2EMGA

Solution structure of the c2h2 type zinc finger (region 463-495) of human zinc finger protein 484
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGENPFICSECGKVFTHKTNLIIHQKIHTGERPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 484
publication title Solution structure of the C2H2 type zinc finger (region 463-495) of human Zinc finger protein 484
rcsb
source organism Homo sapiens
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emgA01
2MDGA 1A1KA 2EPAA 2NABA 1F2IG 2EN3A 4IS1C 1ZU1A 2EMZA 2EMGA 2EOHA 1P47A 2EN2A 2EMYA 2EE8A 4F6NA 2YTGA 1ZAAC 2PRTA 1X5WA 1A1FA 1A1IA 1AAYA 1WJPA 2LV2A 2EMWA 2YTPA 2CT1A 2EPUA 2EOJA 4R2AA 1YUJA 2ELYA 2CSHA 1NCSA 2EM8A 2ADRA 2EL6A 3EPLA 1UBDC 2YU5A 2ENCA 2J7JA 1BBOA 5KL4A 1KJKA 2EPCA 2EL4A 2EORA 2EN8A 2RSIA 2EL5A 2EPPA 2EM5A 2VRDA 2YTQA 2EN7A 2WCC3 2GLIA 4R2CA 2YTOA 4R2QA 2EMXA 2JP9A 4WSGA 2EOXA 2EMAA 2EOFA 1JK2A 2LCEA 2EMIA 2EOIA 4X9JA 2EMBA 1ZR9A 2DMIA 2YSOA 4R2SA 3VHTB 2YSPA 1RMDA 2EQ0A 2YRHA 2LVHA 2EN4A 1MEYC 1DGCA 2RPCA 4F2JC 2D9HA 1X6FA 5KL3A 2EM7A 2EMCA 2EOEA 3UK3C 2DLKA 2MKNA 1TF3A 2M9AA 1UN6B 2EMHA 2EM0A 5KL5A 1A1JA 4R2RA 2EPZA 2EPXA 3MHHC 3EPHA 1A1GA 2JPAA 2EOMA 1X3CA 2YTIA 1YUIA 2EM3A 2EMLA 5KL7A 4IJDA 1B69A 2EM2A 2YTFA 2YTEA 2GHFA 1Z1BA 2E72A 2EM9A 2EN1A 2EP3A 2YU8A 3EPKA 1A1LA 1BB8A 4R2DA 4M9VC 2R1FA 3M99B 5KL2A 4F6MA 2EQ1A 1TN9A 1YSAC 2YTDA 2I13A 2DLQA 2EM6A 2LT7A 2WBUA 2EJ4A 1G2DC 2EOSA 2ENAA 2ELZA 1A1HA 2WBTA 1JK1A 2EMKA 3EPJA 4R2EA 2YRKA 2EOOA 2WBSA 2YTNA 2A25A 5KL6A 2YTJA 2CTDA 1LLMC 2EN6A 1G2FC 2DGCA 1X6EA 2EOQA 2ENHA 2EOYA 2BB8A 2EPRA 2LO3A 2HGHA 1X6HA 3MHSC 2YRMA 4GZNC 2DRPA 4R2PA 2EMFA 2EOZA 2EM4A 2EQ3A 1TF6A 2MKDA 4FK5C
chains in the Genus database with same CATH superfamily
