1A1JA

Radr (zif268 variant) zinc finger-dna complex (gcgt site)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
84
structure length
84
Chain Sequence
RPYACPVESCDRRFSRSADLTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*CP*GP*T)-3')
publication title High-resolution structures of variant Zif268-DNA complexes: implications for understanding zinc finger-DNA recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 25
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 1997-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1jA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1jA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1jA03
2EQ1A 1A1FA 3EPKA 2EOSA 2YRHA 4IS1C 1TF6A 2EL4A 1G2FC 2DLKA 2EMAA 1LLMC 2J7JA 4R2EA 2YTFA 5KL3A 4F2JC 2EN8A 2YTQA 2YTOA 2EPCA 4GZNC 2EOJA 4WSGA 2EQ0A 1BBOA 5KL4A 2LT7A 2EMBA 2EN4A 1B69A 2JP9A 5KL5A 1WJPA 2EPZA 2GLIA 1AAYA 2EPPA 2D9HA 1TN9A 1MEYC 2I13A 2EORA 2MDGA 1BB8A 1ZAAC 1KJKA 2ENAA 4X9JA 3MHHC 3UK3C 2EM0A 2WBTA 2EPXA 2EL5A 5KL2A 2EM6A 2YTGA 4F6MA 1A1HA 2EOEA 2YU8A 1X5WA 2RPCA 2CSHA 2EL6A 1A1LA 1ZU1A 2EMZA 2EE8A 2WCC3 2YTDA 2WBUA 2ENHA 1X6FA 2EOFA 2EPRA 2LVHA 1YUJA 2EN6A 3VHTB 3EPJA 2EOXA 2EM5A 5KL7A 2EMGA 3MHSC 2M9AA 4FK5C 2EM8A 1A1IA 1X6HA 2EMXA 4R2DA 1F2IG 2E72A 2DMIA 4R2CA 2EM4A 2YSOA 2PRTA 1NCSA 2CT1A 2EMLA 2YTPA 4R2PA 2VRDA 2CTDA 2MKNA 2A25A 2JPAA 2YTIA 2EJ4A 3M99B 2EMYA 2EQ3A 1RMDA 2EOMA 1P47A 1YSAC 2ADRA 1G2DC 1A1KA 2YRKA 2EP3A 2LO3A 4R2AA 1A1GA 1X6EA 2EM9A 2EM7A 2DRPA 2HGHA 2BB8A 4F6NA 2EOYA 2EM3A 2WBSA 2EMWA 2EMFA 2LV2A 3EPLA 1A1JA 2ELYA 2ELZA 2YRMA 2LCEA 2YU5A 1Z1BA 2EOOA 1X3CA 1ZR9A 2EN7A 2EOZA 2MKDA 2EOIA 2DGCA 2EN1A 2EN3A 2EOQA 2R1FA 2EPUA 1JK1A 1UBDC 4M9VC 4IJDA 2YTNA 2EOHA 5KL6A 1TF3A 2EMHA 4R2QA 1UN6B 2RSIA 2NABA 2EM2A 2YSPA 2EMCA 4R2SA 3EPHA 2DLQA 2EMIA 2EPAA 2EN2A 2GHFA 2YTEA 1JK2A 2YTJA 1DGCA 1YUIA 2ENCA 4R2RA 2EMKA
chains in the Genus database with same CATH superfamily
