2EMGA

Solution structure of the c2h2 type zinc finger (region 463-495) of human zinc finger protein 484
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGENPFICSECGKVFTHKTNLIIHQKIHTGERPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 463-495) of human Zinc finger protein 484
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 484
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emgA01
1UN6B 2EOQA 2I13A 1UBDC 2MDGA 2YTQA 4F2JC 4R2CA 2EQ1A 1G2DC 1BB8A 2RPCA 2YTNA 2WBSA 4GZNC 1KJKA 2PRTA 1A1IA 1YUJA 2EPCA 2EMAA 2LT7A 1MEYC 1A1HA 4R2AA 2EOXA 2YTIA 1A1JA 4R2EA 2EMXA 2EPUA 1RMDA 2VRDA 2EN1A 4WSGA 1YUIA 2EN2A 2ADRA 2EOZA 2EM2A 2EMWA 4IS1C 2YTEA 1A1LA 2EJ4A 4R2PA 2J7JA 1TN9A 2EMGA 4M9VC 2EOEA 2CT1A 2ENHA 2CTDA 2YTJA 4R2QA 2EE8A 2YTGA 2EOHA 4F6NA 2ENCA 5KL3A 2EL4A 2GHFA 2EN3A 2YTPA 2EMZA 2EMFA 2JP9A 2EPXA 2EOOA 1JK2A 2MKNA 2EMHA 2A25A 1X6FA 1F2IG 2EOFA 2M9AA 3M99B 2NABA 1TF6A 2GLIA 1ZR9A 5KL5A 2DLKA 1JK1A 2LCEA 2EM3A 5KL6A 1X6EA 5KL4A 2EORA 2LVHA 2EN4A 2LV2A 2YRMA 3MHHC 2EN6A 2WCC3 2BB8A 2EMLA 3VHTB 5KL2A 2EM4A 2HGHA 2EPPA 2RSIA 2EL6A 2EL5A 2EM7A 2EM9A 2EP3A 2MKDA 2JPAA 4FK5C 1TF3A 2EMIA 2EM5A 2YTFA 2E72A 1X3CA 2ENAA 2EM8A 4X9JA 1ZU1A 2EOJA 2EOIA 2WBTA 2EMKA 4R2RA 1YSAC 1WJPA 2YU8A 2DLQA 2WBUA 4R2SA 3EPLA 1X6HA 2DGCA 2EQ0A 2EN8A 4R2DA 2EPZA 5KL7A 1Z1BA 2ELZA 2YSOA 1AAYA 1ZAAC 2R1FA 2YSPA 2YU5A 3EPHA 4F6MA 2EOMA 2EQ3A 2DMIA 2EM0A 4IJDA 1G2FC 2EMBA 2YRKA 2YTOA 2YTDA 3EPJA 2EM6A 1X5WA 1B69A 2EPAA 2EOYA 1BBOA 1P47A 3UK3C 1LLMC 2LO3A 3EPKA 1NCSA 3MHSC 2EOSA 2YRHA 2CSHA 2EMYA 1A1KA 2EMCA 1A1GA 2D9HA 1A1FA 2ELYA 2DRPA 2EPRA 1DGCA 2EN7A
chains in the Genus database with same CATH superfamily
