1A1JA

Radr (zif268 variant) zinc finger-dna complex (gcgt site)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
84
structure length
84
Chain Sequence
RPYACPVESCDRRFSRSADLTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title High-resolution structures of variant Zif268-DNA complexes: implications for understanding zinc finger-DNA recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*CP*GP*T)-3')
total genus 25
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 1997-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1jA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1jA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1jA03
3VHTB 2EN3A 3EPKA 4GZNC 3MHHC 2DGCA 2EOZA 1A1FA 1AAYA 2YTDA 1UBDC 2DLKA 2YTQA 2EOFA 2YTJA 2ELZA 2YRHA 5KL6A 2EPRA 2CSHA 2ELYA 2EP3A 4IJDA 2EN6A 1X6FA 2EM8A 3M99B 1G2FC 2MKNA 1F2IG 2WBTA 2YTEA 1A1HA 1A1GA 2EPZA 2EMFA 5KL4A 2RSIA 2YU5A 4WSGA 4R2EA 2A25A 1TF6A 2E72A 4R2QA 2EOXA 3EPLA 2EM4A 2YSOA 1YSAC 5KL5A 2EMZA 2DRPA 2ENAA 2YTNA 2CTDA 2EOYA 5KL7A 1A1KA 2EE8A 2WBUA 2I13A 2YU8A 1B69A 1RMDA 2ENCA 1WJPA 2EOJA 2RPCA 2HGHA 2JP9A 1TF3A 4F2JC 2PRTA 3EPJA 2EMKA 2M9AA 3MHSC 1ZR9A 2YSPA 2EPXA 2BB8A 3EPHA 2EL4A 1TN9A 2EQ1A 2J7JA 1YUJA 2EPCA 1BBOA 2EN4A 2NABA 1JK2A 2EQ3A 2YTFA 2LCEA 2EM5A 2EMBA 1X6HA 2EM7A 2YRMA 1JK1A 2DMIA 2EM3A 2EMLA 4X9JA 4M9VC 2EM6A 2YTPA 1P47A 4FK5C 1MEYC 1A1IA 2EN7A 4F6MA 4R2RA 2EOMA 2EN1A 2LVHA 2EM9A 2EQ0A 2VRDA 1X3CA 2LV2A 1A1LA 2ENHA 2ADRA 2YTOA 2EJ4A 2EMYA 2YTGA 2EMGA 2EN8A 2EMCA 4F6NA 1G2DC 4R2SA 1LLMC 3UK3C 1UN6B 2EPUA 2EMIA 2EM2A 1Z1BA 1ZAAC 2EPAA 2YRKA 2EOQA 2JPAA 1BB8A 4IS1C 1X6EA 4R2DA 2EPPA 5KL3A 2EM0A 4R2AA 2LT7A 2EOSA 1X5WA 2CT1A 1A1JA 2EMWA 2R1FA 2GHFA 1ZU1A 2GLIA 2D9HA 2DLQA 2EN2A 2EOHA 1NCSA 2MKDA 2EORA 2EMXA 2YTIA 1DGCA 1YUIA 2EMAA 2LO3A 2EOEA 5KL2A 2EL5A 2EMHA 2WCC3 2EOOA 2MDGA 1KJKA 2EL6A 2EOIA 2WBSA 4R2PA 4R2CA
chains in the Genus database with same CATH superfamily
