2EMGA

Solution structure of the c2h2 type zinc finger (region 463-495) of human zinc finger protein 484
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
b'GSSGSSGTGENPFICSECGKVFTHKTNLIIHQKIHTGERPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 484
publication title Solution structure of the C2H2 type zinc finger (region 463-495) of human Zinc finger protein 484
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emgA01
2EL6A 1UN6B 4F6NA 1KJKA 2EMBA 2EMWA 2EORA 2EM9A 2EOSA 2WBTA 3M99B 3MHSC 2YTNA 4R2EA 4R2QA 2D9HA 3EPLA 1F2IG 2HGHA 4FK5C 1A1KA 2NABA 2EMGA 2LVHA 2CT1A 4GZNC 2EPCA 2EPAA 2JPAA 2EMFA 2EOIA 2EPRA 1ZU1A 2EQ0A 1X3CA 2EP3A 1A1FA 2YTFA 2GLIA 2EQ1A 1MEYC 2ENAA 2CSHA 2EOXA 2EM2A 4IS1C 1G2DC 2EOZA 2EJ4A 2EM4A 2EN2A 2EN3A 2EMAA 4F2JC 2MKNA 1BBOA 2LCEA 3MHHC 2R1FA 2YRMA 2EM3A 1TN9A 2ADRA 1TF6A 2DLKA 2EN1A 4R2SA 2RSIA 1X6HA 2EM5A 1B69A 2EOHA 2LV2A 2EN4A 4M9VC 1WJPA 2YRHA 5KL4A 1YSAC 2EL5A 2EN8A 2DMIA 2ENCA 1RMDA 1G2FC 2E72A 5KL2A 4R2DA 2WBUA 2EM7A 1ZR9A 2YTDA 2DRPA 4WSGA 2EPXA 3EPJA 2YTEA 2M9AA 2YRKA 2EM8A 2MDGA 2YTOA 1JK2A 2GHFA 2YTGA 1A1JA 2EPZA 2EOQA 2EPUA 2I13A 2EM6A 1AAYA 2ELYA 2EOEA 4R2PA 2EOFA 1Z1BA 5KL5A 2EMHA 3EPKA 2PRTA 2YTPA 1JK1A 2YU8A 2EN6A 2EMZA 1DGCA 2BB8A 1NCSA 1A1IA 2EE8A 2EMIA 2YTQA 1UBDC 2EMXA 2YSPA 2EM0A 2ELZA 2EOJA 1X6FA 2EQ3A 1X6EA 2VRDA 1A1GA 2LT7A 2EOOA 1TF3A 1A1HA 2EMYA 2RPCA 4X9JA 2YTIA 1ZAAC 2J7JA 1YUIA 2YSOA 2WBSA 1BB8A 2EMCA 4IJDA 2ENHA 2YTJA 2EPPA 2A25A 5KL7A 4R2RA 2CTDA 5KL6A 3EPHA 2EMLA 3UK3C 2LO3A 1YUJA 1LLMC 4R2CA 2EN7A 2JP9A 1X5WA 1P47A 2EOYA 1A1LA 5KL3A 2WCC3 2DLQA 4R2AA 2EMKA 2MKDA 2YU5A 3VHTB 2EL4A 2DGCA 2EOMA 4F6MA
chains in the Genus database with same CATH superfamily
