4JI1E 2EMGA 2N3HA 1N33E 1HNXE 1IMUA 1X6HA 1AAYA 1N36E 2CTDA 4LF7E 2WCC3 2EOQA 4R2EA 1IQOA 3BIDA 4RH8A 2IHR1 4LF4E 2DMIA 4ZYGA 5T6JA 3EPLA 1SR9A 4LFBE 1X47A 2R1FA 2YTIA 4YY3E 2YWQA 4WFTA 4R03A 2JYAA 2UXDE 1EKZA 2YTFA 4GKKE 1BBGA 4B3RE 1DQ3A 2MDGA 2UUCE 3P1XA 3HXLA 4ZYHA 4LFCE 1YYKA 2UUAE 2EN4A 2NUGA 4MLVA 2FV4B 2N3GA 2EPNA 1X3CA 3LMLA 5AASA 3JAMC 3EPHA 2EN3A 2HGHA 2RSIA 5AC5A 2YTDA 2LTRA 2LTSA 2GHFA 2WZOA 2LE2A 1YYWA 2JP9A 2FTXB 2L2MA 1A1HA 3J7AG 1L4SA 1ZU1A 4DR4E 1MEYC 1IBKE 1NCSA 5LL6R 2YTJA 2PRTA 3J7Yp 2EMZA 2M9AA 1B69A 4DV6E 5AE1A 2B7VA 2YRHA 2MKDA 2KOUA 1F2IG 2EPPA 3JTZA 4R2AA 2M1SA 2CPNA 1T4NA 4JI2E 2ODRD 4OX9E 2EN7A 4X62E 2D9HA 2RS7A 3ADJA 2UU9E 2M4IA 4F9CB 2EOEA 4F9AB 3ZOQB 4R2PA 5A69A 4JI8E 1A1FA 4WSPA 5F3WA 1X6EA 2EPXA 5LLQA 4F6MA 4JI3E 1BB8A 1PDAA 2EM5A 3EPKA 3BF2A 1WXRA 4YHHE 2EM3A 2A25A 4WSGA 4DR1E 2YTNA 1N32E 4X65E 4AQYE 4DMIA 3T1YE 1X48A 2JOBA 4BHCA 2YTQA 2V89A 4JI0E 1KYQA 1P47A 2EPUA 3MHHC 1A1LA 1AH5A 2EMLA 4DR2E 4DR3E 2CSHA 2GLIA 2EPRA 4JI6E 2EN2A 2EPKX 2GPIA 4WYQB 2EPZA 3EPJA 2LRSA 1NEIA 3TQMA 4LF8E 5BR8E 4WPYA 2YTOA 1UILA 2DB2A 1QU6A 2EMFA 4LU9A 5KL7A 4DV5E 5KL4A 3C6KA 2Q8UA 4DV2E 3THNA 2UXCE 4LTYA 4BBYA 1DGCA 5TSEA 1UN6B 4TUIA 2DSYA 2NABA 3OTOE 5A6BA 2MC5A 5AE3A 4JI7E 2JY9A 2EE8A 3QG5C 1YSAC 1YFHA 1EH7A 2NUFA 2JPAA 5KL6A 2EM2A 2E1MA 5A6KA 5FLXC 4NXME 1T38A 2EMHA 3THOB 5A6AA 2ZM6E 1G2DC 2EORA 2YZTA 2ENAA 2EP3A 4O4KA 3C4BA 3LLHA 2EMXA 1LLMC 1J26A 3F6HA 1ZR9A 5KL5A 2L3JA 4M0VA 4GZNC 4BHBA 4M30A 3K6QA 5KL2A 4DV1E 1T39A 2EL6A 1T4OA 2MKNA 2LCEA 2LUQA 2EOXA 1YUJA 4DUYE 3T1HE 4ZYEA 2MDRA 4L8NA 1FKAE 2EPLX 4BS9A 2HJJA 1HR0E 2JWOA 4GKJE 2E5LE 2EQ3A 2V85A 2L92A 2K7IA 2EOIA 4L5NC 1YUIA 1A1IA 2EM9A 4M9VC 2EMKA 2EJ4A 2VRDA 1GTKA 4DKKA 2EN1A 4WXCA 4FK5C 3C4TA 4DV0E 1FJGE 1YYOA 2EOZA 4X66E 2LJHA 2KONA 3EQ1A 4BC7A 3F6GA 3IWDA 2B7TA 4IJDA 4KZSA 3KZZA 4F54A 3HPSA 1YPNA 2BB8A 5KL3A 