4JI0E 2EOZA 3HQ1A 4WFTA 4RH8A 2F4VE 2V85A 1AAYA 2YTQA 2YTJA 4OX9E 4M30A 2CSHA 2DSYA 4N4RB 4GKJE 2HJJA 2MKNA 2E5LE 2WBTA 2YTEA 2RSIA 1GTKA 4BMJA 4NHRA 1AH5A 4R2QA 3EPLA 5AE2A 5KL5A 2EMZA 2EWLA 2NUEA 2YTNA 2EPMX 1PDAA 2RSMA 4BCAA 1A1KA 2LTRA 1B69A 1XNRE 1RMDA 4WPYA 2VQFE 2MC5A 1WJPA 4JI2E 4F2JC 4LFAE 3BF2A 2LRSA 3OTOE 1YZ9A 1EH8A 2FV4B 2M1SA 2JY9A 3ADLA 1TN9A 2J7JA 1YUJA 1T4NA 2YT4A 2EN4A 4JI3E 2LCEA 3VYYA 2EMBA 4HEIA 4DV0E 5IT9C 1P47A 5IWAE 2UUCE 1N34E 2VQEE 1WHQA 3F6HA 3VYXA 2KONA 2EM9A 2VRDA 2YWQA 4X62E 3J81C 2ENHA 2ADRA 2YTOA 1NEIA 2EMYA 2V89A 2EMGA 3L00A 2RTXA 1G2DC 4R2SA 4BC7A 2EPUA 2EMIA 3K6QA 2JPAA 1YYKA 3JAMC 4F9BB 2L3JA 2L2NA 4R2DA 4R8OA 4OOGC 1YFHA 1A1JA 1X5WA 3H09A 2JR1A 2UXCE 1ZU1A 2EOHA 2L2KB 2EMXA 2YTIA 4TUGA 4LFBE 1J26A 2NUGA 1EH7A 2EOEA 5KL2A 2B3TB 2EMHA 4TUIA 2WCC3 1EKZA 4WXDA 2EPOA 4Q28A 1KJKA 4R2PA 3BBGA 4GZNC 3HPZA 1I94E 3AV0A 2G7HA 1HR0E 1T4OA 1N3GA 4KWYA 2LJHA 1WHNA 2YTDA 2H36X 4YHHE 2V88A 3P1XA 2ELZA 3KZZA 3THOB 5A6KA 2ELYA 5ADZA 4X8WA 1YPNA 4JYAE 1G2FC 2B7VA 3KWRA 1F2IG 4ZYGA 4K0KE 4JV5E 2M4IA 4MLQA 1A1HA 2EPZA 4Q35B 4DV6E 2EPKX 1TF6A 4DR5E 3TQMA 4JI5E 2F8BA 2YSOA 3BIDA 5LMNE 5DNYA 4O5GA 4L5NC 2ENAA 4JI7E 2EPNA 4X64E 2CTDA 5KL7A 2CPNA 2I13A 4WSPA 2LTSA 3JTZA 3T1HE 4YY3E 2ENCA 2ZM6E 4LF9E 4BHCA 2RPCA 4P78A 1TF3A 3MSWA 2L6MA 2PRTA 2EMKA 2NUFA 3C6MA 4BC9A 3OMLA 1ZR9A 2YSPA 2EPXA 3DJWA 2BB8A 3EPHA 1KYQA 2MDRA 2DB2A 2KHXA 3QG5C 1JK2A 4KHPE 2YRMA 2EM7A 2EMLA 2Q8UA 4X9JA 2EM6A 3ADJA 1UILA 2EN7A 1IBME 2VE7C 2EN1A 2IHR1 2LV2A 3BGHA 1IBLE 3LLHA 2EN8A 2EMCA 3C6KA 4NXNE 1SR9A 1UN6B 1Z1BA 4KZSA 3J80C 2EOQA 1HNWE 5A6BA 2WZOA 2JOXA 2UUBE 4LF6E 1XMQE 4DV4E 4L8NA 5KL3A 2EM0A 2JWOA 2YZTA 1XNQE 2L92A 2EMWA 4B3ME 2R1FA 2KOUA 1T4LB 2GLIA 2D9HA 2EN2A 2UUAE 1DI2A 2MKDA 1PJSA 1UHZA 2MC6A 4P7DA 4DUYE 1YUIA 1GZ6A 2EL5A 4LU9A 1X49A 1J5EE 2EL6A 1QU6A 2GPIA 3EPKA 3MHHC 1IQSA 1A1FA 3J7Yp 4WYQB 4F9AB 2EOFA 4ZYDA 3HPSA 5KL6A 1L4SA 2EPRA 4R03A 1FKAE 2EP3A 2ODRD 2DMYA 1YYOA 1IQOA 2V87A 2EM8A 3M99B 2N3HA 4LFCE 4ZYEA 2EMFA 5KL4A 2YU5A 4WSGA 2BBGA 2L8TA 2ODRC 3T1YE 2JOBA 