2B7TA 5IXMB 1ZBQA 4JI1E 2VQFE 2EMBA 1YZ9A 2EORA 2EM9A 2YT4A 4BBYA 5A6BD 2UXCE 2HC5A 2YPNA 2CPNA 1AH5A 4GZNC 3BBGA 3AUZA 1IQSA 2N3GA 5DNYA 5IT9C 2FGGA 2EP3A 2L3JA 2YTFA 1X47A 4LF4E 2V85A 1T4NA 2ENAA 1N36E 1QU6A 4BC9A 4DR1E 2GPIA 5LLQA 2JYAA 2JWOA 2B7VA 2EN1A 4R2SA 2NUEA 4LF5E 4DKKA 4DV0E 3BF2A 1GQEA 2F8BA 4BHCA 5KL2A 4BMJA 4AQYE 1G2FC 4JI0E 1EH7A 4WSGA 2YTEA 2EM8A 4DV2E 2YTOA 1JK2A 2YTGA 2EPUA 2EM6A 1AAYA 5KL5A 5AE3A 4L5NC 4X64E 2EN6A 2EMZA 3HPZA 5AC5A 3T1HE 4JYAE 2K4VA 5IWAE 4DR4E 3IWDA 1RC7A 3ADLA 1X6FA 3JU0A 4M0VA 2LT7A 3J80C 4BS9A 1TF3A 1WHNA 4LF7E 4X9JA 2YTIA 2LUPB 4LTYA 1YUIA 4O4KA 4YY3E 1T4OA 5A6BA 3C6MA 2HJJA 2EMCA 1T39A 3ADGA 4KZSA 4R2RA 4JV5E 4X66E 5KL6A 4O24A 5AE1A 2LO3A 2UUAE 2MC5A 4OOGC 3IWCA 4JI2E 2DLQA 3HPSA 2L92A 4KHPE 4NZVA 5IV8B 3EPLA 2MC6A 3OMLA 2RQLA 4DR7E 4M2ZA 4F6NA 3ZOQB 2EMWA 2V87A 4O43A 3M99B 4R2EA 4HTGA 4R2QA 2L2KB 2D9HA 4F9BB 4NXNE 4R8OA 4WYQB 2NABA 1T38A 3H09A 2EMGA 2FV4B 2JXPA 2EMFA 2EOIA 2M4IA 1ZU1A 2VF1A 3DJWA 1X3CA 1IMUA 2K7IA 2LRSA 2VQEE 2DB2A 1MEYC 4JI7E 5TSEA 2EOXA 4HEIA 1N33E 1J26A 2EPNA 4IS1C 1BBOA 2EJ4A 2EN2A 2EN3A 2EMAA 2LCEA 1FKAE 4WSPA 2DLKA 4GKJE 1B69A 2EOHA 2M1SA 2LV2A 2EN4A 2YRHA 4R2DA 4OX9E 2YTDA 2DRPA 2EPXA 3EPJA 2L33A 2ZM6E 2M9AA 2YRKA 2MDGA 5A69A 1YYOA 3KZYA 3LMLA 2B9DA 3L00A 2LMZA 2LJUA 2EOEA 3C4BA 4WXDA 2PRTA 2Q8UA 3FIGA 2UUCE 1UILA 4DV1E 2ODRC 3KZZA 2YTQA 2EOJA 2G7HA 1HR0E 1N34E 5AE2A 2DIXA 1DQ3A 3DF6A 1A1HA 2I9IA 3VYXA 2DMYA 5LL6R 3TQMA 4DV3E 2YSOA 3MSWA 2WBSA 2EPLX 3QG5C 2N3HA 1PKPA 2CTDA 2V88A 4ZYGA 3UK3C 2E5LE 1LLMC 4X62E 2EN7A 3RMPA 1X5WA 1HNZE 1L4SA 2WCC3 4O5GA 2YU5A 3VHTB 2EL4A 3ECRA 2EL6A 3J7AG 3J7Yp 1UN6B 3IWBA 1XNQE 3THNA 1KJKA 2EOSA 2YTNA 2LBSB 1IBLE 1F2IG 1IBME 2NUFA 1UHZA 1X49A 2UXDE 2LVHA 2CT1A 2M7QA 2ODRD 2EPAA 2LTRA 4Q35B 1FJGE 4BCAA 1A1FA 5ADZA 3BIDA 2WZOA 3F6HA 2LJHA 2EQ1A 5A6AA 4DUYE 2YZTA 1G2DC 1N3GA 2EOZA 2MKNA 4DV7E 4DMIA 3MHHC 4JI5E 1RQ0A 4JI6E 2MDRA 2R1FA 2YRMA 1SR9A 2EM3A 2LE2A 4L8NA 2RSIA 4TUIA 2L3CA 4M9VC 1WJPA 2KONA 4MLVA 1T4LB 5KL4A 1IBKE 2UUBE 3KWRA 2EL5A 2EN8A 4NHRA 2DMIA 1RMDA 1ZBTA 1GTKA 4JI4E 2L2NA 2L2MA 4X65E 1WRJA 3HQ1A 2GHFA 1A1JA 4DUZE 3HXLA 2EOQA 2ELYA 2B3TB 2L6MA 3ADJA 3C6KA 3THOB 1I94E 2YTPA 4MLQA 1EH6A 1STUA 1DGCA 4DR2E 5A6JA 4K0KE 