4P7DA 3EPKA 4JYAE 4IS1C 1PJTA 4RH8A 1G2FC 1TF6A 2EMAA 1YYKA 1LLMC 3KWRA 1YYOA 5F3WA 4NXME 2JVAA 2HC5A 2VQEE 2YTQA 4X65E 2EPCA 2V86A 2IHR1 4Q28A 1BBOA 2JOBA 4LF7E 2EN4A 2JP9A 2B7VA 1KYQA 5ADZA 1WJPA 2MC6A 1AAYA 2LRSA 4GKKE 3IWBA 2EORA 2MDGA 1BB8A 1KJKA 2ENAA 4KZSA 3L00A 4M0VA 2EOEA 2EZ6A 4J8ZA 2B3TB 5AE3A 2YT4A 1ZU1A 2WCC3 1SR9A 4K0KE 3BBGA 1QNTA 1WHQA 2EPRA 2LVHA 4ZYDA 1IQSA 4OX9E 3VHTB 3OMLA 4NHRA 5KL7A 4X66E 4FK5C 4LTYA 2EM8A 3JU0A 4R03A 4DV2E 4B3RE 3P1XA 2FGGA 1AH5A 4JI7E 4BHCA 2EM4A 2YSOA 3ADJA 4N4RB 5A6BA 2PRTA 4R2PA 2L92A 2CTDA 2VF1A 2EJ4A 5T6JA 3KZZA 2EMYA 2EQ3A 2ADRA 4L8NA 2YRKA 4HTGA 4R2AA 2LJHA 4JI8E 2EM7A 2FTXB 1T38A 1SFEA 2N3HA 5LL6R 2JY9A 3DF6A 4ZYEA 2EM3A 2EMWA 2EPOA 4O5GA 4DV7E 4HEIA 2GPIA 3FIGA 2F4VE 2LCEA 2YU5A 1ZR9A 2EOIA 4LF5E 3AUZA 2R1FA 4YY3E 4WXDA 4M9VC 5KL6A 3BF2A 1UN6B 2EMCA 2N8XA 2DLQA 2EN2A 2EPLX 3HQ1A 4BC9A 4GEQB 4DR7E 2EQ1A 2YRHA 2K7IA 5LLQA 1T39A 2EN8A 2YTOA 1EKZA 2BBGA 4BHBA 3KZYA 3LMLA 3ADLA 4LF9E 1B69A 2LT7A 2B9DA 5AE2A 4F9BB 2LTSA 1ZBTA 4B3SE 3VK6A 1ZAAC 2V85A 4X9JA 3EQ1A 3MHHC 1UHZA 3UK3C 4LF6E 2V83A 4DV1E 5TSEA 4OOGC 2YU8A 1GQEA 4LF4E 4LFBE 2H36X 5LMNE 2YTDA 2ENHA 1X6FA 4MLVA 2EOFA 4DR4E 3HPSA 4B3ME 4DR6E 4LF8E 3MHSC 3ZOQB 1A1IA 2L2KB 2E72A 1L4SA 1T4LB 1N33E 1NCSA 2CT1A 2EMLA 2UXBE 4M30A 2EPMX 3ECRA 4DR2E 2L8TA 5FLXC 2E5LE 2JOXA 2LO3A 4L5NC 1X48A 2RTXA 4JI1E 1IBKE 2V8QB 1DI2A 1PJSA 2V87A 5IV8B 4R8OA 4JI6E 1HNXE 5BR8E 1YPNA 1PDAA 1A1JA 2ELZA 4I8OA 1Z1BA 2EOOA 2EN1A 5IWAE 5AC4A 3K6QA 2UUCE 2EWLA 4R2QA 3VYXA 3JAMC 3IWDA 2NABA 2EM2A 3EPHA 2M4IA 2UXCE 2YTEA 1GTKA 1DGCA 1DQ3A 2JR1A 1X47A 3F6GA 4B3TE 1PKPA 2EOSA 3IWCA 2DLKA 3C6KA 4DUZE 4R2EA 5A6KA 4M2ZA 3THNA 2YTFA 4LFAE 5KL3A 4F2JC 2E1MA 2F8BA 3J7Yp 1IQOA 4GZNC 5A6AA 4ZYGA 5KL4A 2ZM6E 2EMBA 2NUFA 1WRJA 2ODRD 2GLIA 2EPPA 2EPKX 2D9HA 5CFFE 3HPZA 4O4KA 1MEYC 2R76A 2L6MA 2EM0A 1IMUA 2LE2A 2NA2A 3HTXA 2KONA 2EPXA 4Q35B 2EL5A 1O0WA 2EM6A 2YTGA 5IXMB 5KL2A 4F6MA 1A1HA 2NUGA 2RPCA 1N34E 1EH8A 1GZ6A 2CSHA 2EL6A 4X62E 1A1LA 3J80C 2DIXA 2N3GA 2EE8A 4MLQA 3THOB 2V88A 1XNQE 4DV0E 2YWQA 1YUJA 