1ZAAC 4MLQA 2H36X 2YTGA 4P7DA 4LF9E 2NA2A 4DUZE 4N4RB 1MGTA 2L6MA 1QNTA 2LV2A 5CFFE 3VYXA 2YSPA 2EOMA 4TUGA 2V86A 4KHPE 1PJTA 1SFEA 3ADGA 2EM7A 4KWYA 4JYAE 4Q28A 1X5WA 4LFAE 1PKPA 4R2CA 4DR6E 2EMIA 2DLKA 2LO3A 2YSOA 2V88A 4O5GA 4BCAA 1ZBTA 2V8QB 2RPCA 4R8OA 4DV4E 4LF6E 2MC6A 4WXDA 2ELZA 2I13A 2F8BA 4F9BB 4F2JC 2UXBE 2LVHA 1WHQA 4IS1C 1DI2A 2NUEA 4JI5E 2ENHA 2LBSB 5IV8B 1RC7A 2DGCA 2EOOA 2VQFE 1A1JA 2EM4A 1JK1A 3JU0A 2HHHE 2EL5A 1XMQE 3AV0A 2EL4A 2K4VA 3VK6A 4B3SE 2VF1A 1PJQA 2EMAA 4O43A 3MSWA 4DV7E 2L8TA 1GQEA 4I8OA 3RMPA 2WBSA 1N3GA 2RS6A 2EPMX 2B3TB 5IT9C 1I94E 5AE2A 2DIXA 2LMZA 4HTGA 1RQ0A 2EOSA 3IWBA 4JI4E 2WBTA 1UBDC 1XNRE 2JXPA 1G2FC 2YTEA 2LUPB 2EM0A 2EMYA 2EPOA 2EMBA 3J80C 4R2RA 4R2DA 2G7HA 5ADZA 3HTXA 3DF6A 1TF6A 1UHZA 4LF5E 1PJSA
chains in the Genus database with same CATH topology
2WBUA 2EOEA 2YRKA 2EOHA 4R2PA 2YU8A 4IJDA 2YRMA 4F6NA 1A1FA 1Z1BA 2BB8A 5KL3A 1ZAAC 1X6EA 2EPXA 2YTGA 4F6MA 1BB8A 2EM8A 2DLQA 2EM5A 2EMCA 3EPKA 1TN9A 1WJPA 2EQ1A 2EMGA 2EM3A 2A25A 1X6HA 2LV2A 4WSGA 2YTNA 1AAYA 2DRPA 2YSPA 2EOMA 2CTDA 1A1KA 4R2SA 2EN6A 2YTQA 2WCC3 2EOQA 4R2EA 2EM7A 1P47A 2DMIA 1X5WA 2EPUA 2EQ0A 3MHHC 3EPLA 1A1LA 4R2CA 3UK3C 2EMIA 2EMLA 2GLIA 2DLKA 2CSHA 2LO3A 2EPRA 2EN2A 3VHTB 2YSOA 2EPZA 3EPJA 2R1FA 2CT1A 2YTIA 2RPCA 2YTOA 1TF3A 2EMFA 5KL7A 3M99B 1JK2A 2ELZA 2I13A 2YTFA 4R2QA 5KL4A 4F2JC 2LVHA 2EOFA 4IS1C 2MDGA 2LT7A 1DGCA 2ENHA 1KJKA 1UN6B 2NABA 2ELYA 2EOJA 2DGCA 2EOYA 2EOOA 2E72A 1A1JA 2EN8A 2EM4A 2EE8A 1JK1A 1YSAC 2EN4A 2JPAA 5KL6A 2EM2A 2EL5A 2EMHA 2EL4A 1G2DC 1X3CA 2ADRA 1A1GA 1BBOA 2EORA 2ENAA 2EP3A 3EPHA 2EMAA 2EPAA 2EN3A 2EPCA 4X9JA 2HGHA 2RSIA 2EMXA 2YTDA 1LLMC 2GHFA 1ZR9A 5KL5A 1X6FA 2JP9A 1A1HA 2WBSA 1ZU1A 4GZNC 5KL2A 1MEYC 1RMDA 2EL6A 2EM6A 2MKNA 2LCEA 2EOXA 1NCSA 2EMWA 2YTJA 2PRTA 1YUJA 2ENCA 2EOSA 2EMZA 2M9AA 2WBTA 1B69A 3MHSC 1UBDC 2YU5A 1G2FC 2YRHA 2EQ3A 2MKDA 