1O0WA 5CFFE 1N36E 1GQEA 1YSAC 2DRPA 4BHBA 2EOYA 1MGTA 1WXRA 2EE8A 3F6GA 2WBUA 5LL6R 2YU8A 4O24A 4DV7E 2JXPA 3KZYA 3IWCA 2M7QA 2RS6A 2EOJA 2VF1A 2HGHA 2JP9A 2B7TA 5AC4A 3ADGA 2HC5A 2M9AA 1IBKE 4DUZE 4BS9A 4HTGA 2UXBE 4F9CB 2EL4A 2EQ1A 5AE1A 2EPCA 2LUPB 1BBOA 2NABA 2YTFA 1WRJA 4ZYHA 2EM5A 1X6HA 3DF6A 2EM3A 4BBYA 3THNA 2YTPA 4FK5C 1MEYC 1A1IA 4WX9A 2B9DA 5FLXC 4R2RA 3C4BA 4JI8E 4B3SE 4M0VA 3IWBA 3C4TA 2EJ4A 2NA2A 2YTGA 4LTYA 1RQ0A 4X66E 4DR2E 4F6NA 1LLMC 4LF8E 3UK3C 4DR1E 2EM2A 1ZAAC 1XMOE 5IV8B 2FGGA 4F54A 1BB8A 2EPLX 2V83A 4IS1C 4R2AA 4X65E 2FTXB 2DLQA 2UU9E 5A2QC 4B3TE 1NCSA 2EORA 2JVAA 5AASA 2N3GA 1X48A 3RMPA 2N8XA 4DR3E 2L3CA 2R76A 2MDGA 1N33E 4LF4E 4R2CA 1SFEA 3VHTB 2EN3A 2L33A 2DGCA 4AQYE 2HHHE 4JI6E 1IMUA 1UBDC 1FJGE 2LUQA 2DLKA 2V86A 4M2ZA 3LMLA 2YRHA 1PKPA 5A6JA 4LF7E 1QNTA 4IJDA 5F3WA 1EH6A 2EN6A 4RHBB 5T6JA 1X6FA 4NZVA 3ZOQB 5BR8E 4DMIA 1A1GA 4R2EA 2A25A 2E1MA 2E72A 5IXMB 2EOXA 5AC5A 2EM4A 4DV3E 5LLQA 1T38A 2K4VA 3HXLA 2RQLA 2I9IA 2V8QB 5LMUE 4LF5E 3FIGA 1ZBTA 1PJTA 1HNXE 1STUA 3ADIA 3EPJA 4O4KA 5A69A 3MHSC 2LBSB 2L2MA 1PJQA 4DV1E 1YYWA 4NXME 1DQ3A 4JI4E 4B3RE 2EQ3A 4DV2E 1JK1A 2DMIA 4GKKE 1N32E 2EZ6A 3J7AG 4M9VC 4F6MA 4JI1E 2YPNA 1HNZE 2EOMA 4MLVA 4DR7E 2LVHA 2EQ0A 3AUZA 1X3CA 1A1LA 1ZBQA 1RC7A 4DR6E 4I8OA 4O43A 1X47A 1BBGA 2EPAA 2JYAA 2YRKA 4DV5E 3VK6A 4J8ZA 4DKKA 1X6EA 5TSEA 2EPPA 5AE3A 2K7IA 3EQ1A 4GEQB 2LT7A 2EOSA 2CT1A 2GHFA 3IWDA 2LJUA 5A6AA 2UXDE 3ECRA 3JU0A 2RS7A 5A6BD 2LE2A 4WXCA 2LMZA 1DGCA 2EMAA 3HTXA 4DR4E 2LO3A 1T39A 2DIXA 2EOOA 2EOIA 2WBSA
chains in the Genus database with same CATH topology
3VHTB 2EN3A 3EPKA 4GZNC 3MHHC 2DGCA 2EOZA 1A1FA 1AAYA 2YTDA 1UBDC 2DLKA 2YTQA 2EOFA 2YTJA 2ELZA 2YRHA 5KL6A 2EPRA 2CSHA 2ELYA 2EP3A 4IJDA 2EN6A 1X6FA 2EM8A 3M99B 1G2FC 2MKNA 1F2IG 2WBTA 2YTEA 1A1HA 1A1GA 2EPZA 2EMFA 5KL4A 2RSIA 2YU5A 4WSGA 4R2EA 2A25A 1TF6A 2E72A 4R2QA 2EOXA 3EPLA 2EM4A 2YSOA 1YSAC 5KL5A 2EMZA 2DRPA 2ENAA 2YTNA 2CTDA 2EOYA 5KL7A 1A1KA 2EE8A 2WBUA 2I13A 2YU8A 1B69A 1RMDA 2ENCA 