1A1JA

Radr (zif268 variant) zinc finger-dna complex (gcgt site)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
84
structure length
84
Chain Sequence
RPYACPVESCDRRFSRSADLTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title High-resolution structures of variant Zif268-DNA complexes: implications for understanding zinc finger-DNA recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*CP*GP*T)-3')
total genus 25
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 1997-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1jA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1jA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1jA03
2EP3A 2RSIA 2ENAA 4R2SA 2EPCA 1X6FA 3UK3C 4R2EA 4F6MA 2EPPA 2DGCA 2EN8A 2EOZA 2YSPA 2YRMA 1A1HA 2EM6A 3M99B 5KL6A 4IS1C 1TF6A 2LO3A 1A1KA 2WCC3 2LT7A 4GZNC 2EMHA 2YU5A 2MDGA 2YRHA 2YTEA 1AAYA 3EPKA 1ZAAC 1WJPA 4R2PA 2I13A 2EMCA 4X9JA 1F2IG 2EMXA 2EMYA 1A1LA 2A25A 3EPJA 3EPHA 2EMFA 2EOOA 2EM9A 2EM2A 2EQ1A 2EOYA 2YRKA 2EOMA 2R1FA 3EPLA 2EOSA 2YTPA 2EMIA 2EM3A 2GHFA 2EPAA 5KL2A 1NCSA 1ZU1A 2EMLA 2EM5A 2M9AA 4F6NA 2DRPA 2EOQA 1X6EA 1YSAC 5KL3A 2HGHA 2EPUA 2ADRA 2YTDA 2CT1A 1X6HA 1X3CA 1P47A 2MKNA 2LCEA 4FK5C 4IJDA 2WBSA 2GLIA 2EN1A 2RPCA 2EOXA 2LVHA 4R2QA 2EQ0A 1JK1A 2YTFA 2EMGA 2CTDA 2EN3A 2EPXA 2EMZA 2ENCA 2EMBA 4WSGA 2EOEA 1YUJA 2YTJA 2EN6A 2EL6A 2EOJA 4F2JC 2D9HA 2JP9A 2NABA 2ELYA 1JK2A 2EN7A 2EM0A 1A1IA 2J7JA 1MEYC 1ZR9A 2EMAA 2EMWA 2CSHA 1YUIA 1A1JA 1A1GA 2YTNA 4R2RA 2DMIA 4M9VC 5KL7A 2EPRA 3MHSC 2EN2A 2EOIA 4R2AA 1Z1BA 2EM8A 2YTIA 4R2CA 2EOHA 1LLMC 1BB8A 2DLQA 1X5WA 2EORA 2WBUA 1B69A 2E72A 2LV2A 2WBTA 5KL4A 2YTGA 1UN6B 2YSOA 2DLKA 2YTQA 4R2DA 2PRTA 2BB8A 2VRDA 1TN9A 2MKDA 1KJKA 1A1FA 2EL5A 2EMKA 2EN4A 1G2DC 2EE8A 2EL4A 2EM7A 5KL5A 1RMDA 2ENHA 2YTOA 2EJ4A 2YU8A 3VHTB 1TF3A 3MHHC 1G2FC 1DGCA 2ELZA 1BBOA 1UBDC 2EQ3A 2EOFA 2EM4A 2JPAA 2EPZA
chains in the Genus database with same CATH superfamily