2YTEA 1F2IG 2EPPA 2J7JA 2EM0A 2EOIA 2EMYA 4R2AA 2EMBA 1YUIA 1A1IA 2EM9A 4M9VC 4R2RA 2EMKA 2EJ4A 2VRDA 4R2DA 2EN7A 2YTPA 2EN1A 4FK5C 2D9HA 1TF6A 2EOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WBU A;  2EOE A;  2YRK A;  2EOH A;  4R2P A;  2YU8 A;  4IJD A;  2YRM A;  4F6N A;  1A1F A;  1Z1B A;  2BB8 A;  5KL3 A;  1ZAA C;  1X6E A;  2EPX A;  2YTG A;  4F6M A;  1BB8 A;  2EM8 A;  2DLQ A;  2EM5 A;  2EMC A;  3EPK A;  1TN9 A;  1WJP A;  2EQ1 A;  2EMG A;  2EM3 A;  2A25 A;  1X6H A;  2LV2 A;  4WSG A;  2YTN A;  1AAY A;  2DRP A;  2YSP A;  2EOM A;  2CTD A;  1A1K A;  4R2S A;  2EN6 A;  2YTQ A;  2WCC 3;  2EOQ A;  4R2E A;  2EM7 A;  1P47 A;  2DMI A;  1X5W A;  2EPU A;  2EQ0 A;  3MHH C;  3EPL A;  1A1L A;  4R2C A;  3UK3 C;  2EMI A;  2EML A;  2GLI A;  2DLK A;  2CSH A;  2LO3 A;  2EPR A;  2EN2 A;  3VHT B;  2YSO A;  2EPZ A;  3EPJ A;  2R1F A;  2CT1 A;  2YTI A;  2RPC A;  2YTO A;  1TF3 A;  2EMF A;  5KL7 A;  3M99 B;  1JK2 A;  2ELZ A;  2I13 A;  2YTF A;  4R2Q A;  5KL4 A;  4F2J C;  2LVH A;  2EOF A;  4IS1 C;  2MDG A;  2LT7 A;  1DGC A;  2ENH A;  1KJK A;  1UN6 B;  2NAB A;  2ELY A;  2EOJ A;  2DGC A;  2EOY A;  2EOO A;  2E72 A;  1A1J A;  2EN8 A;  2EM4 A;  2EE8 A;  1JK1 A;  1YSA C;  2EN4 A;  2JPA A;  5KL6 A;  2EM2 A;  2EL5 A;  2EMH A;  2EL4 A;  1G2D C;  1X3C A;  2ADR A;  1A1G A;  1BBO A;  2EOR A;  2ENA A;  2EP3 A;  3EPH A;  2EMA A;  2EPA A;  2EN3 A;  2EPC A;  4X9J A;  2HGH A;  2RSI A;  2EMX A;  2YTD A;  1LLM C;  2GHF A;  1ZR9 A;  5KL5 A;  1X6F A;  2JP9 A;  1A1H A;  2WBS A;  1ZU1 A;  4GZN C;  5KL2 A;  1MEY C;  1RMD A;  2EL6 A;  2EM6 A;  2MKN A;  2LCE A;  2EOX A;  1NCS A;  2EMW A;  2YTJ A;  2PRT A;  1YUJ A;  2ENC A;  2EOS A;  2EMZ A;  2M9A A;  2WBT A;  1B69 A;  3MHS C;  1UBD C;  2YU5 A;  1G2F C;  2YRH A;  2EQ3 A;  2MKD A;  2YTE A;  1F2I G;  2EPP A;  2J7J A;  2EM0 A;  2EOI A;  2EMY A;  4R2A A;  2EMB A;  1YUI A;  1A1I A;  2EM9 A;  4M9V C;  4R2R A;  2EMK A;  2EJ4 A;  2VRD A;  4R2D A;  2EN7 A;  2YTP A;  2EN1 A;  4FK5 C;  2D9H A;  1TF6 A;  2EOZ A; 