5LL6R 4HTGA 1YZ9A 2EOQA 3DF6A 3QG5C 2B3TB 4DV0E 3AV0A 1YYWA 2NUFA 4ZYEA 1BB8A 1N32E 2L3CA 2V83A 2YTNA 2WBSA 1A1IA 1HNXE 2EMAA 1A1HA 4LF5E 2EOXA 3C6MA 2LUPB 2YTIA 5LMUE 4KZSA 2EMXA 2EPUA 4Q35B 1GQEA 4HEIA 4WFTA 1UILA 4WSGA 1PKPA 2MC6A 4ZYHA 1N34E 2EN2A 2ADRA 2KONA 2J7JA 4TUIA 2F4VE 2EOEA 2CTDA 1PJTA 2FTXB 4F6NA 3MSWA 4LF9E 1IMUA 2YTPA 2EMZA 4LF8E 2EMFA 2JP9A 2EPXA 4X65E 2MKNA 4B3SE 3HXLA 4R03A 3ADGA 2A25A 1F2IG 2DSYA 3HPZA 2LE2A 4J8ZA 2LUQA 2FGGA 2M4IA 5AE3A 4LFCE 2EN4A 5KL2A 2EM4A 5ADZA 2E1MA 2EPPA 2RSIA 2EL5A 4LF6E 1WRJA 2EP3A 2JPAA 2UUCE 2JR1A 2VQFE 2L33A 2EM8A 1ZU1A 2WBTA 4WYQB 2B7TA 4LTYA 1EH7A 2UXDE 2WZOA 1WJPA 4GEQB 3TQMA 4P78A 1AH5A 4R2SA 2CPNA 2LRSA 4B3RE 2ELZA 1X48A 2R1FA 2YU5A 2EOMA 5AC5A 2EQ3A 5A69A 4ZYDA 2VQEE 4IJDA 4R8OA 1G2FC 2HJJA 1DI2A 2L6MA 4JI1E 3P1XA 4KWYA 4RHBB 3THOB 4DR6E 2JOBA 2EMYA 2F8BA 1XMQE 2D9HA 4MLQA 2EPRA 1DGCA 2HHHE 2ODRC 2NA2A 2I13A 2MDGA 1XMOE 4R2CA 4P7DA 2B7VA 2RS6A 3C6KA 1G2DC 4GZNC 1YUJA 2RS7A 3ZOQB 4BHBA 1YYKA 2V85A 2JY9A 2N8XA 3KZZA 5CFFE 4WXCA 2Q8UA 2EN1A 1YUIA 2EM2A 2EOZA 2UUAE 4OOGC 2YTEA 2DIXA 2N3GA 1TN9A 1WHNA 2H36X 1T39A 3L00A 2YTJA 3OMLA 4F54A 3H09A 2YT4A 5IV8B 3T1YE 2L2MA 2RQLA 5A2QC 1T4OA 4X8WA 1J5EE 4JI5E 2EOOA 4LFAE 1T4NA 3KWRA 2NUGA 4X66E 1TF6A 2GLIA 1ZR9A 5KL5A 2LCEA 4F9CB 4JI7E 2EORA 2LVHA 2DB2A 4YHHE 2YRMA 4BC7A 5A6AA 4M0VA 4KHPE 2WCC3 3VK6A 2EPLX 1IBLE 2EL6A 1ZBTA 2EM7A 2EM9A 4MLVA 2GPIA 3ECRA 2IHR1 4FK5C 3C4BA 2EMIA 2EM5A 2E72A 1X3CA 3JTZA 2EZ6A 2ENAA 2R76A 2K4VA 1EKZA 5FLXC 1EH6A 5LLQA 2LBSB 3HTXA 2HC5A 4NZVA 4LF7E 1YSAC 1UHZA 3EPLA 1X6HA 1N33E 1BBGA 2EQ0A 1I94E 2EPZA 2MC5A 3RMPA 1AAYA 3EPHA 2YSPA 2BBGA 4GKKE 3LLHA 2DMIA 2EMBA 2YRKA 3VYXA 2KHXA 3BIDA 2G7HA 1IQOA 2YTDA 3EPJA 2UXBE 1X5WA 1YPNA 4TUGA 2EPAA 1B69A 1HR0E 4JV5E 1BBOA 3UK3C 2LJUA 4JI6E 5A6BD 1QU6A 4DR7E 3THNA 1NCSA 2EOSA 4BBYA 4DUYE 4M2ZA 2YRHA 2CSHA 2EMCA 5A6BA 3J7Yp 1N3GA 4F6MA 3BF2A 1UN6B 1PJSA 2LMZA 4WSPA 1UBDC 4RH8A 4F2JC 2RPCA 4F9BB 3C4TA 3J7AG 2PRTA 2UU9E 3ADIA 5AE1A 2M7QA 2ZM6E 4L5NC 1WHQA 2LT7A 4DUZE 4B3ME 1A1JA 5IWAE 4JYAE 4DR3E 4LF4E 2VRDA 4LU9A 1SR9A 2EWLA 3KZYA 2EMWA 4NHRA 1WXRA 1FJGE 4M9VC 4X62E 4DV5E 2CT1A 2V89A 2YTGA 4BS9A 2EOHA 1GZ6A 2ENCA 5KL3A 2EL4A 2GHFA 1IQSA 3EQ1A 1ZBQA 4GKJE 4DV6E 4O4KA 4M30A 2DMYA 4N4RB 1JK2A 