4WX9A 5FLXC 2EPCA 3P1XA 1SFEA 4R2EA 5AASA 2EN8A 4M2ZA 3L00A 4DR2E 3BBGA 2YZTA 2EM6A 3M99B 3IWBA 2WCC3 1NEIA 4P7DA 2L2MA 2YRHA 2YTEA 1AAYA 4JV5E 2EMCA 4KZSA 4BHCA 2NUGA 1PJTA 5IWAE 4BCAA 4DKKA 5ADZA 1X48A 2Q8UA 2YRKA 2EQ1A 2R1FA 4DR3E 3EPLA 2EOSA 2EM3A 5LL6R 1NCSA 1ZU1A 1YYWA 2RS6A 1N36E 1QU6A 5A69A 2EOQA 4X66E 3ADGA 4YY3E 5KL3A 2ADRA 2I9IA 2B7TA 2YTDA 5LMUE 1P47A 4N4RB 1N3GA 3F6GA 1X47A 4BBYA 4DV2E 2YPNA 4IJDA 3OTOE 2GLIA 2EN1A 1KYQA 4R2QA 4JI2E 2EMBA 1DI2A 4NXME 2EWLA 1PDAA 1YUJA 4WXDA 4LFCE 1YZ9A 1MGTA 4F2JC 4ZYHA 4O5GA 2EPKX 2KOUA 3RMPA 4B3SE 5IV8B 2N8XA 3AUZA 4O43A 2EZ6A 5IXMB 2EN7A 4BC9A 1A1IA 3ADJA 4DR6E 4NZVA 1A1JA 4X8WA 2YTNA 2CPNA 2DMIA 2EPMX 2HC5A 2L3JA 1YYKA 2LTRA 2V88A 2JWOA 4DV5E 4KWYA 2L2NA 1T4OA 2EOHA 1EH6A 3QG5C 5AE1A 1X5WA 1B69A 2GPIA 2YTGA 3H09A 2MKDA 5AC4A 1PJSA 1KJKA 4DR7E 2ZM6E 1YPNA 2EL5A 3OMLA 2EMKA 4J8ZA 2EN4A 4LF8E 4DV1E 4K0KE 2EL4A 2EM7A 4LF6E 1RMDA 1RC7A 5BR8E 2EJ4A 1TF3A 3DJWA 2ODRD 4WFTA 4OX9E 2MC6A 1HNZE 1UILA 2NA2A 2ELZA 1FKAE 3VYXA 5TSEA 2EQ3A 2EOFA 2ENAA 2UUAE 4F9BB 4DR5E 1EH8A 4BS9A 3UK3C 4F6MA 4TUGA 1EKZA 2YSPA 5KL6A 2E5LE 1A1KA 1X49A 2R76A 2LT7A 2EMHA 3EPKA 3HTXA 2EPNA 2K4VA 4X9JA 1F2IG 4LU9A 4KHPE 3KZZA 2EMYA 4X64E 2EM9A 1WRJA 1HNXE 1N32E 1XMOE 5A6BD 4DUZE 2EMIA 2GHFA 2EPAA 2V87A 5KL2A 2EM5A 4DV4E 2DRPA 2V86A 1STUA 1X6EA 3C6MA 2EPUA 2VE7C 2CT1A 1DQ3A 2FTXB 2MKNA 4P78A 4Q28A 3T1HE 2RPCA 1IQOA 4AQYE 5AC5A 2B9DA 2EMGA 3AV0A 2EN3A 1YFHA 2EPXA 2UXCE 2F4VE 2L2KB 1HNWE 4JI7E 2YTJA 2K7IA 4DV0E 2JP9A 1SR9A 3LLHA 1IBLE 2RTXA 1GQEA 1ZBTA 3C4BA 2EMWA 2CSHA 2JR1A 5LMNE 1N34E 1YUIA 2UU9E 5KL7A 2EN2A 4R2AA 4MLQA 4BMJA 2V8QB 2EM8A 2M7QA 2VF1A 2IHR1 1LLMC 2DB2A 2EORA 4R8OA 3THNA 1PKPA 2LV2A 2WBTA 4NHRA 2YSOA 1T38A 2YTQA 2VRDA 1GTKA 4DMIA 3T1YE 2G7HA 2L92A 1A1FA 3JU0A 2V89A 4RH8A 5T6JA 5KL5A 2YTOA 2YU8A 3MHHC 2F8BA 4ZYDA 3JAMC 2JPAA 3FIGA 2EP3A 3C4TA 2L8TA 4R2SA 4JI0E 2JOXA 4BC7A 2HHHE 2VQEE 2EPPA 1WXRA 2VQFE 2EOZA 4JI8E 1GZ6A 2NUFA 3BGHA 2DSYA 4IS1C 1EH7A 4LF4E 1HR0E 3TQMA 2LE2A 1IBKE 2DMYA 2YU5A 4HEIA 2H36X 4JI4E 1BBGA 2MDGA 1XNRE 1J26A 