#chains in the Genus database with same CATH topology
 2JOX A;  2YRK A;  3KZY A;  2EOH A;  2YU8 A;  4F6N A;  2EZ6 A;  4M2Z A;  1GZ6 A;  2BBG A;  2HC5 A;  2V83 A;  4GEQ B;  3L00 A;  1TN9 A;  1O0W A;  2LJU A;  4P78 A;  4Q35 B;  4DR5 E;  2DRP A;  3J81 C;  1N34 E;  1YZ9 A;  2RSM A;  1A1K A;  4R2S A;  2EN6 A;  1EH8 A;  1T4L B;  3H09 A;  2RTX A;  1HNW E;  4B3M E;  2L3C A;  1XNQ E;  2EQ0 A;  2UUB E;  2L2N A;  3ADL A;  4J8Z A;  3UK3 C;  2ODR C;  4DR7 E;  3VHT B;  2M7Q A;  2CT1 A;  2R76 A;  2L33 A;  1TF3 A;  3M99 B;  1JK2 A;  4DV3 E;  3HQ1 A;  4R2Q A;  1IBL E;  5A6B D;  5LMN E;  2RQL A;  5A6J A;  2YT4 A;  4NHR A;  1WRJ A;  2EOF A;  3BGH A;  5IWA E;  2LT7 A;  2B9D A;  4BMJ A;  2EWL A;  1KJK A;  2ELY A;  2EOJ A;  2EOY A;  2E72 A;  2EN8 A;  4K0K E;  4RHB B;  2FGG A;  1BBO A;  3HPZ A;  2ADR A;  2JR1 A;  3FIG A;  5A2Q C;  1A1G A;  1HNZ E;  1EH6 A;  3VYY A;  3DJW A;  2EPA A;  2EPC A;  4X9J A;  2I9I A;  1X49 A;  3ECR A;  1X6F A;  3KWR A;  5AC4 A;  3BBG A;  2L2K B;  1RMD A;  2EM6 A;  2EMW A;  4HEI A;  4OOG C;  2V87 A;  2ENC A;  4JV5 E;  2KHX A;  4X8W A;  3MHS C;  4NXN E;  2YU5 A;  2F4V E;  3ADI A;  2J7J A;  4NZV A;  4BC9 A;  4B3T E;  2YPN A;  3AUZ A;  1J5E E;  1STU A;  4WX9 A;  2YTP A;  1WHN A;  4ZYD A;  2N8X A;  3IWC A;  3C6M A;  3OML A;  1XMO E;  5DNY A;  2WBU A;  1IQS A;  1IBM E;  2DMY A;  2YRM A;  1Z1B A;  2JVA A;  4X64 E;  2VE7 C;  4O24 A;  5IXM B;  1ZBQ A;  2EM8 A;  2DLQ A;  2VQE E;  2EMC A;  1WJP A;  5LMU E;  2EQ1 A;  4JI1 E;  2EMG A;  2N3H A;  1N33 E;  1HNX E;  1IMU A;  1X6H A;  1AAY A;  1N36 E;  2CTD A;  4LF7 E;  2WCC 3;  2EOQ A;  4R2E A;  1IQO A;  3BID A;  4RH8 A;  2IHR 1;  4LF4 E;  2DMI A;  4ZYG A;  5T6J A;  3EPL A;  1SR9 A;  4LFB E;  1X47 A;  2R1F A;  2YTI A;  