2UU9E 1WHQA 1AH5A 4F9CB 4IS1C 2JXPA 1YPNA 4DR1E 1P47A 4B3ME 4M30A 4LFAE 1ZAAC 2YTGA 2E1MA 1X5WA 1WJPA 1DI2A 2EOJA 2YPNA 4X65E 2EM8A 1NCSA 4TUGA 3ECRA 2ENCA 2J7JA 4JI2E 5KL4A 2EPCA 1X47A 2LBSB 1T4OA 2EPKX 3BBGA 1XMQE 2YTOA 3EQ1A 4F54A 2JP9A 1IBME 2FV4B 2EOFA 3BGHA 2LCEA 2JOXA 4X9JA 2EMBA 2M7QA 2NUGA 2K4VA 4DMIA 3H09A 4WX9A 2YRHA 2M4IA 2RPCA 2HJJA 2WZOA 1N32E 2EMCA 3F6GA 5LMUE 5LLQA 3P1XA 1EH8A 2M9AA 2KOUA 1IQSA 2EMHA 4O4KA 5TSEA 2V86A 4ZYHA 2EPZA 3MHHC 1YZ9A 4AQYE 2LUPB 4DV1E 1XMOE 5A6BD 2JPAA 3VK6A 3TQMA 2B7VA 1B69A 2IHR1 3AV0A 2EM9A 5A6JA 2UUCE 1N3GA 4R8OA 2R1FA 2VQEE 5A6KA 2F8BA 3M99B 4O5GA 4P7DA 2V83A 2YTDA 4DV4E 1G2DC 2LT7A 2WBUA 1PJQA 1BBGA 3QG5C 2EOSA 2ENAA 4I8OA 2ELZA 1T4NA 2EOOA 4BHCA 5KL6A 2GPIA 3LLHA 2YWQA 4MLVA 4P78A 2CTDA 4LTYA 4JI1E 2V8QB 2EOQA 1IMUA 1UHZA 2HGHA 2UUAE 3MHSC 4GZNC 2JY9A 2DRPA 4R2PA 4M2ZA 4WXCA 3RMPA 4FK5C 1XNQE 1EH7A 2EPAA 1PKPA 2V88A 2NABA 1F2IG 2JVAA 2EMGA 1IBKE 4JI0E 2EN2A 2EMYA 2EE8A 4F6NA 1L4SA 4LF5E 4GEQB 2UUBE 4WPYA 4ZYEA 2ODRC 1HNXE 2LV2A 3THNA 2EPUA 4R2AA 2LTRA 2K7IA 4ZYGA 2ELYA 1IBLE 3EPLA 2L2NA 1GZ6A 1DQ3A 1BBOA 2EL5A 2LJUA 2VRDA 2YTQA 1XNRE 5IV8B 2L92A 1EH6A 5FLXC 2GLIA 2EPMX 4R2QA 4YY3E 4JI5E 4F9BB 5T6JA 4JI6E 2EMIA 4MLQA 1IQOA 1ZR9A 1KYQA 2YSOA 1HNZE 2DB2A 4R2SA 2EPLX 2VQFE 1RMDA 2EQ0A 1MEYC 2LVHA 2N3GA 1DGCA 3HPZA 3OMLA 1HR0E 1ZBTA 2B3TB 3DF6A 5KL3A 2EOEA 2NUEA 2LE2A 2L3CA 2MKNA 2EM0A 2VF1A 4DR2E 2L2MA 4DUZE 2I9IA 1X3CA 2L8TA 1EKZA 1YUIA 2EMLA 2LJHA 2EM2A 2YTFA 2L33A 1T4LB 2RS7A 3ADJA 4B3TE 2LRSA 1ZBQA 2GHFA 4DR6E 1Z1BA 2V87A 2YU8A 1BB8A 3T1HE 2L2KB 3KZYA 3J7AG 2EZ6A 2MC6A 4BC9A 1YYWA 2EQ1A 4JI7E 1YYOA 1TN9A 5AE3A 3FIGA 2UXBE 1PJSA 5CFFE 4LFCE 1YYKA 2M1SA 4HEIA 4OX9E 2V89A 1N33E 4O24A 4BMJA 2YRKA 1SFEA 4DV3E 4DV2E 1N36E 3HPSA 4BS9A 2JOBA 2FTXB 5AE1A 1WHNA 2RSMA 4WFTA 1X48A 3ADIA 2ENHA 2EOYA 4JV5E 2EPRA 1GQEA 2RS6A 2EMFA 2RTXA 4NZVA 4BBYA 4Q28A 3F6HA 1TF6A 2LUQA 2YT4A 2FGGA 4GKKE 4BC7A 1A1KA 1FKAE 1ZU1A 1O0WA 2EOHA 4X8WA 2KONA 3LMLA 4LF4E 2B9DA 4NHRA 2H36X 1FJGE 4B3RE 5A69A 5AASA 4LF9E 2YTPA 4DR7E 2CSHA 2YZTA 4KHPE 2ADRA 2EL6A 3AUZA 2G7HA 5A6BA 4DR5E 1KJKA 2EL4A 2EORA 3ZOQB 3IWBA 2EPPA 1MGTA 2EM5A 4JI4E 2EN7A 5IWAE 4DV7E 4R2CA 3L00A 2EMXA 4WSGA 4DV5E 2Q8UA 2EOXA 