2FGGA 3HQ1A 1WJPA 3VYYA 1ZAAC 2EMXA 1A1LA 1J5EE 2A25A 3EPJA 1I94E 2EMFA 2EOOA 1O0WA 4WXCA 2EM2A 2EOYA 4GEQB 1ZBQA 3JTZA 2LTSA 1UHZA 2MDRA 1IMUA 1YSAC 3IWCA 2HGHA 4HTGA 4B3ME 3ADIA 1X3CA 1X6HA 2EPOA 2LBSB 3VK6A 4GKJE 4I8OA 4LF9E 4F9CB 2EOXA 2V85A 2LVHA 4X65E 1JK1A 2YTFA 2CTDA 4DV6E 4BHBA 3J7Yp 2EOEA 2EN6A 3F6HA 2EL6A 2EOJA 3EQ1A 2NABA 1T4LB 1T4NA 4Q35B 1JK2A 1FJGE 4ZYEA 1IBME 2EM0A 5A2QC 2RS7A 4DR4E 2LUPB 1AH5A 4YHHE 2EPRA 2EOIA 5LLQA 5IT9C 1Z1BA 3HPSA 2YTIA 5A6JA 4R2CA 1BB8A 2DLQA 2JOBA 2WBUA 5F3WA 2E72A 5KL4A 3HXLA 1UN6B 2DLKA 1QNTA 4DUYE 1TN9A 1XMQE 2LJUA 2M1SA 2M4IA 1G2DC 2B7VA 2HJJA 2EE8A 2N3GA 2LRSA 1WHQA 2ENHA 3BIDA 1PJQA 1G2FC 4OOGC 2LJHA 4GKKE 1DGCA 4DV7E 2V83A 2EM4A 5A6KA 4M0VA 2EPZA 2RSIA 4O4KA 1X6FA 4LF5E 4WPYA 2B3TB 2JYAA 4DV3E 2DGCA 1A1HA 2YRMA 5CFFE 4F54A 2YWQA 2RQLA 3IWDA 1TF6A 2LO3A 2UUCE 4LFAE 4GZNC 3J7AG 3ZOQB 2EPLX 4R2PA 2I13A 4ZYGA 3LMLA 2E1MA 3BF2A 3ADLA 3EPHA 2EOMA 2YTPA 1IQSA 4F9AB 2EMLA 2M9AA 1RQ0A 1T39A 4F6NA 3C6KA 5A6AA 3K6QA 2L33A 3KWRA 1YYOA 2LUQA 4L8NA 2NUEA 4B3RE 2DIXA 2LCEA 4FK5C 4NXNE 4LTYA 2WBSA 2FV4B 2EQ0A 2EMZA 2ENCA 4JYAE 2N3HA 2JXPA 3THOB 4WSGA 2MC5A 1XNQE 2D9HA 1L4SA 1N33E 5DNYA 4RHBB 3J81C 3KZYA 2ELYA 5AE3A 2ODRC 1MEYC 2J7JA 2RSMA 4JI5E 1ZR9A 2EMAA 4X62E 4TUIA 1A1GA 3ECRA 4R2RA 1WHNA 4M9VC 3MHSC 4JI1E 4LF7E 4R03A 3MSWA 4MLVA 2L6MA 4WYQB 2KHXA 2BBGA 2WZOA 4B3TE 4M30A 3HPZA 5AE2A 4JI3E 4DR1E 2JVAA 4R2DA 2PRTA 2BB8A 2JY9A 2UUBE 4WSPA 4LFBE 3DF6A 2YT4A 2KONA 2LMZA 3J80C 4L5NC 2L3CA 3VHTB 2UXDE 2UXBE 4JI6E 5A6BA 1BBOA 1UBDC 4O24A
chains in the Genus database with same CATH topology
2EP3A 2RSIA 2ENAA 4R2SA 2EPCA 1X6FA 3UK3C 4R2EA 4F6MA 2EPPA 2DGCA 2EN8A 2EOZA 2YSPA 2YRMA 1A1HA 2EM6A 3M99B 5KL6A 4IS1C 1TF6A 2LO3A 1A1KA 2WCC3 2LT7A 4GZNC 2EMHA 2YU5A 2MDGA 2YRHA 2YTEA 1AAYA 3EPKA 1ZAAC 1WJPA 4R2PA 2I13A 2EMCA 4X9JA 1F2IG 2EMXA 2EMYA 1A1LA 2A25A 3EPJA 3EPHA 2EMFA 2EOOA 2EM9A 2EM2A 2EQ1A 2EOYA 2YRKA 2EOMA 2R1FA 3EPLA 2EOSA 2YTPA 2EMIA 2EM3A 2GHFA 2EPAA 5KL2A 1NCSA 1ZU1A 2EMLA 