1J5EE 2YWQA 2BB8A 4KWYA 2EE8A 4M30A 1PJQA 5A2QC 2EMXA 1HNXE 1HNWE 2ELZA 1O0WA 2FTXB 2EQ3A 2V86A 1X6EA 2VRDA 2LUQA 1A1GA 4GEQB 2EOOA 2EMYA 3F6GA 1ZAAC 3P1XA 1X48A 2E1MA 4P7DA 3J81C 4DR6E 5KL7A 4BC7A 3C4TA 3EPHA 1PJTA 2EMLA 2KHXA 4JI3E 2V89A 2RSMA 2V8QB 2EPOA 4LU9A 3LLHA 1YFHA 5KL3A 4TUGA 4F9AB 4R2AA 2V83A 4WX9A 2JR1A 2DGCA 4F6MA 3T1YE 2F4VE 1XMOE 2RS6A 2UXBE 4Q28A 2IHR1 4ZYEA 5F3WA 2WBTA 2EZ6A 2H36X 3MHSC 4P78A 2EOMA 4RH8A 4X8WA 1XNRE 4B3ME 1SFEA 1DI2A 4JI8E 2HGHA 4FK5C 4N4RB 1A1KA 2NUGA 4RHBB 2EPCA 2LTSA 2JPAA 2EPRA 2EQ0A 1GZ6A 1YYKA 4LF6E 3ADIA 2GLIA 1KYQA 4WPYA 4ZYDA 3JAMC 1IQOA 2UU9E 2EPMX 2RTXA 1YYWA 2CSHA 1MGTA 2JVAA 5LMUE 2EM2A 5LMNE 2EM4A 4F2JC 1QNTA 2RS7A 1NEIA 5AC4A 5A6KA 3EQ1A 2ADRA 4ZYHA 4DV4E 1TF6A 1TN9A 4R03A 1X6HA 2EM5A 3VK6A 1N32E 3AV0A 1WHQA 1YSAC 4LFAE 2ENCA 2BBGA 2E72A 1EH8A 5CFFE 2WBUA 1BBGA 2EM7A 1ZR9A 5AASA 4BHBA 4LFBE 2EPKX 4NXME 2EPZA 2VE7C 2I13A 2NA2A 4R2PA 2EOFA 1Z1BA 2JOBA 2EMHA 3EPKA 4LF9E 1JK1A 3VYYA 2YU8A 2HHHE 4LFCE 4DR3E 4LF8E 4GKKE 1NCSA 1A1IA 1PJSA 2EMIA 2EWLA 1UBDC 2YSPA 2EM0A 3HTXA 1PDAA 4F9CB 3OTOE 3K6QA 1YPNA 2R76A 4I8OA 1EKZA 2RPCA 4B3TE 2J7JA 4WXCA 1XMQE 4B3RE 1BB8A 2DSYA 3BGHA 4IJDA 2ENHA 2YTJA 2EPPA 3JTZA 2A25A 4WFTA 4DV5E 4YHHE 1YUJA 2L8TA 2N8XA 1WXRA 5T6JA 4R2CA 2KOUA 2JP9A 1P47A 4F54A 2EOYA 5FLXC 1A1LA 4B3SE 2EMKA 2JY9A 2MKDA 5BR8E 2JOXA 4J8ZA 4DV6E 4DR5E
chains in the Genus database with same CATH topology
2EL6A 1UN6B 4F6NA 1KJKA 2EMBA 2EMWA 2EORA 2EM9A 2EOSA 2WBTA 3M99B 3MHSC 2YTNA 4R2EA 4R2QA 2D9HA 3EPLA 1F2IG 2HGHA 4FK5C 1A1KA 2NABA 2EMGA 2LVHA 2CT1A 4GZNC 2EPCA 2EPAA 2JPAA 2EMFA 2EOIA 2EPRA 1ZU1A 2EQ0A 1X3CA 2EP3A 1A1FA 2YTFA 2GLIA 2EQ1A 1MEYC 2ENAA 2CSHA 2EOXA 2EM2A 4IS1C 1G2DC 2EOZA 2EJ4A 2EM4A 2EN2A 2EN3A 2EMAA 4F2JC 2MKNA 1BBOA 2LCEA 3MHHC 2R1FA 2YRMA 2EM3A 1TN9A 2ADRA 1TF6A 2DLKA 2EN1A 4R2SA 2RSIA 1X6HA 2EM5A 1B69A 2EOHA 2LV2A 2EN4A 4M9VC 1WJPA 2YRHA 5KL4A 1YSAC 2EL5A 2EN8A 2DMIA 2ENCA 1RMDA 1G2FC 2E72A 5KL2A 4R2DA 2WBUA 