5DNYA 3J81C 4KZSA 1JK2A 4LFBE 2NA2A 3HQ1A 2DSYA 5AE2A 2YSPA 2EN4A 1X6FA 5A6AA 2EM7A 1WXRA 3UK3C 4TUIA 1TF3A 1SR9A 1A1JA 3ADLA 5AC4A 4R2RA 4X62E 3JAMC 2EPXA 3EPHA 4DR4E 1A1GA 1NEIA 2L6MA 2EOMA 2YTIA 3HXLA 3IWCA 4DV0E 1YFHA 3MSWA 5KL7A 3C6MA 4IJDA 2EPOA 2YTEA 3DJWA 4DKKA 1I94E 2JR1A 4DUYE 2LMZA 2E72A 2EN1A 4N4RB 4R2DA 4X64E 4M9VC 4O43A 5KL2A 2I13A 1YSAC 2DLQA 2EM6A 5LL6R 2MDRA 5AC5A 5BR8E 1A1HA 1JK1A 2EMKA 3EPJA 1HNWE 1STUA 3C4TA 4J8ZA 2HC5A 5IXMB 1LLMC 2EN6A 3OTOE 1G2FC 1X6EA 4HTGA 2JYAA 2LO3A 3C4BA 1X49A 2EOZA 2EQ3A 3J7Yp 4JYAE 4JI8E 1T38A 1UILA 2MKDA 4K0KE 2MDGA 3HTXA 3T1YE 2EN3A 2KHXA 3VYYA 2EMZA 2E5LE 1GTKA 4RH8A 3KWRA 4DV6E 4B3SE 2PRTA 2UXDE 4M0VA 1A1FA 1A1IA 1AAYA 2ZM6E 2EWLA 4BHBA 2V85A 2RQLA 4KWYA 1N34E 2UXCE 2EMWA 2CT1A 1YUJA 2HHHE 4LF7E 3BIDA 5IT9C 4YHHE 5LMNE 1J5EE 1UBDC 2YU5A 4LU9A 2R76A 4BCAA 1RC7A 2RSIA 2EN8A 3JU0A 4JI3E 2BBGA 2WCC3 2VE7C 3K6QA 5ADZA 1J26A 3IWDA 4DR3E 2EMAA 2EOIA 2DMIA 4GKJE 3KZZA 2F4VE 3VHTB 4LF6E 2L3JA 4OOGC 4F2JC 2N3HA 2D9HA 2ODRD 1QU6A 2DLKA 1UN6B 2DIXA 4WXDA 5KL5A 3JTZA 2MC5A 4L8NA 2NUFA 2EM3A 3ADGA 5F3WA 2EP3A 1A1LA 3EPKA 5A2QC 2JWOA 4F9AB 4LF8E 4F6MA 4WYQB 2EJ4A 3VYXA 3J80C 3THOB 2DMYA 4L5NC 2WBTA 4R2EA 1QNTA 2WBSA 2CPNA 2YTNA 4NXNE 2A25A 4R03A 2YTJA 4ZYDA 1WRJA 3C6KA 2DGCA 4NXME 3BF2A 2B7TA 2LTSA 1T39A 2BB8A 1RQ0A 2EPNA 1X6HA 4WSPA 4X66E 2YRMA 2EM4A 2N8XA 1PDAA 4Q35B 4RHBB 1PJTA
chains in the Genus database with same CATH topology
2MDGA 1A1KA 2EPAA 2NABA 1F2IG 2EN3A 4IS1C 1ZU1A 2EMZA 2EMGA 2EOHA 1P47A 2EN2A 2EMYA 2EE8A 4F6NA 2YTGA 1ZAAC 2PRTA 1X5WA 1A1FA 1A1IA 1AAYA 1WJPA 2LV2A 2EMWA 2YTPA 2CT1A 2EPUA 2EOJA 4R2AA 1YUJA 2ELYA 2CSHA 1NCSA 2EM8A 2ADRA 2EL6A 3EPLA 1UBDC 2YU5A 2ENCA 2J7JA 1BBOA 5KL4A 1KJKA 2EPCA 2EL4A 2EORA 2EN8A 2RSIA 2EL5A 2EPPA 2EM5A 2VRDA 2YTQA 2EN7A 2WCC3 2GLIA 4R2CA 2YTOA 4R2QA 2EMXA 2JP9A 4WSGA 2EOXA 2EMAA 2EOFA 1JK2A 2LCEA 2EMIA 2EOIA 4X9JA 2EMBA 1ZR9A 2DMIA 2YSOA 4R2SA 3VHTB 2YSPA 1RMDA 2EQ0A 2YRHA 2LVHA 2EN4A 1MEYC 1DGCA 