2FV4B 5IT9C 1O0WA 4JI0E 4LFBE 2LTSA 4WX9A 2L8TA 4O43A 1X6FA 2M9AA 3M99B 2NABA 2YZTA 5AC4A 4DMIA 2JVAA 2L2KB 2EM3A 1X6EA 5LMNE 2LV2A 4YY3E 2EN6A 4JI8E 3VHTB 2EMLA 3DJWA 5AASA 2K7IA 2L92A 3FIGA 1J26A 2JXPA 2MDRA 3JU0A 2ODRD 1XNRE 3ADLA 2UXCE 1X47A 3BGHA 4X64E 2V86A 4BCAA 4X9JA 4DR1E 1N36E 2EOJA 2EOIA 3T1HE 4DV3E 3IWDA 3F6GA 2EMKA 4R2RA 2YU8A 2WBUA 2EPOA 2DGCA 1GTKA 4R2DA 4DKKA 1QNTA 2EPNA 2B9DA 5KL7A 2YSOA 2EM0A 4Q28A 5T6JA 2YTOA 2EM6A 2EOYA 1P47A 1PDAA 1SFEA 1LLMC 2LO3A 1NEIA 3EPKA 4NXNE 5TSEA 2M1SA 1A1KA 1A1GA 1IBKE 2EN7A 5DNYA 3OTOE 2YTQA 2EPMX 4F9AB 2EQ1A 2JWOA 1KJKA 2EPCA 5AE2A 5A6JA 1MEYC 4I8OA 4R2AA 4R2EA 1PJQA 4AQYE 1RMDA 3IWBA 1X49A 4DV1E 1A1LA 3AUZA 4IS1C 2EJ4A 4R2PA 1HNZE 2EMGA 4DV4E 2ENHA 4R2QA 2EE8A 4JI2E 2V88A 3J81C 4DR2E 1L4SA 2V87A 2EN3A 4JI4E 4L8NA 1YYOA 2V8QB 2EMHA 2YPNA 3LMLA 2RTXA 2EOFA 3F6HA 1KYQA 2VE7C 2DLKA 1JK1A 3BBGA 5KL6A 5KL4A 4K0KE 1T4LB 3HQ1A 1XNQE 3MHHC 2RSMA 2HGHA 2BB8A 5F3WA 3ADJA 4ZYGA 5A6KA 2UUBE 3K6QA 2MKDA 4DR4E 1T38A 3IWCA 3VYYA 1TF3A 4DV2E 2YTFA 2E5LE 2L2NA 1FKAE 4O5GA 1IBME 1RC7A 4B3TE 2N3HA 4O24A 3J80C 2DLQA 1EH8A 4BHCA 2YWQA 1MGTA 2EN8A 5IXMB 1DQ3A 2JYAA 2LJHA 1Z1BA 1ZAAC 4NXME 2JOXA 4DR5E 1YFHA 3HPSA 2NUEA 3JAMC 2VF1A 1HNWE 4DV7E 2EPKX 4BMJA 2LTRA 4WPYA 4OX9E 5BR8E 4WXDA 2L3JA 1STUA 3MHSC 2KOUA 1RQ0A 4BC9A 1A1FA 2DRPA 4JI3E 2ELYA 2I9IA
chains in the Genus database with same CATH topology
1UN6B 2EOQA 2I13A 1UBDC 2MDGA 2YTQA 4F2JC 4R2CA 2EQ1A 1G2DC 1BB8A 2RPCA 2YTNA 2WBSA 4GZNC 1KJKA 2PRTA 1A1IA 1YUJA 2EPCA 2EMAA 2LT7A 1MEYC 1A1HA 4R2AA 2EOXA 2YTIA 1A1JA 4R2EA 2EMXA 2EPUA 1RMDA 2VRDA 2EN1A 4WSGA 1YUIA 2EN2A 2ADRA 2EOZA 2EM2A 2EMWA 4IS1C 2YTEA 1A1LA 2EJ4A 4R2PA 2J7JA 1TN9A 2EMGA 4M9VC 2EOEA 2CT1A 2ENHA 2CTDA 2YTJA 4R2QA 2EE8A 2YTGA 2EOHA 4F6NA 2ENCA 5KL3A 2EL4A 2GHFA 2EN3A 2YTPA 2EMZA 2EMFA 2JP9A 2EPXA 2EOOA 1JK2A 2MKNA 2EMHA 2A25A 1X6FA 1F2IG 2EOFA 2M9AA 3M99B 2NABA 1TF6A 2GLIA 1ZR9A 5KL5A 2DLKA 1JK1A 2LCEA 2EM3A 5KL6A 1X6EA 5KL4A 