5LMUE 3LLHA 2EMGA 2M9AA 3JTZA 2HHHE 2KHXA 4DV6E 1T4OA 1X6HA 1HR0E 2Q8UA 2EMXA 1F2IG 2DMIA 4DKKA 1X49A 2YTPA 4BMJA 3VYYA 1PJQA 4F54A 3J81C 4JI4E 2JWOA 1YYWA 2EOMA 1YSAC 4KHPE 1A1KA 1X6EA 4WX9A 4BCAA 4DR5E 2UUAE 1FKAE 4AQYE 4F6NA 2L2MA 2L2NA 2WZOA 5A69A 4TUGA 5AE1A 2M7QA 3RMPA 4LFCE 2EMFA 4O43A 3EPLA 2ELYA 2I9IA 2VE7C 2YRMA 5IT9C 4BS9A 1X3CA 1N3GA 2EN7A 2EOZA 2MKDA 1J5EE 3DJWA 2V89A 2EOQA 1JK1A 2EPUA 1UBDC 4LU9A 2EOHA 2L33A 1XMOE 1HNZE 2YSPA 4DR1E 5AC5A 4R2SA 2UU9E 1I94E 1T4NA 2FV4B 4DUYE 2EPAA 2NUEA 2GHFA 1YUIA 2YTJA 3MSWA 2CPNA 2ENCA 4O24A 4WXCA 4RHBB 2EMKA 1A1FA 2LUQA 5AASA 1IBLE 2EL4A 3J7AG 1NEIA 2J7JA 4ZYHA 4F9CB 3C4TA 2RQLA 4GKJE 2JXPA 1WXRA 1FJGE 1N32E 4WFTA 5A6JA 1XMQE 2K4VA 2RSMA 2EOJA 2UUBE 4WSGA 2EQ0A 4DR3E 3AV0A 5KL5A 1YFHA 1EH6A 2EPZA 4YHHE 4X64E 4WSPA 5A6BD 1TN9A 2I13A 2L3CA 2WBTA 4BBYA 1IBME 2MC5A 1X5WA 2LBSB 3BIDA 3T1HE 2LMZA 1YZ9A 3F6HA 2EMZA 1XNRE 2WBUA 4BC7A 4JI2E 3T1YE 1ZBQA 2HJJA 2EN6A 2JYAA 4DV4E 1RC7A 3EPJA 1QU6A 2EOXA 2KOUA 2EM5A 4JI5E 4DV3E 2ODRC 4KWYA 4R2DA 4TUIA 2YZTA 4WPYA 3HXLA 1MGTA 4R2CA 3ADGA 4WYQB 4X8WA 4JV5E 5A2QC 1N36E 2VRDA 3QG5C 1HNWE 2MKNA 2A25A 3BGHA 2JPAA 2MDRA 2YTIA 3H09A 3M99B 1RMDA 1P47A 3ADIA 3C4BA 1STUA 1G2DC 2EP3A 2DRPA 2RS7A 1A1GA 2EM9A 2HGHA 1BBGA 2BB8A 4JI3E 3TQMA 2L3JA 2EOYA 2VQFE 2UXDE 2G7HA 2WBSA 2DMYA 2EPNA 3OTOE 2LV2A 1EH7A 4JI0E 1RQ0A 2DB2A 4NXNE 2YPNA 2LTRA 1J26A 2B7TA 2LUPB 4NZVA 2DGCA 1WHNA 4F9AB 2EN3A 2DSYA 4IJDA 2YTNA 1TF3A 2EMHA 2M1SA 5DNYA 2LJUA 2RSIA 4DV5E 2EMIA 1JK2A 4DMIA 1UILA 4P78A 2RS6A 3C6MA 4R2RA
chains in the Genus database with same CATH topology
2EQ1A 1A1FA 3EPKA 2EOSA 2YRHA 4IS1C 1TF6A 2EL4A 1G2FC 2DLKA 2EMAA 1LLMC 2J7JA 4R2EA 2YTFA 5KL3A 4F2JC 2EN8A 2YTQA 2YTOA 2EPCA 4GZNC 2EOJA 4WSGA 2EQ0A 1BBOA 5KL4A 2LT7A 2EMBA 2EN4A 1B69A 2JP9A 5KL5A 1WJPA 2EPZA 2GLIA 1AAYA 2EPPA 2D9HA 1TN9A 1MEYC 2I13A 2EORA 2MDGA 1BB8A 1ZAAC 1KJKA 2ENAA 4X9JA 3MHHC 3UK3C 2EM0A 2WBTA 2EPXA 2EL5A 5KL2A 2EM6A 2YTGA 4F6MA 1A1HA 2EOEA 2YU8A 1X5WA 2RPCA 2CSHA 2EL6A 