2RPCA 4F2JC 2D9HA 1X6FA 5KL3A 2EM7A 2EMCA 2EOEA 3UK3C 2DLKA 2MKNA 1TF3A 2M9AA 1UN6B 2EMHA 2EM0A 5KL5A 1A1JA 4R2RA 2EPZA 2EPXA 3MHHC 3EPHA 1A1GA 2JPAA 2EOMA 1X3CA 2YTIA 1YUIA 2EM3A 2EMLA 5KL7A 4IJDA 1B69A 2EM2A 2YTFA 2YTEA 2GHFA 1Z1BA 2E72A 2EM9A 2EN1A 2EP3A 2YU8A 3EPKA 1A1LA 1BB8A 4R2DA 4M9VC 2R1FA 3M99B 5KL2A 4F6MA 2EQ1A 1TN9A 1YSAC 2YTDA 2I13A 2DLQA 2EM6A 2LT7A 2WBUA 2EJ4A 1G2DC 2EOSA 2ENAA 2ELZA 1A1HA 2WBTA 1JK1A 2EMKA 3EPJA 4R2EA 2YRKA 2EOOA 2WBSA 2YTNA 2A25A 5KL6A 2YTJA 2CTDA 1LLMC 2EN6A 1G2FC 2DGCA 1X6EA 2EOQA 2ENHA 2EOYA 2BB8A 2EPRA 2LO3A 2HGHA 1X6HA 3MHSC 2YRMA 4GZNC 2DRPA 4R2PA 2EMFA 2EOZA 2EM4A 2EQ3A 1TF6A 2MKDA 4FK5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MDG A;  1A1K A;  2EPA A;  2NAB A;  1F2I G;  2EN3 A;  4IS1 C;  1ZU1 A;  2EMZ A;  2EMG A;  2EOH A;  1P47 A;  2EN2 A;  2EMY A;  2EE8 A;  4F6N A;  2YTG A;  1ZAA C;  2PRT A;  1X5W A;  1A1F A;  1A1I A;  1AAY A;  1WJP A;  2LV2 A;  2EMW A;  2YTP A;  2CT1 A;  2EPU A;  2EOJ A;  4R2A A;  1YUJ A;  2ELY A;  2CSH A;  1NCS A;  2EM8 A;  2ADR A;  2EL6 A;  3EPL A;  1UBD C;  2YU5 A;  2ENC A;  2J7J A;  1BBO A;  5KL4 A;  1KJK A;  2EPC A;  2EL4 A;  2EOR A;  2EN8 A;  2RSI A;  2EL5 A;  2EPP A;  2EM5 A;  2VRD A;  2YTQ A;  2EN7 A;  2WCC 3;  2GLI A;  4R2C A;  2YTO A;  4R2Q A;  2EMX A;  2JP9 A;  4WSG A;  2EOX A;  2EMA A;  2EOF A;  1JK2 A;  2LCE A;  2EMI A;  2EOI A;  4X9J A;  2EMB A;  1ZR9 A;  2DMI A;  2YSO A;  4R2S A;  3VHT B;  2YSP A;  1RMD A;  2EQ0 A;  2YRH A;  2LVH A;  2EN4 A;  1MEY C;  1DGC A;  2RPC A;  4F2J C;  2D9H A;  1X6F A;  5KL3 A;  2EM7 A;  2EMC A;  2EOE A;  3UK3 C;  2DLK A;  2MKN A;  1TF3 A;  2M9A A;  1UN6 B;  2EMH A;  2EM0 A;  5KL5 A;  1A1J A;  4R2R A;  2EPZ A;  2EPX A;  3MHH C;  3EPH A;  1A1G A;  2JPA A;  2EOM A;  1X3C A;  2YTI A;  1YUI A;  2EM3 A;  2EML A;  5KL7 A;  4IJD A;  1B69 A;  2EM2 A;  2YTF A;  2YTE A;  2GHF A;  1Z1B A;  2E72 A;  2EM9 A;  2EN1 A;  2EP3 A;  2YU8 A;  3EPK A;  1A1L A;  1BB8 A;  4R2D A;  4M9V