2EORA 2LVHA 2EN4A 2LV2A 2YRMA 3MHHC 2EN6A 2WCC3 2BB8A 2EMLA 3VHTB 5KL2A 2EM4A 2HGHA 2EPPA 2RSIA 2EL6A 2EL5A 2EM7A 2EM9A 2EP3A 2MKDA 2JPAA 4FK5C 1TF3A 2EMIA 2EM5A 2YTFA 2E72A 1X3CA 2ENAA 2EM8A 4X9JA 1ZU1A 2EOJA 2EOIA 2WBTA 2EMKA 4R2RA 1YSAC 1WJPA 2YU8A 2DLQA 2WBUA 4R2SA 3EPLA 1X6HA 2DGCA 2EQ0A 2EN8A 4R2DA 2EPZA 5KL7A 1Z1BA 2ELZA 2YSOA 1AAYA 1ZAAC 2R1FA 2YSPA 2YU5A 3EPHA 4F6MA 2EOMA 2EQ3A 2DMIA 2EM0A 4IJDA 1G2FC 2EMBA 2YRKA 2YTOA 2YTDA 3EPJA 2EM6A 1X5WA 1B69A 2EPAA 2EOYA 1BBOA 1P47A 3UK3C 1LLMC 2LO3A 3EPKA 1NCSA 3MHSC 2EOSA 2YRHA 2CSHA 2EMYA 1A1KA 2EMCA 1A1GA 2D9HA 1A1FA 2ELYA 2DRPA 2EPRA 1DGCA 2EN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UN6 B;  2EOQ A;  2I13 A;  1UBD C;  2MDG A;  2YTQ A;  4F2J C;  4R2C A;  2EQ1 A;  1G2D C;  1BB8 A;  2RPC A;  2YTN A;  2WBS A;  4GZN C;  1KJK A;  2PRT A;  1A1I A;  1YUJ A;  2EPC A;  2EMA A;  2LT7 A;  1MEY C;  1A1H A;  4R2A A;  2EOX A;  2YTI A;  1A1J A;  4R2E A;  2EMX A;  2EPU A;  1RMD A;  2VRD A;  2EN1 A;  4WSG A;  1YUI A;  2EN2 A;  2ADR A;  2EOZ A;  2EM2 A;  2EMW A;  4IS1 C;  2YTE A;  1A1L A;  2EJ4 A;  4R2P A;  2J7J A;  1TN9 A;  2EMG A;  4M9V C;  2EOE A;  2CT1 A;  2ENH A;  2CTD A;  2YTJ A;  4R2Q A;  2EE8 A;  2YTG A;  2EOH A;  4F6N A;  2ENC A;  5KL3 A;  2EL4 A;  2GHF A;  2EN3 A;  2YTP A;  2EMZ A;  2EMF A;  2JP9 A;  2EPX A;  2EOO A;  1JK2 A;  2MKN A;  2EMH A;  2A25 A;  1X6F A;  1F2I G;  2EOF A;  2M9A A;  3M99 B;  2NAB A;  1TF6 A;  2GLI A;  1ZR9 A;  5KL5 A;  2DLK A;  1JK1 A;  2LCE A;  2EM3 A;  5KL6 A;  1X6E A;  5KL4 A;  2EOR A;  2LVH A;  2EN4 A;  2LV2 A;  2YRM A;  3MHH C;  2EN6 A;  2WCC 3;  2BB8 A;  2EML A;  3VHT B;  5KL2 A;  2EM4 A;  2HGH A;  2EPP A;  2RSI A;  2EL6 A;  2EL5 A;  2EM7 A;  2EM9 A;  2EP3 A;  2MKD A;  2JPA A;  4FK5 C;  1TF3 A;  2EMI A;  2EM5 A;  2YTF A;  2E72 A;  1X3C A;  2ENA A;  2EM8 A;  4X9J A;  1ZU1 A;  2EOJ A;  2EOI A;  2WBT A;  2EMK A;  4R2R A;  1YSA C;  1WJP A;  2YU8 A;  2DLQ A;  2WBU A;  4R2S A;  3EPL A;  1X6H