2EM7A 1ZR9A 2YTDA 2DRPA 4WSGA 2EPXA 3EPJA 2YTEA 2M9AA 2YRKA 2EM8A 2MDGA 2YTOA 1JK2A 2GHFA 2YTGA 1A1JA 2EPZA 2EOQA 2EPUA 2I13A 2EM6A 1AAYA 2ELYA 2EOEA 4R2PA 2EOFA 1Z1BA 5KL5A 2EMHA 3EPKA 2PRTA 2YTPA 1JK1A 2YU8A 2EN6A 2EMZA 1DGCA 2BB8A 1NCSA 1A1IA 2EE8A 2EMIA 2YTQA 1UBDC 2EMXA 2YSPA 2EM0A 2ELZA 2EOJA 1X6FA 2EQ3A 1X6EA 2VRDA 1A1GA 2LT7A 2EOOA 1TF3A 1A1HA 2EMYA 2RPCA 4X9JA 2YTIA 1ZAAC 2J7JA 1YUIA 2YSOA 2WBSA 1BB8A 2EMCA 4IJDA 2ENHA 2YTJA 2EPPA 2A25A 5KL7A 4R2RA 2CTDA 5KL6A 3EPHA 2EMLA 3UK3C 2LO3A 1YUJA 1LLMC 4R2CA 2EN7A 2JP9A 1X5WA 1P47A 2EOYA 1A1LA 5KL3A 2WCC3 2DLQA 4R2AA 2EMKA 2MKDA 2YU5A 3VHTB 2EL4A 2DGCA 2EOMA 4F6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EL6 A;  1UN6 B;  4F6N A;  1KJK A;  2EMB A;  2EMW A;  2EOR A;  2EM9 A;  2EOS A;  2WBT A;  3M99 B;  3MHS C;  2YTN A;  4R2E A;  4R2Q A;  2D9H A;  3EPL A;  1F2I G;  2HGH A;  4FK5 C;  1A1K A;  2NAB A;  2EMG A;  2LVH A;  2CT1 A;  4GZN C;  2EPC A;  2EPA A;  2JPA A;  2EMF A;  2EOI A;  2EPR A;  1ZU1 A;  2EQ0 A;  1X3C A;  2EP3 A;  1A1F A;  2YTF A;  2GLI A;  2EQ1 A;  1MEY C;  2ENA A;  2CSH A;  2EOX A;  2EM2 A;  4IS1 C;  1G2D C;  2EOZ A;  2EJ4 A;  2EM4 A;  2EN2 A;  2EN3 A;  2EMA A;  4F2J C;  2MKN A;  1BBO A;  2LCE A;  3MHH C;  2R1F A;  2YRM A;  2EM3 A;  1TN9 A;  2ADR A;  1TF6 A;  2DLK A;  2EN1 A;  4R2S A;  2RSI A;  1X6H A;  2EM5 A;  1B69 A;  2EOH A;  2LV2 A;  2EN4 A;  4M9V C;  1WJP A;  2YRH A;  5KL4 A;  1YSA C;  2EL5 A;  2EN8 A;  2DMI A;  2ENC A;  1RMD A;  1G2F C;  2E72 A;  5KL2 A;  4R2D A;  2WBU A;  2EM7 A;  1ZR9 A;  2YTD A;  2DRP A;  4WSG A;  2EPX A;  3EPJ A;  2YTE A;  2M9A A;  2YRK A;  2EM8 A;  2MDG A;  2YTO A;  1JK2 A;  2GHF A;  2YTG A;  1A1J A;  2EPZ A;  2EOQ A;  2EPU A;  2I13 A;  2EM6 A;  1AAY A;  2ELY A;  2EOE A;  4R2P A;  2EOF A;  1Z1B A;  5KL5 A;  2EMH A;  3EPK A;  2PRT A;  2YTP A;  1JK1 A;  2YU8 A;  2EN6 A;  2EMZ A;  1DGC A;  2BB8 A;  1NCS A;  1A1I A;  2EE8 A;  2EMI A;  2YTQ A;  1UBD C;  2EMX A;  2YSP A;  2EM0 A;  