1A1LA 1ZU1A 2EMZA 2EE8A 2WCC3 2YTDA 2WBUA 2ENHA 1X6FA 2EOFA 2EPRA 2LVHA 1YUJA 2EN6A 3VHTB 3EPJA 2EOXA 2EM5A 5KL7A 2EMGA 3MHSC 2M9AA 4FK5C 2EM8A 1A1IA 1X6HA 2EMXA 4R2DA 1F2IG 2E72A 2DMIA 4R2CA 2EM4A 2YSOA 2PRTA 1NCSA 2CT1A 2EMLA 2YTPA 4R2PA 2VRDA 2CTDA 2MKNA 2A25A 2JPAA 2YTIA 2EJ4A 3M99B 2EMYA 2EQ3A 1RMDA 2EOMA 1P47A 1YSAC 2ADRA 1G2DC 1A1KA 2YRKA 2EP3A 2LO3A 4R2AA 1A1GA 1X6EA 2EM9A 2EM7A 2DRPA 2HGHA 2BB8A 4F6NA 2EOYA 2EM3A 2WBSA 2EMWA 2EMFA 2LV2A 3EPLA 1A1JA 2ELYA 2ELZA 2YRMA 2LCEA 2YU5A 1Z1BA 2EOOA 1X3CA 1ZR9A 2EN7A 2EOZA 2MKDA 2EOIA 2DGCA 2EN1A 2EN3A 2EOQA 2R1FA 2EPUA 1JK1A 1UBDC 4M9VC 4IJDA 2YTNA 2EOHA 5KL6A 1TF3A 2EMHA 4R2QA 1UN6B 2RSIA 2NABA 2EM2A 2YSPA 2EMCA 4R2SA 3EPHA 2DLQA 2EMIA 2EPAA 2EN2A 2GHFA 2YTEA 1JK2A 2YTJA 1DGCA 1YUIA 2ENCA 4R2RA 2EMKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EQ1 A;  1A1F A;  3EPK A;  2EOS A;  2YRH A;  4IS1 C;  1TF6 A;  2EL4 A;  1G2F C;  2DLK A;  2EMA A;  1LLM C;  2J7J A;  4R2E A;  2YTF A;  5KL3 A;  4F2J C;  2EN8 A;  2YTQ A;  2YTO A;  2EPC A;  4GZN C;  2EOJ A;  4WSG A;  2EQ0 A;  1BBO A;  5KL4 A;  2LT7 A;  2EMB A;  2EN4 A;  1B69 A;  2JP9 A;  5KL5 A;  1WJP A;  2EPZ A;  2GLI A;  1AAY A;  2EPP A;  2D9H A;  1TN9 A;  1MEY C;  2I13 A;  2EOR A;  2MDG A;  1BB8 A;  1ZAA C;  1KJK A;  2ENA A;  4X9J A;  3MHH C;  3UK3 C;  2EM0 A;  2WBT A;  2EPX A;  2EL5 A;  5KL2 A;  2EM6 A;  2YTG A;  4F6M A;  1A1H A;  2EOE A;  2YU8 A;  1X5W A;  2RPC A;  2CSH A;  2EL6 A;  1A1L A;  1ZU1 A;  2EMZ A;  2EE8 A;  2WCC 3;  2YTD A;  2WBU A;  2ENH A;  1X6F A;  2EOF A;  2EPR A;  2LVH A;  1YUJ A;  2EN6 A;  3VHT B;  3EPJ A;  2EOX A;  2EM5 A;  5KL7 A;  2EMG A;  3MHS C;  2M9A A;  4FK5 C;  2EM8 A;  1A1I A;  1X6H A;  2EMX A;  4R2D A;  1F2I G;  2E72 A;  2DMI A;  4R2C A;  2EM4 A;  2YSO A;  2PRT A;  1NCS A;  2CT1 A;  2EML A;  2YTP A;  4R2P A;  2VRD A;  2CTD A;  2MKN A;  2A25 A;  2JPA A;  2YTI A;  2EJ4 A;  3M99 B;  2EMY A;  2EQ3 A;  1RMD A;  2EOM A;  1P47 A;  1YSA C;  2ADR A;  1G2D C;  1A1K A;  2YRK A;  2EP3 