A;  2DGC A;  2EQ0 A;  2EN8 A;  4R2D A;  2EPZ A;  5KL7 A;  1Z1B A;  2ELZ A;  2YSO A;  1AAY A;  1ZAA C;  2R1F A;  2YSP A;  2YU5 A;  3EPH A;  4F6M A;  2EOM A;  2EQ3 A;  2DMI A;  2EM0 A;  4IJD A;  1G2F C;  2EMB A;  2YRK A;  2YTO A;  2YTD A;  3EPJ A;  2EM6 A;  1X5W A;  1B69 A;  2EPA A;  2EOY A;  1BBO A;  1P47 A;  3UK3 C;  1LLM C;  2LO3 A;  3EPK A;  1NCS A;  3MHS C;  2EOS A;  2YRH A;  2CSH A;  2EMY A;  1A1K A;  2EMC A;  1A1G A;  2D9H A;  1A1F A;  2ELY A;  2DRP A;  2EPR A;  1DGC A;  2EN7 A; 
#chains in the Genus database with same CATH topology
 5LL6 R;  4HTG A;  1YZ9 A;  2EOQ A;  3DF6 A;  3QG5 C;  2B3T B;  4DV0 E;  3AV0 A;  1YYW A;  2NUF A;  4ZYE A;  1BB8 A;  1N32 E;  2L3C A;  2V83 A;  2YTN A;  2WBS A;  1A1I A;  1HNX E;  2EMA A;  1A1H A;  4LF5 E;  2EOX A;  3C6M A;  2LUP B;  2YTI A;  5LMU E;  4KZS A;  2EMX A;  2EPU A;  4Q35 B;  1GQE A;  4HEI A;  4WFT A;  1UIL A;  4WSG A;  1PKP A;  2MC6 A;  4ZYH A;  1N34 E;  2EN2 A;  2ADR A;  2KON A;  2J7J A;  4TUI A;  2F4V E;  2EOE A;  2CTD A;  1PJT A;  2FTX B;  4F6N A;  3MSW A;  4LF9 E;  1IMU A;  2YTP A;  2EMZ A;  4LF8 E;  2EMF A;  2JP9 A;  2EPX A;  4X65 E;  2MKN A;  4B3S E;  3HXL A;  4R03 A;  3ADG A;  2A25 A;  1F2I G;  2DSY A;  3HPZ A;  2LE2 A;  4J8Z A;  2LUQ A;  2FGG A;  2M4I A;  5AE3 A;  4LFC E;  2EN4 A;  5KL2 A;  2EM4 A;  5ADZ A;  2E1M A;  2EPP A;  2RSI A;  2EL5 A;  4LF6 E;  1WRJ A;  2EP3 A;  2JPA A;  2UUC E;  2JR1 A;  2VQF E;  2L33 A;  2EM8 A;  1ZU1 A;  2WBT A;  4WYQ B;  2B7T A;  4LTY A;  1EH7 A;  2UXD E;  2WZO A;  1WJP A;  4GEQ B;  3TQM A;  4P78 A;  1AH5 A;  4R2S A;  2CPN A;  2LRS A;  4B3R E;  2ELZ A;  1X48 A;  2R1F A;  2YU5 A;  2EOM A;  5AC5 A;  2EQ3 A;  5A69 A;  4ZYD A;  2VQE E;  4IJD A;  4R8O A;  1G2F C;  2HJJ A;  1DI2 A;  2L6M A;  4JI1 E;  3P1X A;  4KWY A;  4RHB B;  3THO B;  4DR6 E;  2JOB A;  2EMY A;  2F8B A;  1XMQ E;  2D9H A;  4MLQ A;  2EPR A;  1DGC A;  2HHH E;  2ODR C;  2NA2 A;  2I13 A;  2MDG A;  1XMO E;  4R2C A;  4P7D A;  2B7V A;  