2EM5A 2M9AA 4F6NA 2DRPA 2EOQA 1X6EA 1YSAC 5KL3A 2HGHA 2EPUA 2ADRA 2YTDA 2CT1A 1X6HA 1X3CA 1P47A 2MKNA 2LCEA 4FK5C 4IJDA 2WBSA 2GLIA 2EN1A 2RPCA 2EOXA 2LVHA 4R2QA 2EQ0A 1JK1A 2YTFA 2EMGA 2CTDA 2EN3A 2EPXA 2EMZA 2ENCA 2EMBA 4WSGA 2EOEA 1YUJA 2YTJA 2EN6A 2EL6A 2EOJA 4F2JC 2D9HA 2JP9A 2NABA 2ELYA 1JK2A 2EN7A 2EM0A 1A1IA 2J7JA 1MEYC 1ZR9A 2EMAA 2EMWA 2CSHA 1YUIA 1A1JA 1A1GA 2YTNA 4R2RA 2DMIA 4M9VC 5KL7A 2EPRA 3MHSC 2EN2A 2EOIA 4R2AA 1Z1BA 2EM8A 2YTIA 4R2CA 2EOHA 1LLMC 1BB8A 2DLQA 1X5WA 2EORA 2WBUA 1B69A 2E72A 2LV2A 2WBTA 5KL4A 2YTGA 1UN6B 2YSOA 2DLKA 2YTQA 4R2DA 2PRTA 2BB8A 2VRDA 1TN9A 2MKDA 1KJKA 1A1FA 2EL5A 2EMKA 2EN4A 1G2DC 2EE8A 2EL4A 2EM7A 5KL5A 1RMDA 2ENHA 2YTOA 2EJ4A 2YU8A 3VHTB 1TF3A 3MHHC 1G2FC 1DGCA 2ELZA 1BBOA 1UBDC 2EQ3A 2EOFA 2EM4A 2JPAA 2EPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EP3 A;  2RSI A;  2ENA A;  4R2S A;  2EPC A;  1X6F A;  3UK3 C;  4R2E A;  4F6M A;  2EPP A;  2DGC A;  2EN8 A;  2EOZ A;  2YSP A;  2YRM A;  1A1H A;  2EM6 A;  3M99 B;  5KL6 A;  4IS1 C;  1TF6 A;  2LO3 A;  1A1K A;  2WCC 3;  2LT7 A;  4GZN C;  2EMH A;  2YU5 A;  2MDG A;  2YRH A;  2YTE A;  1AAY A;  3EPK A;  1ZAA C;  1WJP A;  4R2P A;  2I13 A;  2EMC A;  4X9J A;  1F2I G;  2EMX A;  2EMY A;  1A1L A;  2A25 A;  3EPJ A;  3EPH A;  2EMF A;  2EOO A;  2EM9 A;  2EM2 A;  2EQ1 A;  2EOY A;  2YRK A;  2EOM A;  2R1F A;  3EPL A;  2EOS A;  2YTP A;  2EMI A;  2EM3 A;  2GHF A;  2EPA A;  5KL2 A;  1NCS A;  1ZU1 A;  2EML A;  2EM5 A;  2M9A A;  4F6N A;  2DRP A;  2EOQ A;  1X6E A;  1YSA C;  5KL3 A;  2HGH A;  2EPU A;  2ADR A;  2YTD A;  2CT1 A;  1X6H A;  1X3C A;  1P47 A;  2MKN A;  2LCE A;  4FK5 C;  4IJD A;  2WBS A;  2GLI A;  2EN1 A;  2RPC A;  2EOX A;  2LVH A;  4R2Q A;  2EQ0 A;  1JK1 A;  2YTF A;  2EMG A;  2CTD A;  2EN3 A;  2EPX A;  2EMZ A;  2ENC A;  2EMB A;  4WSG A;  2EOE A;  1YUJ A;  2YTJ A;  2EN6 A;  2EL6 A;  2EOJ A;  4F2J C;  2D9H A;  2JP9 A;  2NAB A;  2ELY A;  1JK2 A;  2EN7 A;  2EM0 A;  1A1I A;  2J7J A;  1MEY C;  1ZR9 A;  2EMA A;  2EMW A;  2CSH