A;  2LO3 A;  4R2A A;  1A1G A;  1X6E A;  2EM9 A;  2EM7 A;  2DRP A;  2HGH A;  2BB8 A;  4F6N A;  2EOY A;  2EM3 A;  2WBS A;  2EMW A;  2EMF A;  2LV2 A;  3EPL A;  1A1J A;  2ELY A;  2ELZ A;  2YRM A;  2LCE A;  2YU5 A;  1Z1B A;  2EOO A;  1X3C A;  1ZR9 A;  2EN7 A;  2EOZ A;  2MKD A;  2EOI A;  2DGC A;  2EN1 A;  2EN3 A;  2EOQ A;  2R1F A;  2EPU A;  1JK1 A;  1UBD C;  4M9V C;  4IJD A;  2YTN A;  2EOH A;  5KL6 A;  1TF3 A;  2EMH A;  4R2Q A;  1UN6 B;  2RSI A;  2NAB A;  2EM2 A;  2YSP A;  2EMC A;  4R2S A;  3EPH A;  2DLQ A;  2EMI A;  2EPA A;  2EN2 A;  2GHF A;  2YTE A;  1JK2 A;  2YTJ A;  1DGC A;  1YUI A;  2ENC A;  4R2R A;  2EMK A; 
#chains in the Genus database with same CATH topology
 4P7D A;  3EPK A;  4JYA E;  4IS1 C;  1PJT A;  4RH8 A;  1G2F C;  1TF6 A;  2EMA A;  1YYK A;  1LLM C;  3KWR A;  1YYO A;  5F3W A;  4NXM E;  2JVA A;  2HC5 A;  2VQE E;  2YTQ A;  4X65 E;  2EPC A;  2V86 A;  2IHR 1;  4Q28 A;  1BBO A;  2JOB A;  4LF7 E;  2EN4 A;  2JP9 A;  2B7V A;  1KYQ A;  5ADZ A;  1WJP A;  2MC6 A;  1AAY A;  2LRS A;  4GKK E;  3IWB A;  2EOR A;  2MDG A;  1BB8 A;  1KJK A;  2ENA A;  4KZS A;  3L00 A;  4M0V A;  2EOE A;  2EZ6 A;  4J8Z A;  2B3T B;  5AE3 A;  2YT4 A;  1ZU1 A;  2WCC 3;  1SR9 A;  4K0K E;  3BBG A;  1QNT A;  1WHQ A;  2EPR A;  2LVH A;  4ZYD A;  1IQS A;  4OX9 E;  3VHT B;  3OML A;  4NHR A;  5KL7 A;  4X66 E;  4FK5 C;  4LTY A;  2EM8 A;  3JU0 A;  4R03 A;  4DV2 E;  4B3R E;  3P1X A;  2FGG A;  1AH5 A;  4JI7 E;  4BHC A;  2EM4 A;  2YSO A;  3ADJ A;  4N4R B;  5A6B A;  2PRT A;  4R2P A;  2L92 A;  2CTD A;  2VF1 A;  2EJ4 A;  5T6J A;  3KZZ A;  2EMY A;  2EQ3 A;  2ADR A;  4L8N A;  2YRK A;  4HTG A;  4R2A A;  2LJH A;  4JI8 E;  2EM7 A;  2FTX B;  1T38 A;  1SFE A;  2N3H A;  5LL6 R;  2JY9 A;  3DF6 A;  4ZYE A;  2EM3 A;  2EMW A;  2EPO A;  4O5G A;  4DV7 E;  4HEI A;  2GPI A;  3FIG A;  2F4V E;  2LCE A;  2YU5 A;  1ZR9 A;  2EOI A;  4LF5 E;  3AUZ A;  2R1F A;  4YY3 E;  4WXD A;  4M9V C;  5KL6 A;  3BF2 A;  1UN6 B;  2EMC A;  2N8X A;  2DLQ A;  2EN2 A;  2EPL X;  3HQ1 A;  