2RS6 A;  3C6K A;  1G2D C;  4GZN C;  1YUJ A;  2RS7 A;  3ZOQ B;  4BHB A;  1YYK A;  2V85 A;  2JY9 A;  2N8X A;  3KZZ A;  5CFF E;  4WXC A;  2Q8U A;  2EN1 A;  1YUI A;  2EM2 A;  2EOZ A;  2UUA E;  4OOG C;  2YTE A;  2DIX A;  2N3G A;  1TN9 A;  1WHN A;  2H36 X;  1T39 A;  3L00 A;  2YTJ A;  3OML A;  4F54 A;  3H09 A;  2YT4 A;  5IV8 B;  3T1Y E;  2L2M A;  2RQL A;  5A2Q C;  1T4O A;  4X8W A;  1J5E E;  4JI5 E;  2EOO A;  4LFA E;  1T4N A;  3KWR A;  2NUG A;  4X66 E;  1TF6 A;  2GLI A;  1ZR9 A;  5KL5 A;  2LCE A;  4F9C B;  4JI7 E;  2EOR A;  2LVH A;  2DB2 A;  4YHH E;  2YRM A;  4BC7 A;  5A6A A;  4M0V A;  4KHP E;  2WCC 3;  3VK6 A;  2EPL X;  1IBL E;  2EL6 A;  1ZBT A;  2EM7 A;  2EM9 A;  4MLV A;  2GPI A;  3ECR A;  2IHR 1;  4FK5 C;  3C4B A;  2EMI A;  2EM5 A;  2E72 A;  1X3C A;  3JTZ A;  2EZ6 A;  2ENA A;  2R76 A;  2K4V A;  1EKZ A;  5FLX C;  1EH6 A;  5LLQ A;  2LBS B;  3HTX A;  2HC5 A;  4NZV A;  4LF7 E;  1YSA C;  1UHZ A;  3EPL A;  1X6H A;  1N33 E;  1BBG A;  2EQ0 A;  1I94 E;  2EPZ A;  2MC5 A;  3RMP A;  1AAY A;  3EPH A;  2YSP A;  2BBG A;  4GKK E;  3LLH A;  2DMI A;  2EMB A;  2YRK A;  3VYX A;  2KHX A;  3BID A;  2G7H A;  1IQO A;  2YTD A;  3EPJ A;  2UXB E;  1X5W A;  1YPN A;  4TUG A;  2EPA A;  1B69 A;  1HR0 E;  4JV5 E;  1BBO A;  3UK3 C;  2LJU A;  4JI6 E;  5A6B D;  1QU6 A;  4DR7 E;  3THN A;  1NCS A;  2EOS A;  4BBY A;  4DUY E;  4M2Z A;  2YRH A;  2CSH A;  2EMC A;  5A6B A;  3J7Y p;  1N3G A;  4F6M A;  3BF2 A;  1UN6 B;  1PJS A;  2LMZ A;  4WSP A;  1UBD C;  4RH8 A;  4F2J C;  2RPC A;  4F9B B;  3C4T A;  3J7A G;  2PRT A;  2UU9 E;  3ADI A;  5AE1 A;  2M7Q A;  2ZM6 E;  4L5N C;  1WHQ A;  2LT7 A;  4DUZ E;  4B3M E;  1A1J A;  5IWA E;  4JYA E;  4DR3 E;  4LF4 E;  2VRD A;  4LU9 A;  1SR9 A;  2EWL A;  3KZY A;  2EMW A;  4NHR A;  1WXR A;  1FJG E;  4M9V C;  4X62 E;  4DV5 E;  2CT1 A;  2V89 A;  2YTG A;  4BS9 A;  2EOH A;  1GZ6 A;  2ENC A;  5KL3 A;  2EL4 A;  2GHF A;  1IQS A;  3EQ1 A;  1ZBQ A;  4GKJ E;  4DV6 E;  4O4K A;  4M30 A;  2DMY A;  