2ELZ A;  2EOJ A;  1X6F A;  2EQ3 A;  1X6E A;  2VRD A;  1A1G A;  2LT7 A;  2EOO A;  1TF3 A;  1A1H A;  2EMY A;  2RPC A;  4X9J A;  2YTI A;  1ZAA C;  2J7J A;  1YUI A;  2YSO A;  2WBS A;  1BB8 A;  2EMC A;  4IJD A;  2ENH A;  2YTJ A;  2EPP A;  2A25 A;  5KL7 A;  4R2R A;  2CTD A;  5KL6 A;  3EPH A;  2EML A;  3UK3 C;  2LO3 A;  1YUJ A;  1LLM C;  4R2C A;  2EN7 A;  2JP9 A;  1X5W A;  1P47 A;  2EOY A;  1A1L A;  5KL3 A;  2WCC 3;  2DLQ A;  4R2A A;  2EMK A;  2MKD A;  2YU5 A;  3VHT B;  2EL4 A;  2DGC A;  2EOM A;  4F6M A; 
#chains in the Genus database with same CATH topology
 2B7T A;  5IXM B;  1ZBQ A;  4JI1 E;  2VQF E;  2EMB A;  1YZ9 A;  2EOR A;  2EM9 A;  2YT4 A;  4BBY A;  5A6B D;  2UXC E;  2HC5 A;  2YPN A;  2CPN A;  1AH5 A;  4GZN C;  3BBG A;  3AUZ A;  1IQS A;  2N3G A;  5DNY A;  5IT9 C;  2FGG A;  2EP3 A;  2L3J A;  2YTF A;  1X47 A;  4LF4 E;  2V85 A;  1T4N A;  2ENA A;  1N36 E;  1QU6 A;  4BC9 A;  4DR1 E;  2GPI A;  5LLQ A;  2JYA A;  2JWO A;  2B7V A;  2EN1 A;  4R2S A;  2NUE A;  4LF5 E;  4DKK A;  4DV0 E;  3BF2 A;  1GQE A;  2F8B A;  4BHC A;  5KL2 A;  4BMJ A;  4AQY E;  1G2F C;  4JI0 E;  1EH7 A;  4WSG A;  2YTE A;  2EM8 A;  4DV2 E;  2YTO A;  1JK2 A;  2YTG A;  2EPU A;  2EM6 A;  1AAY A;  5KL5 A;  5AE3 A;  4L5N C;  4X64 E;  2EN6 A;  2EMZ A;  3HPZ A;  5AC5 A;  3T1H E;  4JYA E;  2K4V A;  5IWA E;  4DR4 E;  3IWD A;  1RC7 A;  3ADL A;  1X6F A;  3JU0 A;  4M0V A;  2LT7 A;  3J80 C;  4BS9 A;  1TF3 A;  1WHN A;  4LF7 E;  4X9J A;  2YTI A;  2LUP B;  4LTY A;  1YUI A;  4O4K A;  4YY3 E;  1T4O A;  5A6B A;  3C6M A;  2HJJ A;  2EMC A;  1T39 A;  3ADG A;  4KZS A;  4R2R A;  4JV5 E;  4X66 E;  5KL6 A;  4O24 A;  5AE1 A;  2LO3 A;  2UUA E;  2MC5 A;  4OOG C;  3IWC A;  4JI2 E;  2DLQ A;  3HPS A;  2L92 A;  4KHP E;  4NZV A;  5IV8 B;  3EPL A;  2MC6 A;  3OML A;  2RQL A;  4DR7 E;  4M2Z A;  4F6N A;  3ZOQ B;  2EMW A;  2V87 A;  4O43 A;  3M99 B;  4R2E A;  4HTG A;  4R2Q A;  2L2K B;  2D9H A;  4F9B B;  4NXN E;  4R8O A;  4WYQ B;  2NAB A;  1T38 A;  3H09 