1WJPA 2EOJA 2RPCA 2HGHA 2JP9A 1TF3A 4F2JC 2PRTA 3EPJA 2EMKA 2M9AA 3MHSC 1ZR9A 2YSPA 2EPXA 2BB8A 3EPHA 2EL4A 1TN9A 2EQ1A 2J7JA 1YUJA 2EPCA 1BBOA 2EN4A 2NABA 1JK2A 2EQ3A 2YTFA 2LCEA 2EM5A 2EMBA 1X6HA 2EM7A 2YRMA 1JK1A 2DMIA 2EM3A 2EMLA 4X9JA 4M9VC 2EM6A 2YTPA 1P47A 4FK5C 1MEYC 1A1IA 2EN7A 4F6MA 4R2RA 2EOMA 2EN1A 2LVHA 2EM9A 2EQ0A 2VRDA 1X3CA 2LV2A 1A1LA 2ENHA 2ADRA 2YTOA 2EJ4A 2EMYA 2YTGA 2EMGA 2EN8A 2EMCA 4F6NA 1G2DC 4R2SA 1LLMC 3UK3C 1UN6B 2EPUA 2EMIA 2EM2A 1Z1BA 1ZAAC 2EPAA 2YRKA 2EOQA 2JPAA 1BB8A 4IS1C 1X6EA 4R2DA 2EPPA 5KL3A 2EM0A 4R2AA 2LT7A 2EOSA 1X5WA 2CT1A 1A1JA 2EMWA 2R1FA 2GHFA 1ZU1A 2GLIA 2D9HA 2DLQA 2EN2A 2EOHA 1NCSA 2MKDA 2EORA 2EMXA 2YTIA 1DGCA 1YUIA 2EMAA 2LO3A 2EOEA 5KL2A 2EL5A 2EMHA 2WCC3 2EOOA 2MDGA 1KJKA 2EL6A 2EOIA 2WBSA 4R2PA 4R2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VHT B;  2EN3 A;  3EPK A;  4GZN C;  3MHH C;  2DGC A;  2EOZ A;  1A1F A;  1AAY A;  2YTD A;  1UBD C;  2DLK A;  2YTQ A;  2EOF A;  2YTJ A;  2ELZ A;  2YRH A;  5KL6 A;  2EPR A;  2CSH A;  2ELY A;  2EP3 A;  4IJD A;  2EN6 A;  1X6F A;  2EM8 A;  3M99 B;  1G2F C;  2MKN A;  1F2I G;  2WBT A;  2YTE A;  1A1H A;  1A1G A;  2EPZ A;  2EMF A;  5KL4 A;  2RSI A;  2YU5 A;  4WSG A;  4R2E A;  2A25 A;  1TF6 A;  2E72 A;  4R2Q A;  2EOX A;  3EPL A;  2EM4 A;  2YSO A;  1YSA C;  5KL5 A;  2EMZ A;  2DRP A;  2ENA A;  2YTN A;  2CTD A;  2EOY A;  5KL7 A;  1A1K A;  2EE8 A;  2WBU A;  2I13 A;  2YU8 A;  1B69 A;  1RMD A;  2ENC A;  1WJP A;  2EOJ A;  2RPC A;  2HGH A;  2JP9 A;  1TF3 A;  4F2J C;  2PRT A;  3EPJ A;  2EMK A;  2M9A A;  3MHS C;  1ZR9 A;  2YSP A;  2EPX A;  2BB8 A;  3EPH A;  2EL4 A;  1TN9 A;  2EQ1 A;  2J7J A;  1YUJ A;  2EPC A;  1BBO A;  2EN4 A;  2NAB A;  1JK2 A;  2EQ3 A;  2YTF A;  2LCE A;  2EM5 A;  2EMB A;  1X6H A;  2EM7 A;  2YRM A;  1JK1 A;  2DMI A;  2EM3 A;  2EML A;  4X9J A;  4M9V C;  2EM6 A;  2YTP A;  1P47 A;  4FK5 C;  1MEY C;  1A1I A;  2EN7 A;  4F6M A;  4R2R A;  2EOM A;  2EN1 A;  2LVH A;  2EM9 A;  2EQ0 A;  2VRD A;  1X3C A;  2LV2 A;  1A1L