4N4R B;  1JK2 A;  2FV4 B;  5IT9 C;  1O0W A;  4JI0 E;  4LFB E;  2LTS A;  4WX9 A;  2L8T A;  4O43 A;  1X6F A;  2M9A A;  3M99 B;  2NAB A;  2YZT A;  5AC4 A;  4DMI A;  2JVA A;  2L2K B;  2EM3 A;  1X6E A;  5LMN E;  2LV2 A;  4YY3 E;  2EN6 A;  4JI8 E;  3VHT B;  2EML A;  3DJW A;  5AAS A;  2K7I A;  2L92 A;  3FIG A;  1J26 A;  2JXP A;  2MDR A;  3JU0 A;  2ODR D;  1XNR E;  3ADL A;  2UXC E;  1X47 A;  3BGH A;  4X64 E;  2V86 A;  4BCA A;  4X9J A;  4DR1 E;  1N36 E;  2EOJ A;  2EOI A;  3T1H E;  4DV3 E;  3IWD A;  3F6G A;  2EMK A;  4R2R A;  2YU8 A;  2WBU A;  2EPO A;  2DGC A;  1GTK A;  4R2D A;  4DKK A;  1QNT A;  2EPN A;  2B9D A;  5KL7 A;  2YSO A;  2EM0 A;  4Q28 A;  5T6J A;  2YTO A;  2EM6 A;  2EOY A;  1P47 A;  1PDA A;  1SFE A;  1LLM C;  2LO3 A;  1NEI A;  3EPK A;  4NXN E;  5TSE A;  2M1S A;  1A1K A;  1A1G A;  1IBK E;  2EN7 A;  5DNY A;  3OTO E;  2YTQ A;  2EPM X;  4F9A B;  2EQ1 A;  2JWO A;  1KJK A;  2EPC A;  5AE2 A;  5A6J A;  1MEY C;  4I8O A;  4R2A A;  4R2E A;  1PJQ A;  4AQY E;  1RMD A;  3IWB A;  1X49 A;  4DV1 E;  1A1L A;  3AUZ A;  4IS1 C;  2EJ4 A;  4R2P A;  1HNZ E;  2EMG A;  4DV4 E;  2ENH A;  4R2Q A;  2EE8 A;  4JI2 E;  2V88 A;  3J81 C;  4DR2 E;  1L4S A;  2V87 A;  2EN3 A;  4JI4 E;  4L8N A;  1YYO A;  2V8Q B;  2EMH A;  2YPN A;  3LML A;  2RTX A;  2EOF A;  3F6H A;  1KYQ A;  2VE7 C;  2DLK A;  1JK1 A;  3BBG A;  5KL6 A;  5KL4 A;  4K0K E;  1T4L B;  3HQ1 A;  1XNQ E;  3MHH C;  2RSM A;  2HGH A;  2BB8 A;  5F3W A;  3ADJ A;  4ZYG A;  5A6K A;  2UUB E;  3K6Q A;  2MKD A;  4DR4 E;  1T38 A;  3IWC A;  3VYY A;  1TF3 A;  4DV2 E;  2YTF A;  2E5L E;  2L2N A;  1FKA E;  4O5G A;  1IBM E;  1RC7 A;  4B3T E;  2N3H A;  4O24 A;  3J80 C;  2DLQ A;  1EH8 A;  4BHC A;  2YWQ A;  1MGT A;  2EN8 A;  5IXM B;  1DQ3 A;  2JYA A;  2LJH A;  1Z1B A;  1ZAA C;  4NXM E;  2JOX A;  4DR5 E;  1YFH A;  3HPS A;  2NUE A;  3JAM C;  2VF1 A;  1HNW E;  4DV7 E;  2EPK X;  4BMJ A;  2LTR A;  4WPY A;  4OX9 E;  5BR8 E;  4WXD A;  2L3J A;  1STU A;  3MHS C;  2KOU A;  1RQ0 A;  4BC9 A;  1A1F A;  2DRP A;  4JI3 E;  2ELY A;  2I9I A; 