A;  1YUI A;  1A1J A;  1A1G A;  2YTN A;  4R2R A;  2DMI A;  4M9V C;  5KL7 A;  2EPR A;  3MHS C;  2EN2 A;  2EOI A;  4R2A A;  1Z1B A;  2EM8 A;  2YTI A;  4R2C A;  2EOH A;  1LLM C;  1BB8 A;  2DLQ A;  1X5W A;  2EOR A;  2WBU A;  1B69 A;  2E72 A;  2LV2 A;  2WBT A;  5KL4 A;  2YTG A;  1UN6 B;  2YSO A;  2DLK A;  2YTQ A;  4R2D A;  2PRT A;  2BB8 A;  2VRD A;  1TN9 A;  2MKD A;  1KJK A;  1A1F A;  2EL5 A;  2EMK A;  2EN4 A;  1G2D C;  2EE8 A;  2EL4 A;  2EM7 A;  5KL5 A;  1RMD A;  2ENH A;  2YTO A;  2EJ4 A;  2YU8 A;  3VHT B;  1TF3 A;  3MHH C;  1G2F C;  1DGC A;  2ELZ A;  1BBO A;  1UBD C;  2EQ3 A;  2EOF A;  2EM4 A;  2JPA A;  2EPZ A; 
#chains in the Genus database with same CATH topology
 4WX9 A;  5FLX C;  2EPC A;  3P1X A;  1SFE A;  4R2E A;  5AAS A;  2EN8 A;  4M2Z A;  3L00 A;  4DR2 E;  3BBG A;  2YZT A;  2EM6 A;  3M99 B;  3IWB A;  2WCC 3;  1NEI A;  4P7D A;  2L2M A;  2YRH A;  2YTE A;  1AAY A;  4JV5 E;  2EMC A;  4KZS A;  4BHC A;  2NUG A;  1PJT A;  5IWA E;  4BCA A;  4DKK A;  5ADZ A;  1X48 A;  2Q8U A;  2YRK A;  2EQ1 A;  2R1F A;  4DR3 E;  3EPL A;  2EOS A;  2EM3 A;  5LL6 R;  1NCS A;  1ZU1 A;  1YYW A;  2RS6 A;  1N36 E;  1QU6 A;  5A69 A;  2EOQ A;  4X66 E;  3ADG A;  4YY3 E;  5KL3 A;  2ADR A;  2I9I A;  2B7T A;  2YTD A;  5LMU E;  1P47 A;  4N4R B;  1N3G A;  3F6G A;  1X47 A;  4BBY A;  4DV2 E;  2YPN A;  4IJD A;  3OTO E;  2GLI A;  2EN1 A;  1KYQ A;  4R2Q A;  4JI2 E;  2EMB A;  1DI2 A;  4NXM E;  2EWL A;  1PDA A;  1YUJ A;  4WXD A;  4LFC E;  1YZ9 A;  1MGT A;  4F2J C;  4ZYH A;  4O5G A;  2EPK X;  2KOU A;  3RMP A;  4B3S E;  5IV8 B;  2N8X A;  3AUZ A;  4O43 A;  2EZ6 A;  5IXM B;  2EN7 A;  4BC9 A;  1A1I A;  3ADJ A;  4DR6 E;  4NZV A;  1A1J A;  4X8W A;  2YTN A;  2CPN A;  2DMI A;  2EPM X;  2HC5 A;  2L3J A;  1YYK A;  2LTR A;  2V88 A;  2JWO A;  4DV5 E;  4KWY A;  2L2N A;  1T4O A;  2EOH A;  1EH6 A;  3QG5 C;  5AE1 A;  1X5W A;  1B69 A;  2GPI A;  2YTG A;  3H09 A;  2MKD A;  5AC4 A;  1PJS A;  1KJK A;  4DR7 E;  2ZM6 E;  1YPN A;  2EL5 A;  3OML A;  2EMK A;  4J8Z A;  