A;  2ENH A;  2ADR A;  2YTO A;  2EJ4 A;  2EMY A;  2YTG A;  2EMG A;  2EN8 A;  2EMC A;  4F6N A;  1G2D C;  4R2S A;  1LLM C;  3UK3 C;  1UN6 B;  2EPU A;  2EMI A;  2EM2 A;  1Z1B A;  1ZAA C;  2EPA A;  2YRK A;  2EOQ A;  2JPA A;  1BB8 A;  4IS1 C;  1X6E A;  4R2D A;  2EPP A;  5KL3 A;  2EM0 A;  4R2A A;  2LT7 A;  2EOS A;  1X5W A;  2CT1 A;  1A1J A;  2EMW A;  2R1F A;  2GHF A;  1ZU1 A;  2GLI A;  2D9H A;  2DLQ A;  2EN2 A;  2EOH A;  1NCS A;  2MKD A;  2EOR A;  2EMX A;  2YTI A;  1DGC A;  1YUI A;  2EMA A;  2LO3 A;  2EOE A;  5KL2 A;  2EL5 A;  2EMH A;  2WCC 3;  2EOO A;  2MDG A;  1KJK A;  2EL6 A;  2EOI A;  2WBS A;  4R2P A;  4R2C A; 
#chains in the Genus database with same CATH topology
 4JI0 E;  2EOZ A;  3HQ1 A;  4WFT A;  4RH8 A;  2F4V E;  2V85 A;  1AAY A;  2YTQ A;  2YTJ A;  4OX9 E;  4M30 A;  2CSH A;  2DSY A;  4N4R B;  4GKJ E;  2HJJ A;  2MKN A;  2E5L E;  2WBT A;  2YTE A;  2RSI A;  1GTK A;  4BMJ A;  4NHR A;  1AH5 A;  4R2Q A;  3EPL A;  5AE2 A;  5KL5 A;  2EMZ A;  2EWL A;  2NUE A;  2YTN A;  2EPM X;  1PDA A;  2RSM A;  4BCA A;  1A1K A;  2LTR A;  1B69 A;  1XNR E;  1RMD A;  4WPY A;  2VQF E;  2MC5 A;  1WJP A;  4JI2 E;  4F2J C;  4LFA E;  3BF2 A;  2LRS A;  3OTO E;  1YZ9 A;  1EH8 A;  2FV4 B;  2M1S A;  2JY9 A;  3ADL A;  1TN9 A;  2J7J A;  1YUJ A;  1T4N A;  2YT4 A;  2EN4 A;  4JI3 E;  2LCE A;  3VYY A;  2EMB A;  4HEI A;  4DV0 E;  5IT9 C;  1P47 A;  5IWA E;  2UUC E;  1N34 E;  2VQE E;  1WHQ A;  3F6H A;  3VYX A;  2KON A;  2EM9 A;  2VRD A;  2YWQ A;  4X62 E;  3J81 C;  2ENH A;  2ADR A;  2YTO A;  1NEI A;  2EMY A;  2V89 A;  2EMG A;  3L00 A;  2RTX A;  1G2D C;  4R2S A;  4BC7 A;  2EPU A;  2EMI A;  3K6Q A;  2JPA A;  1YYK A;  3JAM C;  4F9B B;  2L3J A;  2L2N A;  4R2D A;  4R8O A;  4OOG C;  1YFH A;  1A1J A;  1X5W A;  3H09 A;  2JR1 A;  2UXC E;  1ZU1 A;  2EOH A;  2L2K B;  2EMX A;  2YTI A;  4TUG A;  4LFB E;  1J26 A;  2NUG A;  1EH7 A;  2EOE A;  5KL2 A;  2B3T B;  2EMH A;  4TUI A;  2WCC 3;  1EKZ A;  4WXD A;  2EPO A;  4Q28 A;  1KJK A;  4R2P A;  3BBG A;  4GZN C;  