A;  2EMG A;  2FV4 B;  2JXP A;  2EMF A;  2EOI A;  2M4I A;  1ZU1 A;  2VF1 A;  3DJW A;  1X3C A;  1IMU A;  2K7I A;  2LRS A;  2VQE E;  2DB2 A;  1MEY C;  4JI7 E;  5TSE A;  2EOX A;  4HEI A;  1N33 E;  1J26 A;  2EPN A;  4IS1 C;  1BBO A;  2EJ4 A;  2EN2 A;  2EN3 A;  2EMA A;  2LCE A;  1FKA E;  4WSP A;  2DLK A;  4GKJ E;  1B69 A;  2EOH A;  2M1S A;  2LV2 A;  2EN4 A;  2YRH A;  4R2D A;  4OX9 E;  2YTD A;  2DRP A;  2EPX A;  3EPJ A;  2L33 A;  2ZM6 E;  2M9A A;  2YRK A;  2MDG A;  5A69 A;  1YYO A;  3KZY A;  3LML A;  2B9D A;  3L00 A;  2LMZ A;  2LJU A;  2EOE A;  3C4B A;  4WXD A;  2PRT A;  2Q8U A;  3FIG A;  2UUC E;  1UIL A;  4DV1 E;  2ODR C;  3KZZ A;  2YTQ A;  2EOJ A;  2G7H A;  1HR0 E;  1N34 E;  5AE2 A;  2DIX A;  1DQ3 A;  3DF6 A;  1A1H A;  2I9I A;  3VYX A;  2DMY A;  5LL6 R;  3TQM A;  4DV3 E;  2YSO A;  3MSW A;  2WBS A;  2EPL X;  3QG5 C;  2N3H A;  1PKP A;  2CTD A;  2V88 A;  4ZYG A;  3UK3 C;  2E5L E;  1LLM C;  4X62 E;  2EN7 A;  3RMP A;  1X5W A;  1HNZ E;  1L4S A;  2WCC 3;  4O5G A;  2YU5 A;  3VHT B;  2EL4 A;  3ECR A;  2EL6 A;  3J7A G;  3J7Y p;  1UN6 B;  3IWB A;  1XNQ E;  3THN A;  1KJK A;  2EOS A;  2YTN A;  2LBS B;  1IBL E;  1F2I G;  1IBM E;  2NUF A;  1UHZ A;  1X49 A;  2UXD E;  2LVH A;  2CT1 A;  2M7Q A;  2ODR D;  2EPA A;  2LTR A;  4Q35 B;  1FJG E;  4BCA A;  1A1F A;  5ADZ A;  3BID A;  2WZO A;  3F6H A;  2LJH A;  2EQ1 A;  5A6A A;  4DUY E;  2YZT A;  1G2D C;  1N3G A;  2EOZ A;  2MKN A;  4DV7 E;  4DMI A;  3MHH C;  4JI5 E;  1RQ0 A;  4JI6 E;  2MDR A;  2R1F A;  2YRM A;  1SR9 A;  2EM3 A;  2LE2 A;  4L8N A;  2RSI A;  4TUI A;  2L3C A;  4M9V C;  1WJP A;  2KON A;  4MLV A;  1T4L B;  5KL4 A;  1IBK E;  2UUB E;  3KWR A;  2EL5 A;  2EN8 A;  4NHR A;  2DMI A;  1RMD A;  1ZBT A;  1GTK A;  4JI4 E;  2L2N A;  2L2M A;  4X65 E;  1WRJ A;  3HQ1 A;  2GHF A;  1A1J A;  4DUZ E;  3HXL A;  2EOQ A;  2ELY A;  2B3T B;  2L6M A;  3ADJ A;  3C6K A;  3THO B;  1I94 E;  2YTP A;  4MLQ A;  1EH6 A;  1STU A;  1DGC A;  4DR2 E;  5A6J A;  4K0K E;  1J5E E;  