2EN4 A;  4LF8 E;  4DV1 E;  4K0K E;  2EL4 A;  2EM7 A;  4LF6 E;  1RMD A;  1RC7 A;  5BR8 E;  2EJ4 A;  1TF3 A;  3DJW A;  2ODR D;  4WFT A;  4OX9 E;  2MC6 A;  1HNZ E;  1UIL A;  2NA2 A;  2ELZ A;  1FKA E;  3VYX A;  5TSE A;  2EQ3 A;  2EOF A;  2ENA A;  2UUA E;  4F9B B;  4DR5 E;  1EH8 A;  4BS9 A;  3UK3 C;  4F6M A;  4TUG A;  1EKZ A;  2YSP A;  5KL6 A;  2E5L E;  1A1K A;  1X49 A;  2R76 A;  2LT7 A;  2EMH A;  3EPK A;  3HTX A;  2EPN A;  2K4V A;  4X9J A;  1F2I G;  4LU9 A;  4KHP E;  3KZZ A;  2EMY A;  4X64 E;  2EM9 A;  1WRJ A;  1HNX E;  1N32 E;  1XMO E;  5A6B D;  4DUZ E;  2EMI A;  2GHF A;  2EPA A;  2V87 A;  5KL2 A;  2EM5 A;  4DV4 E;  2DRP A;  2V86 A;  1STU A;  1X6E A;  3C6M A;  2EPU A;  2VE7 C;  2CT1 A;  1DQ3 A;  2FTX B;  2MKN A;  4P78 A;  4Q28 A;  3T1H E;  2RPC A;  1IQO A;  4AQY E;  5AC5 A;  2B9D A;  2EMG A;  3AV0 A;  2EN3 A;  1YFH A;  2EPX A;  2UXC E;  2F4V E;  2L2K B;  1HNW E;  4JI7 E;  2YTJ A;  2K7I A;  4DV0 E;  2JP9 A;  1SR9 A;  3LLH A;  1IBL E;  2RTX A;  1GQE A;  1ZBT A;  3C4B A;  2EMW A;  2CSH A;  2JR1 A;  5LMN E;  1N34 E;  1YUI A;  2UU9 E;  5KL7 A;  2EN2 A;  4R2A A;  4MLQ A;  4BMJ A;  2V8Q B;  2EM8 A;  2M7Q A;  2VF1 A;  2IHR 1;  1LLM C;  2DB2 A;  2EOR A;  4R8O A;  3THN A;  1PKP A;  2LV2 A;  2WBT A;  4NHR A;  2YSO A;  1T38 A;  2YTQ A;  2VRD A;  1GTK A;  4DMI A;  3T1Y E;  2G7H A;  2L92 A;  1A1F A;  3JU0 A;  2V89 A;  4RH8 A;  5T6J A;  5KL5 A;  2YTO A;  2YU8 A;  3MHH C;  2F8B A;  4ZYD A;  3JAM C;  2JPA A;  3FIG A;  2EP3 A;  3C4T A;  2L8T A;  4R2S A;  4JI0 E;  2JOX A;  4BC7 A;  2HHH E;  2VQE E;  2EPP A;  1WXR A;  2VQF E;  2EOZ A;  4JI8 E;  1GZ6 A;  2NUF A;  3BGH A;  2DSY A;  4IS1 C;  1EH7 A;  4LF4 E;  1HR0 E;  3TQM A;  2LE2 A;  1IBK E;  2DMY A;  2YU5 A;  4HEI A;  2H36 X;  4JI4 E;  1BBG A;  2MDG A;  1XNR E;  1J26 A;  2FGG A;  3HQ1 A;  1WJP A;  3VYY A;  1ZAA C;  2EMX A;  1A1L A;  1J5E E;  2A25 A;  3EPJ A;  1I94 E;  2EMF A;  2EOO A;  1O0W A;  4WXC A;  2EM2 A;  2EOY A;  4GEQ B;  1ZBQ A;  3JTZ A;  2LTS A;  1UHZ A;  2MDR A;  