4BC9 A;  4GEQ B;  4DR7 E;  2EQ1 A;  2YRH A;  2K7I A;  5LLQ A;  1T39 A;  2EN8 A;  2YTO A;  1EKZ A;  2BBG A;  4BHB A;  3KZY A;  3LML A;  3ADL A;  4LF9 E;  1B69 A;  2LT7 A;  2B9D A;  5AE2 A;  4F9B B;  2LTS A;  1ZBT A;  4B3S E;  3VK6 A;  1ZAA C;  2V85 A;  4X9J A;  3EQ1 A;  3MHH C;  1UHZ A;  3UK3 C;  4LF6 E;  2V83 A;  4DV1 E;  5TSE A;  4OOG C;  2YU8 A;  1GQE A;  4LF4 E;  4LFB E;  2H36 X;  5LMN E;  2YTD A;  2ENH A;  1X6F A;  4MLV A;  2EOF A;  4DR4 E;  3HPS A;  4B3M E;  4DR6 E;  4LF8 E;  3MHS C;  3ZOQ B;  1A1I A;  2L2K B;  2E72 A;  1L4S A;  1T4L B;  1N33 E;  1NCS A;  2CT1 A;  2EML A;  2UXB E;  4M30 A;  2EPM X;  3ECR A;  4DR2 E;  2L8T A;  5FLX C;  2E5L E;  2JOX A;  2LO3 A;  4L5N C;  1X48 A;  2RTX A;  4JI1 E;  1IBK E;  2V8Q B;  1DI2 A;  1PJS A;  2V87 A;  5IV8 B;  4R8O A;  4JI6 E;  1HNX E;  5BR8 E;  1YPN A;  1PDA A;  1A1J A;  2ELZ A;  4I8O A;  1Z1B A;  2EOO A;  2EN1 A;  5IWA E;  5AC4 A;  3K6Q A;  2UUC E;  2EWL A;  4R2Q A;  3VYX A;  3JAM C;  3IWD A;  2NAB A;  2EM2 A;  3EPH A;  2M4I A;  2UXC E;  2YTE A;  1GTK A;  1DGC A;  1DQ3 A;  2JR1 A;  1X47 A;  3F6G A;  4B3T E;  1PKP A;  2EOS A;  3IWC A;  2DLK A;  3C6K A;  4DUZ E;  4R2E A;  5A6K A;  4M2Z A;  3THN A;  2YTF A;  4LFA E;  5KL3 A;  4F2J C;  2E1M A;  2F8B A;  3J7Y p;  1IQO A;  4GZN C;  5A6A A;  4ZYG A;  5KL4 A;  2ZM6 E;  2EMB A;  2NUF A;  1WRJ A;  2ODR D;  2GLI A;  2EPP A;  2EPK X;  2D9H A;  5CFF E;  3HPZ A;  4O4K A;  1MEY C;  2R76 A;  2L6M A;  2EM0 A;  1IMU A;  2LE2 A;  2NA2 A;  3HTX A;  2KON A;  2EPX A;  4Q35 B;  2EL5 A;  1O0W A;  2EM6 A;  2YTG A;  5IXM B;  5KL2 A;  4F6M A;  1A1H A;  2NUG A;  2RPC A;  1N34 E;  1EH8 A;  1GZ6 A;  2CSH A;  2EL6 A;  4X62 E;  1A1L A;  3J80 C;  2DIX A;  2N3G A;  2EE8 A;  4MLQ A;  3THO B;  2V88 A;  1XNQ E;  4DV0 E;  2YWQ A;  1YUJ A;  5LMU E;  3LLH A;  2EMG A;  2M9A A;  3JTZ A;  2HHH E;  2KHX A;  4DV6 E;  1T4O A;  1X6H A;  1HR0 E;  2Q8U A;  2EMX A;  1F2I G;  2DMI A;  4DKK A;  1X49 A;  2YTP A;  4BMJ A;  3VYY A;  1PJQ A;  4F54 A;  3J81 C;  