4YY3 E;  2YWQ A;  4WFT A;  4R03 A;  2JYA A;  2UXD E;  1EKZ A;  2YTF A;  4GKK E;  1BBG A;  4B3R E;  1DQ3 A;  2MDG A;  2UUC E;  3P1X A;  3HXL A;  4ZYH A;  4LFC E;  1YYK A;  2UUA E;  2EN4 A;  2NUG A;  4MLV A;  2FV4 B;  2N3G A;  2EPN A;  1X3C A;  3LML A;  5AAS A;  3JAM C;  3EPH A;  2EN3 A;  2HGH A;  2RSI A;  5AC5 A;  2YTD A;  2LTR A;  2LTS A;  2GHF A;  2WZO A;  2LE2 A;  1YYW A;  2JP9 A;  2FTX B;  2L2M A;  1A1H A;  3J7A G;  1L4S A;  1ZU1 A;  4DR4 E;  1MEY C;  1IBK E;  1NCS A;  5LL6 R;  2YTJ A;  2PRT A;  3J7Y p;  2EMZ A;  2M9A A;  1B69 A;  4DV6 E;  5AE1 A;  2B7V A;  2YRH A;  2MKD A;  2KOU A;  1F2I G;  2EPP A;  3JTZ A;  4R2A A;  2M1S A;  2CPN A;  1T4N A;  4JI2 E;  2ODR D;  4OX9 E;  2EN7 A;  4X62 E;  2D9H A;  2RS7 A;  3ADJ A;  2UU9 E;  2M4I A;  4F9C B;  2EOE A;  4F9A B;  3ZOQ B;  4R2P A;  5A69 A;  4JI8 E;  1A1F A;  4WSP A;  5F3W A;  1X6E A;  2EPX A;  5LLQ A;  4F6M A;  4JI3 E;  1BB8 A;  1PDA A;  2EM5 A;  3EPK A;  3BF2 A;  1WXR A;  4YHH E;  2EM3 A;  2A25 A;  4WSG A;  4DR1 E;  2YTN A;  1N32 E;  4X65 E;  4AQY E;  4DMI A;  3T1Y E;  1X48 A;  2JOB A;  4BHC A;  2YTQ A;  2V89 A;  4JI0 E;  1KYQ A;  1P47 A;  2EPU A;  3MHH C;  1A1L A;  1AH5 A;  2EML A;  4DR2 E;  4DR3 E;  2CSH A;  2GLI A;  2EPR A;  4JI6 E;  2EN2 A;  2EPK X;  2GPI A;  4WYQ B;  2EPZ A;  3EPJ A;  2LRS A;  1NEI A;  3TQM A;  4LF8 E;  5BR8 E;  4WPY A;  2YTO A;  1UIL A;  2DB2 A;  1QU6 A;  2EMF A;  4LU9 A;  5KL7 A;  4DV5 E;  5KL4 A;  3C6K A;  2Q8U A;  4DV2 E;  3THN A;  2UXC E;  4LTY A;  4BBY A;  1DGC A;  5TSE A;  1UN6 B;  4TUI A;  2DSY A;  2NAB A;  3OTO E;  5A6B A;  2MC5 A;  5AE3 A;  4JI7 E;  2JY9 A;  2EE8 A;  3QG5 C;  1YSA C;  1YFH A;  1EH7 A;  2NUF A;  2JPA A;  5KL6 A;  2EM2 A;  2E1M A;  5A6K A;  5FLX C;  4NXM E;  1T38 A;  2EMH A;  3THO B;  5A6A A;  2ZM6 E;  1G2D C;  2EOR A;  2YZT A;  2ENA A;  2EP3 A;  4O4K A;  3C4B A;  3LLH A;  2EMX A;  