1IMU A;  1YSA C;  3IWC A;  2HGH A;  4HTG A;  4B3M E;  3ADI A;  1X3C A;  1X6H A;  2EPO A;  2LBS B;  3VK6 A;  4GKJ E;  4I8O A;  4LF9 E;  4F9C B;  2EOX A;  2V85 A;  2LVH A;  4X65 E;  1JK1 A;  2YTF A;  2CTD A;  4DV6 E;  4BHB A;  3J7Y p;  2EOE A;  2EN6 A;  3F6H A;  2EL6 A;  2EOJ A;  3EQ1 A;  2NAB A;  1T4L B;  1T4N A;  4Q35 B;  1JK2 A;  1FJG E;  4ZYE A;  1IBM E;  2EM0 A;  5A2Q C;  2RS7 A;  4DR4 E;  2LUP B;  1AH5 A;  4YHH E;  2EPR A;  2EOI A;  5LLQ A;  5IT9 C;  1Z1B A;  3HPS A;  2YTI A;  5A6J A;  4R2C A;  1BB8 A;  2DLQ A;  2JOB A;  2WBU A;  5F3W A;  2E72 A;  5KL4 A;  3HXL A;  1UN6 B;  2DLK A;  1QNT A;  4DUY E;  1TN9 A;  1XMQ E;  2LJU A;  2M1S A;  2M4I A;  1G2D C;  2B7V A;  2HJJ A;  2EE8 A;  2N3G A;  2LRS A;  1WHQ A;  2ENH A;  3BID A;  1PJQ A;  1G2F C;  4OOG C;  2LJH A;  4GKK E;  1DGC A;  4DV7 E;  2V83 A;  2EM4 A;  5A6K A;  4M0V A;  2EPZ A;  2RSI A;  4O4K A;  1X6F A;  4LF5 E;  4WPY A;  2B3T B;  2JYA A;  4DV3 E;  2DGC A;  1A1H A;  2YRM A;  5CFF E;  4F54 A;  2YWQ A;  2RQL A;  3IWD A;  1TF6 A;  2LO3 A;  2UUC E;  4LFA E;  4GZN C;  3J7A G;  3ZOQ B;  2EPL X;  4R2P A;  2I13 A;  4ZYG A;  3LML A;  2E1M A;  3BF2 A;  3ADL A;  3EPH A;  2EOM A;  2YTP A;  1IQS A;  4F9A B;  2EML A;  2M9A A;  1RQ0 A;  1T39 A;  4F6N A;  3C6K A;  5A6A A;  3K6Q A;  2L33 A;  3KWR A;  1YYO A;  2LUQ A;  4L8N A;  2NUE A;  4B3R E;  2DIX A;  2LCE A;  4FK5 C;  4NXN E;  4LTY A;  2WBS A;  2FV4 B;  2EQ0 A;  2EMZ A;  2ENC A;  4JYA E;  2N3H A;  2JXP A;  3THO B;  4WSG A;  2MC5 A;  1XNQ E;  2D9H A;  1L4S A;  1N33 E;  5DNY A;  4RHB B;  3J81 C;  3KZY A;  2ELY A;  5AE3 A;  2ODR C;  1MEY C;  2J7J A;  2RSM A;  4JI5 E;  1ZR9 A;  2EMA A;  4X62 E;  4TUI A;  1A1G A;  3ECR A;  4R2R A;  1WHN A;  4M9V C;  3MHS C;  4JI1 E;  4LF7 E;  4R03 A;  3MSW A;  4MLV A;  2L6M A;  4WYQ B;  2KHX A;  2BBG A;  2WZO A;  4B3T E;  4M30 A;  3HPZ A;  5AE2 A;  4JI3 E;  4DR1 E;  2JVA A;  4R2D A;  2PRT A;  2BB8 A;  2JY9 A;  2UUB E;  4WSP A;  4LFB E;  3DF6 A;  2YT4 A;  2KON A;  2LMZ A;  3J80 C;  4L5N C;  2L3C A;  3VHT B;  2UXD E;  2UXB E;  4JI6 E;  5A6B A;  1BBO A;  1UBD C;  4O24 A; 