#chains in the Genus database with same CATH homology
 1UN6 B;  2EOQ A;  2I13 A;  1UBD C;  2MDG A;  2YTQ A;  4F2J C;  4R2C A;  2EQ1 A;  1G2D C;  1BB8 A;  2RPC A;  2YTN A;  2WBS A;  4GZN C;  1KJK A;  2PRT A;  1A1I A;  1YUJ A;  2EPC A;  2EMA A;  2LT7 A;  1MEY C;  1A1H A;  4R2A A;  2EOX A;  2YTI A;  1A1J A;  4R2E A;  2EMX A;  2EPU A;  1RMD A;  2VRD A;  2EN1 A;  4WSG A;  1YUI A;  2EN2 A;  2ADR A;  2EOZ A;  2EM2 A;  2EMW A;  4IS1 C;  2YTE A;  1A1L A;  2EJ4 A;  4R2P A;  2J7J A;  1TN9 A;  2EMG A;  4M9V C;  2EOE A;  2CT1 A;  2ENH A;  2CTD A;  2YTJ A;  4R2Q A;  2EE8 A;  2YTG A;  2EOH A;  4F6N A;  2ENC A;  5KL3 A;  2EL4 A;  2GHF A;  2EN3 A;  2YTP A;  2EMZ A;  2EMF A;  2JP9 A;  2EPX A;  2EOO A;  1JK2 A;  2MKN A;  2EMH A;  2A25 A;  1X6F A;  1F2I G;  2EOF A;  2M9A A;  3M99 B;  2NAB A;  1TF6 A;  2GLI A;  1ZR9 A;  5KL5 A;  2DLK A;  1JK1 A;  2LCE A;  2EM3 A;  5KL6 A;  1X6E A;  5KL4 A;  2EOR A;  2LVH A;  2EN4 A;  2LV2 A;  2YRM A;  3MHH C;  2EN6 A;  2WCC 3;  2BB8 A;  2EML A;  3VHT B;  5KL2 A;  2EM4 A;  2HGH A;  2EPP A;  2RSI A;  2EL6 A;  2EL5 A;  2EM7 A;  2EM9 A;  2EP3 A;  2MKD A;  2JPA A;  4FK5 C;  1TF3 A;  2EMI A;  2EM5 A;  2YTF A;  2E72 A;  1X3C A;  2ENA A;  2EM8 A;  4X9J A;  1ZU1 A;  2EOJ A;  2EOI A;  2WBT A;  2EMK A;  4R2R A;  1YSA C;  1WJP A;  2YU8 A;  2DLQ A;  2WBU A;  4R2S A;  3EPL A;  1X6H A;  2DGC A;  2EQ0 A;  2EN8 A;  4R2D A;  2EPZ A;  5KL7 A;  1Z1B A;  2ELZ A;  2YSO A;  1AAY A;  1ZAA C;  2R1F A;  2YSP A;  2YU5 A;  3EPH A;  4F6M A;  2EOM A;  2EQ3 A;  2DMI A;  2EM0 A;  4IJD A;  1G2F C;  2EMB A;  2YRK A;  2YTO A;  2YTD A;  3EPJ A;  2EM6 A;  1X5W A;  1B69 A;  2EPA A;  2EOY A;  1BBO A;  1P47 A;  3UK3 C;  1LLM C;  2LO3 A;  3EPK A;  1NCS A;  3MHS C;  2EOS A;  2YRH A;  2CSH A;  2EMY A;  1A1K A;  2EMC A;  1A1G A;  2D9H A;  1A1F A;  2ELY A;  2DRP A;  2EPR A;  1DGC A;  2EN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...