1LLM C;  1J26 A;  3F6H A;  1ZR9 A;  5KL5 A;  2L3J A;  4M0V A;  4GZN C;  4BHB A;  4M30 A;  3K6Q A;  5KL2 A;  4DV1 E;  1T39 A;  2EL6 A;  1T4O A;  2MKN A;  2LCE A;  2LUQ A;  2EOX A;  1YUJ A;  4DUY E;  3T1H E;  4ZYE A;  2MDR A;  4L8N A;  1FKA E;  2EPL X;  4BS9 A;  2HJJ A;  1HR0 E;  2JWO A;  4GKJ E;  2E5L E;  2EQ3 A;  2V85 A;  2L92 A;  2K7I A;  2EOI A;  4L5N C;  1YUI A;  1A1I A;  2EM9 A;  4M9V C;  2EMK A;  2EJ4 A;  2VRD A;  1GTK A;  4DKK A;  2EN1 A;  4WXC A;  4FK5 C;  3C4T A;  4DV0 E;  1FJG E;  1YYO A;  2EOZ A;  4X66 E;  2LJH A;  2KON A;  3EQ1 A;  4BC7 A;  3F6G A;  3IWD A;  2B7T A;  4IJD A;  4KZS A;  3KZZ A;  4F54 A;  3HPS A;  1YPN A;  2BB8 A;  5KL3 A;  1ZAA C;  4MLQ A;  2H36 X;  2YTG A;  4P7D A;  4LF9 E;  2NA2 A;  4DUZ E;  4N4R B;  1MGT A;  2L6M A;  1QNT A;  2LV2 A;  5CFF E;  3VYX A;  2YSP A;  2EOM A;  4TUG A;  2V86 A;  4KHP E;  1PJT A;  1SFE A;  3ADG A;  2EM7 A;  4KWY A;  4JYA E;  4Q28 A;  1X5W A;  4LFA E;  1PKP A;  4R2C A;  4DR6 E;  2EMI A;  2DLK A;  2LO3 A;  2YSO A;  2V88 A;  4O5G A;  4BCA A;  1ZBT A;  2V8Q B;  2RPC A;  4R8O A;  4DV4 E;  4LF6 E;  2MC6 A;  4WXD A;  2ELZ A;  2I13 A;  2F8B A;  4F9B B;  4F2J C;  2UXB E;  2LVH A;  1WHQ A;  4IS1 C;  1DI2 A;  2NUE A;  4JI5 E;  2ENH A;  2LBS B;  5IV8 B;  1RC7 A;  2DGC A;  2EOO A;  2VQF E;  1A1J A;  2EM4 A;  1JK1 A;  3JU0 A;  2HHH E;  2EL5 A;  1XMQ E;  3AV0 A;  2EL4 A;  2K4V A;  3VK6 A;  4B3S E;  2VF1 A;  1PJQ A;  2EMA A;  4O43 A;  3MSW A;  4DV7 E;  2L8T A;  1GQE A;  4I8O A;  3RMP A;  2WBS A;  1N3G A;  2RS6 A;  2EPM X;  2B3T B;  5IT9 C;  1I94 E;  5AE2 A;  2DIX A;  2LMZ A;  4HTG A;  1RQ0 A;  2EOS A;  3IWB A;  4JI4 E;  2WBT A;  1UBD C;  1XNR E;  2JXP A;  1G2F C;  2YTE A;  2LUP B;  2EM0 A;  2EMY A;  2EPO A;  2EMB A;  3J80 C;  4R2R A;  4R2D A;  2G7H A;  5ADZ A;  3HTX A;  3DF6 A;  1TF6 A;  1UHZ A;  4LF5 E;  1PJS A; 
#chains in the Genus database with same CATH homology