3HPZ A;  1I94 E;  3AV0 A;  2G7H A;  1HR0 E;  1T4O A;  1N3G A;  4KWY A;  2LJH A;  1WHN A;  2YTD A;  2H36 X;  4YHH E;  2V88 A;  3P1X A;  2ELZ A;  3KZZ A;  3THO B;  5A6K A;  2ELY A;  5ADZ A;  4X8W A;  1YPN A;  4JYA E;  1G2F C;  2B7V A;  3KWR A;  1F2I G;  4ZYG A;  4K0K E;  4JV5 E;  2M4I A;  4MLQ A;  1A1H A;  2EPZ A;  4Q35 B;  4DV6 E;  2EPK X;  1TF6 A;  4DR5 E;  3TQM A;  4JI5 E;  2F8B A;  2YSO A;  3BID A;  5LMN E;  5DNY A;  4O5G A;  4L5N C;  2ENA A;  4JI7 E;  2EPN A;  4X64 E;  2CTD A;  5KL7 A;  2CPN A;  2I13 A;  4WSP A;  2LTS A;  3JTZ A;  3T1H E;  4YY3 E;  2ENC A;  2ZM6 E;  4LF9 E;  4BHC A;  2RPC A;  4P78 A;  1TF3 A;  3MSW A;  2L6M A;  2PRT A;  2EMK A;  2NUF A;  3C6M A;  4BC9 A;  3OML A;  1ZR9 A;  2YSP A;  2EPX A;  3DJW A;  2BB8 A;  3EPH A;  1KYQ A;  2MDR A;  2DB2 A;  2KHX A;  3QG5 C;  1JK2 A;  4KHP E;  2YRM A;  2EM7 A;  2EML A;  2Q8U A;  4X9J A;  2EM6 A;  3ADJ A;  1UIL A;  2EN7 A;  1IBM E;  2VE7 C;  2EN1 A;  2IHR 1;  2LV2 A;  3BGH A;  1IBL E;  3LLH A;  2EN8 A;  2EMC A;  3C6K A;  4NXN E;  1SR9 A;  1UN6 B;  1Z1B A;  4KZS A;  3J80 C;  2EOQ A;  1HNW E;  5A6B A;  2WZO A;  2JOX A;  2UUB E;  4LF6 E;  1XMQ E;  4DV4 E;  4L8N A;  5KL3 A;  2EM0 A;  2JWO A;  2YZT A;  1XNQ E;  2L92 A;  2EMW A;  4B3M E;  2R1F A;  2KOU A;  1T4L B;  2GLI A;  2D9H A;  2EN2 A;  2UUA E;  1DI2 A;  2MKD A;  1PJS A;  1UHZ A;  2MC6 A;  4P7D A;  4DUY E;  1YUI A;  1GZ6 A;  2EL5 A;  4LU9 A;  1X49 A;  1J5E E;  2EL6 A;  1QU6 A;  2GPI A;  3EPK A;  3MHH C;  1IQS A;  1A1F A;  3J7Y p;  4WYQ B;  4F9A B;  2EOF A;  4ZYD A;  3HPS A;  5KL6 A;  1L4S A;  2EPR A;  4R03 A;  1FKA E;  2EP3 A;  2ODR D;  2DMY A;  1YYO A;  1IQO A;  2V87 A;  2EM8 A;  3M99 B;  2N3H A;  4LFC E;  4ZYE A;  2EMF A;  5KL4 A;  2YU5 A;  4WSG A;  2BBG A;  2L8T A;  2ODR C;  3T1Y E;  2JOB A;  1O0W A;  5CFF E;  1N36 E;  1GQE A;  1YSA C;  2DRP A;  4BHB A;  2EOY A;  1MGT A;  1WXR A;  2EE8 A;  3F6G A;  2WBU A;  5LL6 R;  2YU8 A;  4O24 A;  4DV7 E;  2JXP A;  3KZY A;  3IWC A;  2M7Q A;  2RS6 A;  2EOJ A;  