4JI4 E;  2JWO A;  1YYW A;  2EOM A;  1YSA C;  4KHP E;  1A1K A;  1X6E A;  4WX9 A;  4BCA A;  4DR5 E;  2UUA E;  1FKA E;  4AQY E;  4F6N A;  2L2M A;  2L2N A;  2WZO A;  5A69 A;  4TUG A;  5AE1 A;  2M7Q A;  3RMP A;  4LFC E;  2EMF A;  4O43 A;  3EPL A;  2ELY A;  2I9I A;  2VE7 C;  2YRM A;  5IT9 C;  4BS9 A;  1X3C A;  1N3G A;  2EN7 A;  2EOZ A;  2MKD A;  1J5E E;  3DJW A;  2V89 A;  2EOQ A;  1JK1 A;  2EPU A;  1UBD C;  4LU9 A;  2EOH A;  2L33 A;  1XMO E;  1HNZ E;  2YSP A;  4DR1 E;  5AC5 A;  4R2S A;  2UU9 E;  1I94 E;  1T4N A;  2FV4 B;  4DUY E;  2EPA A;  2NUE A;  2GHF A;  1YUI A;  2YTJ A;  3MSW A;  2CPN A;  2ENC A;  4O24 A;  4WXC A;  4RHB B;  2EMK A;  1A1F A;  2LUQ A;  5AAS A;  1IBL E;  2EL4 A;  3J7A G;  1NEI A;  2J7J A;  4ZYH A;  4F9C B;  3C4T A;  2RQL A;  4GKJ E;  2JXP A;  1WXR A;  1FJG E;  1N32 E;  4WFT A;  5A6J A;  1XMQ E;  2K4V A;  2RSM A;  2EOJ A;  2UUB E;  4WSG A;  2EQ0 A;  4DR3 E;  3AV0 A;  5KL5 A;  1YFH A;  1EH6 A;  2EPZ A;  4YHH E;  4X64 E;  4WSP A;  5A6B D;  1TN9 A;  2I13 A;  2L3C A;  2WBT A;  4BBY A;  1IBM E;  2MC5 A;  1X5W A;  2LBS B;  3BID A;  3T1H E;  2LMZ A;  1YZ9 A;  3F6H A;  2EMZ A;  1XNR E;  2WBU A;  4BC7 A;  4JI2 E;  3T1Y E;  1ZBQ A;  2HJJ A;  2EN6 A;  2JYA A;  4DV4 E;  1RC7 A;  3EPJ A;  1QU6 A;  2EOX A;  2KOU A;  2EM5 A;  4JI5 E;  4DV3 E;  2ODR C;  4KWY A;  4R2D A;  4TUI A;  2YZT A;  4WPY A;  3HXL A;  1MGT A;  4R2C A;  3ADG A;  4WYQ B;  4X8W A;  4JV5 E;  5A2Q C;  1N36 E;  2VRD A;  3QG5 C;  1HNW E;  2MKN A;  2A25 A;  3BGH A;  2JPA A;  2MDR A;  2YTI A;  3H09 A;  3M99 B;  1RMD A;  1P47 A;  3ADI A;  3C4B A;  1STU A;  1G2D C;  2EP3 A;  2DRP A;  2RS7 A;  1A1G A;  2EM9 A;  2HGH A;  1BBG A;  2BB8 A;  4JI3 E;  3TQM A;  2L3J A;  2EOY A;  2VQF E;  2UXD E;  2G7H A;  2WBS A;  2DMY A;  2EPN A;  3OTO E;  2LV2 A;  1EH7 A;  4JI0 E;  1RQ0 A;  2DB2 A;  4NXN E;  2YPN A;  2LTR A;  1J26 A;  2B7T A;  2LUP B;  4NZV A;  2DGC A;  1WHN A;  4F9A B;  2EN3 A;  2DSY A;  4IJD A;  2YTN A;  1TF3 A;  2EMH A;  2M1S A;  5DNY A;  2LJU A;  2RSI A;  4DV5 E;  2EMI A;  1JK2 A;  4DMI A;  1UIL A;  4P78 A;  2RS6 A;  3C6M A;  4R2R A; 