#chains in the Genus database with same CATH homology
 2EP3 A;  2RSI A;  2ENA A;  4R2S A;  2EPC A;  1X6F A;  3UK3 C;  4R2E A;  4F6M A;  2EPP A;  2DGC A;  2EN8 A;  2EOZ A;  2YSP A;  2YRM A;  1A1H A;  2EM6 A;  3M99 B;  5KL6 A;  4IS1 C;  1TF6 A;  2LO3 A;  1A1K A;  2WCC 3;  2LT7 A;  4GZN C;  2EMH A;  2YU5 A;  2MDG A;  2YRH A;  2YTE A;  1AAY A;  3EPK A;  1ZAA C;  1WJP A;  4R2P A;  2I13 A;  2EMC A;  4X9J A;  1F2I G;  2EMX A;  2EMY A;  1A1L A;  2A25 A;  3EPJ A;  3EPH A;  2EMF A;  2EOO A;  2EM9 A;  2EM2 A;  2EQ1 A;  2EOY A;  2YRK A;  2EOM A;  2R1F A;  3EPL A;  2EOS A;  2YTP A;  2EMI A;  2EM3 A;  2GHF A;  2EPA A;  5KL2 A;  1NCS A;  1ZU1 A;  2EML A;  2EM5 A;  2M9A A;  4F6N A;  2DRP A;  2EOQ A;  1X6E A;  1YSA C;  5KL3 A;  2HGH A;  2EPU A;  2ADR A;  2YTD A;  2CT1 A;  1X6H A;  1X3C A;  1P47 A;  2MKN A;  2LCE A;  4FK5 C;  4IJD A;  2WBS A;  2GLI A;  2EN1 A;  2RPC A;  2EOX A;  2LVH A;  4R2Q A;  2EQ0 A;  1JK1 A;  2YTF A;  2EMG A;  2CTD A;  2EN3 A;  2EPX A;  2EMZ A;  2ENC A;  2EMB A;  4WSG A;  2EOE A;  1YUJ A;  2YTJ A;  2EN6 A;  2EL6 A;  2EOJ A;  4F2J C;  2D9H A;  2JP9 A;  2NAB A;  2ELY A;  1JK2 A;  2EN7 A;  2EM0 A;  1A1I A;  2J7J A;  1MEY C;  1ZR9 A;  2EMA A;  2EMW A;  2CSH A;  1YUI A;  1A1J A;  1A1G A;  2YTN A;  4R2R A;  2DMI A;  4M9V C;  5KL7 A;  2EPR A;  3MHS C;  2EN2 A;  2EOI A;  4R2A A;  1Z1B A;  2EM8 A;  2YTI A;  4R2C A;  2EOH A;  1LLM C;  1BB8 A;  2DLQ A;  1X5W A;  2EOR A;  2WBU A;  1B69 A;  2E72 A;  2LV2 A;  2WBT A;  5KL4 A;  2YTG A;  1UN6 B;  2YSO A;  2DLK A;  2YTQ A;  4R2D A;  2PRT A;  2BB8 A;  2VRD A;  1TN9 A;  2MKD A;  1KJK A;  1A1F A;  2EL5 A;  2EMK A;  2EN4 A;  1G2D C;  2EE8 A;  2EL4 A;  2EM7 A;  5KL5 A;  1RMD A;  2ENH A;  2YTO A;  2EJ4 A;  2YU8 A;  3VHT B;  1TF3 A;  3MHH C;  1G2F C;  1DGC A;  2ELZ A;  1BBO A;  1UBD C;  2EQ3 A;  2EOF A;  2EM4 A;  2JPA A;  2EPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...