2VF1 A;  2HGH A;  2JP9 A;  2B7T A;  5AC4 A;  3ADG A;  2HC5 A;  2M9A A;  1IBK E;  4DUZ E;  4BS9 A;  4HTG A;  2UXB E;  4F9C B;  2EL4 A;  2EQ1 A;  5AE1 A;  2EPC A;  2LUP B;  1BBO A;  2NAB A;  2YTF A;  1WRJ A;  4ZYH A;  2EM5 A;  1X6H A;  3DF6 A;  2EM3 A;  4BBY A;  3THN A;  2YTP A;  4FK5 C;  1MEY C;  1A1I A;  4WX9 A;  2B9D A;  5FLX C;  4R2R A;  3C4B A;  4JI8 E;  4B3S E;  4M0V A;  3IWB A;  3C4T A;  2EJ4 A;  2NA2 A;  2YTG A;  4LTY A;  1RQ0 A;  4X66 E;  4DR2 E;  4F6N A;  1LLM C;  4LF8 E;  3UK3 C;  4DR1 E;  2EM2 A;  1ZAA C;  1XMO E;  5IV8 B;  2FGG A;  4F54 A;  1BB8 A;  2EPL X;  2V83 A;  4IS1 C;  4R2A A;  4X65 E;  2FTX B;  2DLQ A;  2UU9 E;  5A2Q C;  4B3T E;  1NCS A;  2EOR A;  2JVA A;  5AAS A;  2N3G A;  1X48 A;  3RMP A;  2N8X A;  4DR3 E;  2L3C A;  2R76 A;  2MDG A;  1N33 E;  4LF4 E;  4R2C A;  1SFE A;  3VHT B;  2EN3 A;  2L33 A;  2DGC A;  4AQY E;  2HHH E;  4JI6 E;  1IMU A;  1UBD C;  1FJG E;  2LUQ A;  2DLK A;  2V86 A;  4M2Z A;  3LML A;  2YRH A;  1PKP A;  5A6J A;  4LF7 E;  1QNT A;  4IJD A;  5F3W A;  1EH6 A;  2EN6 A;  4RHB B;  5T6J A;  1X6F A;  4NZV A;  3ZOQ B;  5BR8 E;  4DMI A;  1A1G A;  4R2E A;  2A25 A;  2E1M A;  2E72 A;  5IXM B;  2EOX A;  5AC5 A;  2EM4 A;  4DV3 E;  5LLQ A;  1T38 A;  2K4V A;  3HXL A;  2RQL A;  2I9I A;  2V8Q B;  5LMU E;  4LF5 E;  3FIG A;  1ZBT A;  1PJT A;  1HNX E;  1STU A;  3ADI A;  3EPJ A;  4O4K A;  5A69 A;  3MHS C;  2LBS B;  2L2M A;  1PJQ A;  4DV1 E;  1YYW A;  4NXM E;  1DQ3 A;  4JI4 E;  4B3R E;  2EQ3 A;  4DV2 E;  1JK1 A;  2DMI A;  4GKK E;  1N32 E;  2EZ6 A;  3J7A G;  4M9V C;  4F6M A;  4JI1 E;  2YPN A;  1HNZ E;  2EOM A;  4MLV A;  4DR7 E;  2LVH A;  2EQ0 A;  3AUZ A;  1X3C A;  1A1L A;  1ZBQ A;  1RC7 A;  4DR6 E;  4I8O A;  4O43 A;  1X47 A;  1BBG A;  2EPA A;  2JYA A;  2YRK A;  4DV5 E;  3VK6 A;  4J8Z A;  4DKK A;  1X6E A;  5TSE A;  2EPP A;  5AE3 A;  2K7I A;  3EQ1 A;  4GEQ B;  2LT7 A;  2EOS A;  2CT1 A;  2GHF A;  3IWD A;  2LJU A;  5A6A A;  2UXD E;  3ECR A;  3JU0 A;  2RS7 A;  5A6B D;  2LE2 A;  4WXC A;  2LMZ A;  1DGC A;  2EMA A;  3HTX A;  4DR4 E;  2LO3 A;  1T39 A;  2DIX A;  2EOO A;  2EOI A;  2WBS A; 