2YWQ A;  2BB8 A;  4KWY A;  2EE8 A;  4M30 A;  1PJQ A;  5A2Q C;  2EMX A;  1HNX E;  1HNW E;  2ELZ A;  1O0W A;  2FTX B;  2EQ3 A;  2V86 A;  1X6E A;  2VRD A;  2LUQ A;  1A1G A;  4GEQ B;  2EOO A;  2EMY A;  3F6G A;  1ZAA C;  3P1X A;  1X48 A;  2E1M A;  4P7D A;  3J81 C;  4DR6 E;  5KL7 A;  4BC7 A;  3C4T A;  3EPH A;  1PJT A;  2EML A;  2KHX A;  4JI3 E;  2V89 A;  2RSM A;  2V8Q B;  2EPO A;  4LU9 A;  3LLH A;  1YFH A;  5KL3 A;  4TUG A;  4F9A B;  4R2A A;  2V83 A;  4WX9 A;  2JR1 A;  2DGC A;  4F6M A;  3T1Y E;  2F4V E;  1XMO E;  2RS6 A;  2UXB E;  4Q28 A;  2IHR 1;  4ZYE A;  5F3W A;  2WBT A;  2EZ6 A;  2H36 X;  3MHS C;  4P78 A;  2EOM A;  4RH8 A;  4X8W A;  1XNR E;  4B3M E;  1SFE A;  1DI2 A;  4JI8 E;  2HGH A;  4FK5 C;  4N4R B;  1A1K A;  2NUG A;  4RHB B;  2EPC A;  2LTS A;  2JPA A;  2EPR A;  2EQ0 A;  1GZ6 A;  1YYK A;  4LF6 E;  3ADI A;  2GLI A;  1KYQ A;  4WPY A;  4ZYD A;  3JAM C;  1IQO A;  2UU9 E;  2EPM X;  2RTX A;  1YYW A;  2CSH A;  1MGT A;  2JVA A;  5LMU E;  2EM2 A;  5LMN E;  2EM4 A;  4F2J C;  1QNT A;  2RS7 A;  1NEI A;  5AC4 A;  5A6K A;  3EQ1 A;  2ADR A;  4ZYH A;  4DV4 E;  1TF6 A;  1TN9 A;  4R03 A;  1X6H A;  2EM5 A;  3VK6 A;  1N32 E;  3AV0 A;  1WHQ A;  1YSA C;  4LFA E;  2ENC A;  2BBG A;  2E72 A;  1EH8 A;  5CFF E;  2WBU A;  1BBG A;  2EM7 A;  1ZR9 A;  5AAS A;  4BHB A;  4LFB E;  2EPK X;  4NXM E;  2EPZ A;  2VE7 C;  2I13 A;  2NA2 A;  4R2P A;  2EOF A;  1Z1B A;  2JOB A;  2EMH A;  3EPK A;  4LF9 E;  1JK1 A;  3VYY A;  2YU8 A;  2HHH E;  4LFC E;  4DR3 E;  4LF8 E;  4GKK E;  1NCS A;  1A1I A;  1PJS A;  2EMI A;  2EWL A;  1UBD C;  2YSP A;  2EM0 A;  3HTX A;  1PDA A;  4F9C B;  3OTO E;  3K6Q A;  1YPN A;  2R76 A;  4I8O A;  1EKZ A;  2RPC A;  4B3T E;  2J7J A;  4WXC A;  1XMQ E;  4B3R E;  1BB8 A;  2DSY A;  3BGH A;  4IJD A;  2ENH A;  2YTJ A;  2EPP A;  3JTZ A;  2A25 A;  4WFT A;  4DV5 E;  4YHH E;  1YUJ A;  2L8T A;  2N8X A;  1WXR A;  5T6J A;  4R2C A;  2KOU A;  2JP9 A;  1P47 A;  4F54 A;  2EOY A;  5FLX C;  1A1L A;  4B3S E;  2EMK A;  2JY9 A;  2MKD A;  5BR8 E;  2JOX A;  4J8Z A;  4DV6 E;  4DR5 E; 