 2WBU A;  2EOE A;  2YRK A;  2EOH A;  4R2P A;  2YU8 A;  4IJD A;  2YRM A;  4F6N A;  1A1F A;  1Z1B A;  2BB8 A;  5KL3 A;  1ZAA C;  1X6E A;  2EPX A;  2YTG A;  4F6M A;  1BB8 A;  2EM8 A;  2DLQ A;  2EM5 A;  2EMC A;  3EPK A;  1TN9 A;  1WJP A;  2EQ1 A;  2EMG A;  2EM3 A;  2A25 A;  1X6H A;  2LV2 A;  4WSG A;  2YTN A;  1AAY A;  2DRP A;  2YSP A;  2EOM A;  2CTD A;  1A1K A;  4R2S A;  2EN6 A;  2YTQ A;  2WCC 3;  2EOQ A;  4R2E A;  2EM7 A;  1P47 A;  2DMI A;  1X5W A;  2EPU A;  2EQ0 A;  3MHH C;  3EPL A;  1A1L A;  4R2C A;  3UK3 C;  2EMI A;  2EML A;  2GLI A;  2DLK A;  2CSH A;  2LO3 A;  2EPR A;  2EN2 A;  3VHT B;  2YSO A;  2EPZ A;  3EPJ A;  2R1F A;  2CT1 A;  2YTI A;  2RPC A;  2YTO A;  1TF3 A;  2EMF A;  5KL7 A;  3M99 B;  1JK2 A;  2ELZ A;  2I13 A;  2YTF A;  4R2Q A;  5KL4 A;  4F2J C;  2LVH A;  2EOF A;  4IS1 C;  2MDG A;  2LT7 A;  1DGC A;  2ENH A;  1KJK A;  1UN6 B;  2NAB A;  2ELY A;  2EOJ A;  2DGC A;  2EOY A;  2EOO A;  2E72 A;  1A1J A;  2EN8 A;  2EM4 A;  2EE8 A;  1JK1 A;  1YSA C;  2EN4 A;  2JPA A;  5KL6 A;  2EM2 A;  2EL5 A;  2EMH A;  2EL4 A;  1G2D C;  1X3C A;  2ADR A;  1A1G A;  1BBO A;  2EOR A;  2ENA A;  2EP3 A;  3EPH A;  2EMA A;  2EPA A;  2EN3 A;  2EPC A;  4X9J A;  2HGH A;  2RSI A;  2EMX A;  2YTD A;  1LLM C;  2GHF A;  1ZR9 A;  5KL5 A;  1X6F A;  2JP9 A;  1A1H A;  2WBS A;  1ZU1 A;  4GZN C;  5KL2 A;  1MEY C;  1RMD A;  2EL6 A;  2EM6 A;  2MKN A;  2LCE A;  2EOX A;  1NCS A;  2EMW A;  2YTJ A;  2PRT A;  1YUJ A;  2ENC A;  2EOS A;  2EMZ A;  2M9A A;  2WBT A;  1B69 A;  3MHS C;  1UBD C;  2YU5 A;  1G2F C;  2YRH A;  2EQ3 A;  2MKD A;  2YTE A;  1F2I G;  2EPP A;  2J7J A;  2EM0 A;  2EOI A;  2EMY A;  4R2A A;  2EMB A;  1YUI A;  1A1I A;  2EM9 A;  4M9V C;  4R2R A;  2EMK A;  2EJ4 A;  2VRD A;  4R2D A;  2EN7 A;  2YTP A;  2EN1 A;  4FK5 C;  2D9H A;  1TF6 A;  2EOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...