#chains in the Genus database with same CATH homology
 3VHT B;  2EN3 A;  3EPK A;  4GZN C;  3MHH C;  2DGC A;  2EOZ A;  1A1F A;  1AAY A;  2YTD A;  1UBD C;  2DLK A;  2YTQ A;  2EOF A;  2YTJ A;  2ELZ A;  2YRH A;  5KL6 A;  2EPR A;  2CSH A;  2ELY A;  2EP3 A;  4IJD A;  2EN6 A;  1X6F A;  2EM8 A;  3M99 B;  1G2F C;  2MKN A;  1F2I G;  2WBT A;  2YTE A;  1A1H A;  1A1G A;  2EPZ A;  2EMF A;  5KL4 A;  2RSI A;  2YU5 A;  4WSG A;  4R2E A;  2A25 A;  1TF6 A;  2E72 A;  4R2Q A;  2EOX A;  3EPL A;  2EM4 A;  2YSO A;  1YSA C;  5KL5 A;  2EMZ A;  2DRP A;  2ENA A;  2YTN A;  2CTD A;  2EOY A;  5KL7 A;  1A1K A;  2EE8 A;  2WBU A;  2I13 A;  2YU8 A;  1B69 A;  1RMD A;  2ENC A;  1WJP A;  2EOJ A;  2RPC A;  2HGH A;  2JP9 A;  1TF3 A;  4F2J C;  2PRT A;  3EPJ A;  2EMK A;  2M9A A;  3MHS C;  1ZR9 A;  2YSP A;  2EPX A;  2BB8 A;  3EPH A;  2EL4 A;  1TN9 A;  2EQ1 A;  2J7J A;  1YUJ A;  2EPC A;  1BBO A;  2EN4 A;  2NAB A;  1JK2 A;  2EQ3 A;  2YTF A;  2LCE A;  2EM5 A;  2EMB A;  1X6H A;  2EM7 A;  2YRM A;  1JK1 A;  2DMI A;  2EM3 A;  2EML A;  4X9J A;  4M9V C;  2EM6 A;  2YTP A;  1P47 A;  4FK5 C;  1MEY C;  1A1I A;  2EN7 A;  4F6M A;  4R2R A;  2EOM A;  2EN1 A;  2LVH A;  2EM9 A;  2EQ0 A;  2VRD A;  1X3C A;  2LV2 A;  1A1L A;  2ENH A;  2ADR A;  2YTO A;  2EJ4 A;  2EMY A;  2YTG A;  2EMG A;  2EN8 A;  2EMC A;  4F6N A;  1G2D C;  4R2S A;  1LLM C;  3UK3 C;  1UN6 B;  2EPU A;  2EMI A;  2EM2 A;  1Z1B A;  1ZAA C;  2EPA A;  2YRK A;  2EOQ A;  2JPA A;  1BB8 A;  4IS1 C;  1X6E A;  4R2D A;  2EPP A;  5KL3 A;  2EM0 A;  4R2A A;  2LT7 A;  2EOS A;  1X5W A;  2CT1 A;  1A1J A;  2EMW A;  2R1F A;  2GHF A;  1ZU1 A;  2GLI A;  2D9H A;  2DLQ A;  2EN2 A;  2EOH A;  1NCS A;  2MKD A;  2EOR A;  2EMX A;  2YTI A;  1DGC A;  1YUI A;  2EMA A;  2LO3 A;  2EOE A;  5KL2 A;  2EL5 A;  2EMH A;  2WCC 3;  2EOO A;  2MDG A;  1KJK A;  2EL6 A;  2EOI A;  2WBS A;  4R2P A;  4R2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...