C;  2R1F A;  3M99 B;  5KL2 A;  4F6M A;  2EQ1 A;  1TN9 A;  1YSA C;  2YTD A;  2I13 A;  2DLQ A;  2EM6 A;  2LT7 A;  2WBU A;  2EJ4 A;  1G2D C;  2EOS A;  2ENA A;  2ELZ A;  1A1H A;  2WBT A;  1JK1 A;  2EMK A;  3EPJ A;  4R2E A;  2YRK A;  2EOO A;  2WBS A;  2YTN A;  2A25 A;  5KL6 A;  2YTJ A;  2CTD A;  1LLM C;  2EN6 A;  1G2F C;  2DGC A;  1X6E A;  2EOQ A;  2ENH A;  2EOY A;  2BB8 A;  2EPR A;  2LO3 A;  2HGH A;  1X6H A;  3MHS C;  2YRM A;  4GZN C;  2DRP A;  4R2P A;  2EMF A;  2EOZ A;  2EM4 A;  2EQ3 A;  1TF6 A;  2MKD A;  4FK5 C; 
#chains in the Genus database with same CATH topology
 2UU9 E;  1WHQ A;  1AH5 A;  4F9C B;  4IS1 C;  2JXP A;  1YPN A;  4DR1 E;  1P47 A;  4B3M E;  4M30 A;  4LFA E;  1ZAA C;  2YTG A;  2E1M A;  1X5W A;  1WJP A;  1DI2 A;  2EOJ A;  2YPN A;  4X65 E;  2EM8 A;  1NCS A;  4TUG A;  3ECR A;  2ENC A;  2J7J A;  4JI2 E;  5KL4 A;  2EPC A;  1X47 A;  2LBS B;  1T4O A;  2EPK X;  3BBG A;  1XMQ E;  2YTO A;  3EQ1 A;  4F54 A;  2JP9 A;  1IBM E;  2FV4 B;  2EOF A;  3BGH A;  2LCE A;  2JOX A;  4X9J A;  2EMB A;  2M7Q A;  2NUG A;  2K4V A;  4DMI A;  3H09 A;  4WX9 A;  2YRH A;  2M4I A;  2RPC A;  2HJJ A;  2WZO A;  1N32 E;  2EMC A;  3F6G A;  5LMU E;  5LLQ A;  3P1X A;  1EH8 A;  2M9A A;  2KOU A;  1IQS A;  2EMH A;  4O4K A;  5TSE A;  2V86 A;  4ZYH A;  2EPZ A;  3MHH C;  1YZ9 A;  4AQY E;  2LUP B;  4DV1 E;  1XMO E;  5A6B D;  2JPA A;  3VK6 A;  3TQM A;  2B7V A;  1B69 A;  2IHR 1;  3AV0 A;  2EM9 A;  5A6J A;  2UUC E;  1N3G A;  4R8O A;  2R1F A;  2VQE E;  5A6K A;  2F8B A;  3M99 B;  4O5G A;  4P7D A;  2V83 A;  2YTD A;  4DV4 E;  1G2D C;  2LT7 A;  2WBU A;  1PJQ A;  1BBG A;  3QG5 C;  2EOS A;  2ENA A;  4I8O A;  2ELZ A;  1T4N A;  2EOO A;  4BHC A;  5KL6 A;  2GPI A;  3LLH A;  2YWQ A;  4MLV A;  4P78 A;  2CTD A;  4LTY A;  4JI1 E;  2V8Q B;  2EOQ A;  1IMU A;  1UHZ A;  2HGH A;  2UUA E;  3MHS C;  4GZN C;  2JY9 A;  2DRP A;  4R2P A;  4M2Z A;  4WXC A;  3RMP A;  4FK5 C;  1XNQ E;  1EH7 A;  2EPA A;  1PKP A;  2V88 A;  2NAB A;  1F2I G;  2JVA