#chains in the Genus database with same CATH homology
 2EQ1 A;  1A1F A;  3EPK A;  2EOS A;  2YRH A;  4IS1 C;  1TF6 A;  2EL4 A;  1G2F C;  2DLK A;  2EMA A;  1LLM C;  2J7J A;  4R2E A;  2YTF A;  5KL3 A;  4F2J C;  2EN8 A;  2YTQ A;  2YTO A;  2EPC A;  4GZN C;  2EOJ A;  4WSG A;  2EQ0 A;  1BBO A;  5KL4 A;  2LT7 A;  2EMB A;  2EN4 A;  1B69 A;  2JP9 A;  5KL5 A;  1WJP A;  2EPZ A;  2GLI A;  1AAY A;  2EPP A;  2D9H A;  1TN9 A;  1MEY C;  2I13 A;  2EOR A;  2MDG A;  1BB8 A;  1ZAA C;  1KJK A;  2ENA A;  4X9J A;  3MHH C;  3UK3 C;  2EM0 A;  2WBT A;  2EPX A;  2EL5 A;  5KL2 A;  2EM6 A;  2YTG A;  4F6M A;  1A1H A;  2EOE A;  2YU8 A;  1X5W A;  2RPC A;  2CSH A;  2EL6 A;  1A1L A;  1ZU1 A;  2EMZ A;  2EE8 A;  2WCC 3;  2YTD A;  2WBU A;  2ENH A;  1X6F A;  2EOF A;  2EPR A;  2LVH A;  1YUJ A;  2EN6 A;  3VHT B;  3EPJ A;  2EOX A;  2EM5 A;  5KL7 A;  2EMG A;  3MHS C;  2M9A A;  4FK5 C;  2EM8 A;  1A1I A;  1X6H A;  2EMX A;  4R2D A;  1F2I G;  2E72 A;  2DMI A;  4R2C A;  2EM4 A;  2YSO A;  2PRT A;  1NCS A;  2CT1 A;  2EML A;  2YTP A;  4R2P A;  2VRD A;  2CTD A;  2MKN A;  2A25 A;  2JPA A;  2YTI A;  2EJ4 A;  3M99 B;  2EMY A;  2EQ3 A;  1RMD A;  2EOM A;  1P47 A;  1YSA C;  2ADR A;  1G2D C;  1A1K A;  2YRK A;  2EP3 A;  2LO3 A;  4R2A A;  1A1G A;  1X6E A;  2EM9 A;  2EM7 A;  2DRP A;  2HGH A;  2BB8 A;  4F6N A;  2EOY A;  2EM3 A;  2WBS A;  2EMW A;  2EMF A;  2LV2 A;  3EPL A;  1A1J A;  2ELY A;  2ELZ A;  2YRM A;  2LCE A;  2YU5 A;  1Z1B A;  2EOO A;  1X3C A;  1ZR9 A;  2EN7 A;  2EOZ A;  2MKD A;  2EOI A;  2DGC A;  2EN1 A;  2EN3 A;  2EOQ A;  2R1F A;  2EPU A;  1JK1 A;  1UBD C;  4M9V C;  4IJD A;  2YTN A;  2EOH A;  5KL6 A;  1TF3 A;  2EMH A;  4R2Q A;  1UN6 B;  2RSI A;  2NAB A;  2EM2 A;  2YSP A;  2EMC A;  4R2S A;  3EPH A;  2DLQ A;  2EMI A;  2EPA A;  2EN2 A;  2GHF A;  2YTE A;  1JK2 A;  2YTJ A;  1DGC A;  1YUI A;  2ENC A;  4R2R A;  2EMK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...