#chains in the Genus database with same CATH homology
 2EL6 A;  1UN6 B;  4F6N A;  1KJK A;  2EMB A;  2EMW A;  2EOR A;  2EM9 A;  2EOS A;  2WBT A;  3M99 B;  3MHS C;  2YTN A;  4R2E A;  4R2Q A;  2D9H A;  3EPL A;  1F2I G;  2HGH A;  4FK5 C;  1A1K A;  2NAB A;  2EMG A;  2LVH A;  2CT1 A;  4GZN C;  2EPC A;  2EPA A;  2JPA A;  2EMF A;  2EOI A;  2EPR A;  1ZU1 A;  2EQ0 A;  1X3C A;  2EP3 A;  1A1F A;  2YTF A;  2GLI A;  2EQ1 A;  1MEY C;  2ENA A;  2CSH A;  2EOX A;  2EM2 A;  4IS1 C;  1G2D C;  2EOZ A;  2EJ4 A;  2EM4 A;  2EN2 A;  2EN3 A;  2EMA A;  4F2J C;  2MKN A;  1BBO A;  2LCE A;  3MHH C;  2R1F A;  2YRM A;  2EM3 A;  1TN9 A;  2ADR A;  1TF6 A;  2DLK A;  2EN1 A;  4R2S A;  2RSI A;  1X6H A;  2EM5 A;  1B69 A;  2EOH A;  2LV2 A;  2EN4 A;  4M9V C;  1WJP A;  2YRH A;  5KL4 A;  1YSA C;  2EL5 A;  2EN8 A;  2DMI A;  2ENC A;  1RMD A;  1G2F C;  2E72 A;  5KL2 A;  4R2D A;  2WBU A;  2EM7 A;  1ZR9 A;  2YTD A;  2DRP A;  4WSG A;  2EPX A;  3EPJ A;  2YTE A;  2M9A A;  2YRK A;  2EM8 A;  2MDG A;  2YTO A;  1JK2 A;  2GHF A;  2YTG A;  1A1J A;  2EPZ A;  2EOQ A;  2EPU A;  2I13 A;  2EM6 A;  1AAY A;  2ELY A;  2EOE A;  4R2P A;  2EOF A;  1Z1B A;  5KL5 A;  2EMH A;  3EPK A;  2PRT A;  2YTP A;  1JK1 A;  2YU8 A;  2EN6 A;  2EMZ A;  1DGC A;  2BB8 A;  1NCS A;  1A1I A;  2EE8 A;  2EMI A;  2YTQ A;  1UBD C;  2EMX A;  2YSP A;  2EM0 A;  2ELZ A;  2EOJ A;  1X6F A;  2EQ3 A;  1X6E A;  2VRD A;  1A1G A;  2LT7 A;  2EOO A;  1TF3 A;  1A1H A;  2EMY A;  2RPC A;  4X9J A;  2YTI A;  1ZAA C;  2J7J A;  1YUI A;  2YSO A;  2WBS A;  1BB8 A;  2EMC A;  4IJD A;  2ENH A;  2YTJ A;  2EPP A;  2A25 A;  5KL7 A;  4R2R A;  2CTD A;  5KL6 A;  3EPH A;  2EML A;  3UK3 C;  2LO3 A;  1YUJ A;  1LLM C;  4R2C A;  2EN7 A;  2JP9 A;  1X5W A;  1P47 A;  2EOY A;  1A1L A;  5KL3 A;  2WCC 3;  2DLQ A;  4R2A A;  2EMK A;  2MKD A;  2YU5 A;  3VHT B;  2EL4 A;  2DGC A;  2EOM A;  4F6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...