A;  2EMG A;  1IBK E;  4JI0 E;  2EN2 A;  2EMY A;  2EE8 A;  4F6N A;  1L4S A;  4LF5 E;  4GEQ B;  2UUB E;  4WPY A;  4ZYE A;  2ODR C;  1HNX E;  2LV2 A;  3THN A;  2EPU A;  4R2A A;  2LTR A;  2K7I A;  4ZYG A;  2ELY A;  1IBL E;  3EPL A;  2L2N A;  1GZ6 A;  1DQ3 A;  1BBO A;  2EL5 A;  2LJU A;  2VRD A;  2YTQ A;  1XNR E;  5IV8 B;  2L92 A;  1EH6 A;  5FLX C;  2GLI A;  2EPM X;  4R2Q A;  4YY3 E;  4JI5 E;  4F9B B;  5T6J A;  4JI6 E;  2EMI A;  4MLQ A;  1IQO A;  1ZR9 A;  1KYQ A;  2YSO A;  1HNZ E;  2DB2 A;  4R2S A;  2EPL X;  2VQF E;  1RMD A;  2EQ0 A;  1MEY C;  2LVH A;  2N3G A;  1DGC A;  3HPZ A;  3OML A;  1HR0 E;  1ZBT A;  2B3T B;  3DF6 A;  5KL3 A;  2EOE A;  2NUE A;  2LE2 A;  2L3C A;  2MKN A;  2EM0 A;  2VF1 A;  4DR2 E;  2L2M A;  4DUZ E;  2I9I A;  1X3C A;  2L8T A;  1EKZ A;  1YUI A;  2EML A;  2LJH A;  2EM2 A;  2YTF A;  2L33 A;  1T4L B;  2RS7 A;  3ADJ A;  4B3T E;  2LRS A;  1ZBQ A;  2GHF A;  4DR6 E;  1Z1B A;  2V87 A;  2YU8 A;  1BB8 A;  3T1H E;  2L2K B;  3KZY A;  3J7A G;  2EZ6 A;  2MC6 A;  4BC9 A;  1YYW A;  2EQ1 A;  4JI7 E;  1YYO A;  1TN9 A;  5AE3 A;  3FIG A;  2UXB E;  1PJS A;  5CFF E;  4LFC E;  1YYK A;  2M1S A;  4HEI A;  4OX9 E;  2V89 A;  1N33 E;  4O24 A;  4BMJ A;  2YRK A;  1SFE A;  4DV3 E;  4DV2 E;  1N36 E;  3HPS A;  4BS9 A;  2JOB A;  2FTX B;  5AE1 A;  1WHN A;  2RSM A;  4WFT A;  1X48 A;  3ADI A;  2ENH A;  2EOY A;  4JV5 E;  2EPR A;  1GQE A;  2RS6 A;  2EMF A;  2RTX A;  4NZV A;  4BBY A;  4Q28 A;  3F6H A;  1TF6 A;  2LUQ A;  2YT4 A;  2FGG A;  4GKK E;  4BC7 A;  1A1K A;  1FKA E;  1ZU1 A;  1O0W A;  2EOH A;  4X8W A;  2KON A;  3LML A;  4LF4 E;  2B9D A;  4NHR A;  2H36 X;  1FJG E;  4B3R E;  5A69 A;  5AAS A;  4LF9 E;  2YTP A;  4DR7 E;  2CSH A;  2YZT A;  4KHP E;  2ADR A;  2EL6 A;  3AUZ A;  2G7H A;  5A6B A;  4DR5 E;  1KJK A;  2EL4 A;  2EOR A;  3ZOQ B;  3IWB A;  2EPP A;  1MGT A;  2EM5 A;  4JI4 E;  2EN7 A;  5IWA E;  4DV7 E;  4R2C A;  3L00 A;  2EMX A;  4WSG A;  4DV5 E;  2Q8U A;  2EOX A;  5DNY A;  3J81 C;  4KZS A;  1JK2 A;  4LFB E;  2NA2 A;  3HQ1 A;  2DSY A;  5AE2 A;  2YSP A;  2EN4 A;  1X6F A;  5A6A A;  2EM7 A;  1WXR A;  3UK3 C;  4TUI A;  1TF3 A;  1SR9 A;  1A1J A;  3ADL A;  5AC4 A;  4R2R A;  4X62 E;  3JAM C;  2EPX A;  3EPH A;  4DR4 E;  1A1G A;  1NEI A;  2L6M A;  2EOM A;  2YTI A;  3HXL A;  3IWC A;  4DV0 E;  1YFH A;  3MSW A;  5KL7 A;  3C6M A;  4IJD A;  2EPO A;  2YTE A;  3DJW A;  4DKK A;  1I94 E;  2JR1 A;  4DUY E;  2LMZ A;  2E72 A;  2EN1 A;  4N4R B;  4R2D A;  4X64 E;  4M9V C;  4O43 A;  5KL2 A;  2I13 A;  1YSA C;  2DLQ A;  2EM6 A;  5LL6 R;  2MDR A;  5AC5 A;  5BR8 E;  1A1H A;  1JK1 A;  2EMK A;  3EPJ A;  1HNW E;  1STU A;  3C4T A;  4J8Z A;  2HC5 A;  5IXM B;  1LLM C;  2EN6 A;  3OTO E;  1G2F C;  1X6E A;  4HTG A;  2JYA A;  2LO3 A;  3C4B A;  1X49 A;  2EOZ A;  2EQ3 A;  3J7Y p;  4JYA E;  4JI8 E;  1T38 A;  1UIL A;  2MKD A;  4K0K E;  2MDG A;  3HTX A;  3T1Y E;  2EN3 A;  2KHX A;  3VYY A;  2EMZ A;  2E5L E;  1GTK A;  4RH8 A;  3KWR A;  4DV6 E;  4B3S E;  2PRT A;  2UXD E;  4M0V A;  1A1F A;  1A1I A;  1AAY A;  2ZM6 E;  2EWL A;  4BHB A;  2V85 A;  2RQL A;  4KWY A;  1N34 E;  2UXC E;  2EMW A;  2CT1 A;  1YUJ A;  2HHH E;  4LF7 E;  3BID A;  5IT9 C;  4YHH E;  5LMN E;  1J5E E;  1UBD C;  2YU5 A;  4LU9 A;  2R76 A;  4BCA A;  1RC7 A;  2RSI A;  2EN8 A;  3JU0 A;  4JI3 E;  2BBG A;  2WCC 3;  2VE7 C;  3K6Q A;  5ADZ A;  1J26 A;  3IWD A;  4DR3 E;  2EMA A;  2EOI A;  2DMI A;  4GKJ E;  3KZZ A;  2F4V E;  3VHT B;  4LF6 E;  2L3J A;  4OOG C;  4F2J C;  2N3H A;  2D9H A;  2ODR D;  1QU6 A;  2DLK A;  1UN6 B;  2DIX A;  4WXD A;  5KL5 A;  3JTZ A;  2MC5 A;  4L8N A;  2NUF A;  2EM3 A;  3ADG A;  5F3W A;  2EP3 A;  1A1L A;  3EPK A;  5A2Q C;  2JWO A;  4F9A B;  4LF8 E;  4F6M A;  4WYQ B;  2EJ4 A;  3VYX A;  3J80 C;  3THO B;  2DMY A;  4L5N C;  2WBT A;  4R2E A;  1QNT A;  2WBS A;  2CPN A;  2YTN A;  4NXN E;  2A25 A;  4R03 A;  2YTJ A;  4ZYD A;  1WRJ A;  3C6K A;  2DGC A;  4NXM E;  3BF2 A;  2B7T A;  2LTS A;  1T39 A;  2BB8 A;  1RQ0 A;  2EPN A;  1X6H A;  4WSP A;  4X66 E;  2YRM A;  2EM4 A;  2N8X A;  1PDA A;  4Q35 B;  4RHB B;  1PJT A; 
#chains in the Genus database with same CATH homology
 2MDG A;  1A1K A;  2EPA A;  2NAB A;  1F2I G;  2EN3 A;  4IS1 C;  1ZU1 A;  2EMZ A;  2EMG A;  2EOH A;  1P47 A;  2EN2 A;  2EMY A;  2EE8 A;  4F6N A;  2YTG A;  1ZAA C;  2PRT A;  1X5W A;  1A1F A;  1A1I A;  1AAY A;  1WJP A;  2LV2 A;  2EMW A;  2YTP A;  2CT1 A;  2EPU A;  2EOJ A;  4R2A A;  1YUJ A;  2ELY A;  2CSH A;  1NCS A;  2EM8 A;  2ADR A;  2EL6 A;  3EPL A;  1UBD C;  2YU5 A;  2ENC A;  2J7J A;  1BBO A;  5KL4 A;  1KJK A;  2EPC A;  2EL4 A;  2EOR A;  2EN8 A;  2RSI A;  2EL5 A;  2EPP A;  2EM5 A;  2VRD A;  2YTQ A;  2EN7 A;  2WCC 3;  2GLI A;  4R2C A;  2YTO A;  4R2Q A;  2EMX A;  2JP9 A;  4WSG A;  2EOX A;  2EMA A;  2EOF A;  1JK2 A;  2LCE A;  2EMI A;  2EOI A;  4X9J A;  2EMB A;  1ZR9 A;  2DMI A;  2YSO A;  4R2S A;  3VHT B;  2YSP A;  1RMD A;  2EQ0 A;  2YRH A;  2LVH A;  2EN4 A;  1MEY C;  1DGC A;  2RPC A;  4F2J C;  2D9H A;  1X6F A;  5KL3 A;  2EM7 A;  2EMC A;  2EOE A;  3UK3 C;  2DLK A;  2MKN A;  1TF3 A;  2M9A A;  1UN6 B;  2EMH A;  2EM0 A;  5KL5 A;  1A1J A;  4R2R A;  2EPZ A;  2EPX A;  3MHH C;  3EPH A;  1A1G A;  2JPA A;  2EOM A;  1X3C A;  2YTI A;  1YUI A;  2EM3 A;  2EML A;  5KL7 A;  4IJD A;  1B69 A;  2EM2 A;  2YTF A;  2YTE A;  2GHF A;  1Z1B A;  2E72 A;  2EM9 A;  2EN1 A;  2EP3 A;  2YU8 A;  3EPK A;  1A1L A;  1BB8 A;  4R2D A;  4M9V C;  2R1F A;  3M99 B;  5KL2 A;  4F6M A;  2EQ1 A;  1TN9 A;  1YSA C;  2YTD A;  2I13 A;  2DLQ A;  2EM6 A;  2LT7 A;  2WBU A;  2EJ4 A;  1G2D C;  2EOS A;  2ENA A;  2ELZ A;  1A1H A;  2WBT A;  1JK1 A;  2EMK A;  3EPJ A;  4R2E A;  2YRK A;  2EOO A;  2WBS A;  2YTN A;  2A25 A;  5KL6 A;  2YTJ A;  2CTD A;  1LLM C;  2EN6 A;  1G2F C;  2DGC A;  1X6E A;  2EOQ A;  2ENH A;  2EOY A;  2BB8 A;  2EPR A;  2LO3 A;  2HGH A;  1X6H A;  3MHS C;  2YRM A;  4GZN C;  2DRP A;  4R2P A;  2EMF A;  2EOZ A;  2EM4 A;  2EQ3 A;  1TF6 A;  2MKD A;  4FK5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...