2EMGA

Solution structure of the c2h2 type zinc finger (region 463-495) of human zinc finger protein 484
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGENPFICSECGKVFTHKTNLIIHQKIHTGERPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 484
publication title Solution structure of the C2H2 type zinc finger (region 463-495) of human Zinc finger protein 484
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emgA01
2YTOA 5KL4A 2ENHA 2YRKA 2EOHA 2YTGA 2EPRA 2EM9A 2YSOA 1ZAAC 2EPXA 4GZNC 1TF6A 3EPHA 2EMGA 2A25A 2LCEA 2ELYA 1Z1BA 2ENCA 2LV2A 2R1FA 1A1HA 1A1IA 2CSHA 2EM8A 2EOOA 2EM6A 2WBUA 4R2RA 2EN7A 2YU5A 5KL6A 2MKNA 2DLKA 4F6MA 1B69A 2YTIA 2EL5A 2PRTA 2EOZA 5KL5A 2EN3A 2EOJA 2EMBA 4F6NA 2WCC3 2JPAA 1BBOA 1RMDA 2JP9A 2EPPA 2YTDA 4FK5C 2EMKA 3MHHC 4IJDA 4R2SA 5KL3A 2MKDA 4F2JC 4IS1C 1BB8A 1WJPA 2EOIA 2EOMA 2DRPA 2VRDA 4R2AA 2YTQA 2EL4A 2EPZA 2RPCA 2J7JA 2DGCA 2EPUA 1UN6B 2EM3A 3MHSC 2LT7A 2EJ4A 2EP3A 2EQ0A 2EOSA 1F2IG 2CTDA 1YSAC 2EMCA 1LLMC 2EN6A 2RSIA 1A1KA 2EM7A 2LVHA 1YUJA 2EQ3A 2CT1A 1NCSA 1G2DC 2MDGA 2YRHA 2D9HA 4R2PA 3EPJA 2EMYA 3UK3C 2EQ1A 2YTPA 5KL2A 2EN4A 2ENAA 2GHFA 2EN8A 4R2DA 1MEYC 1ZU1A 2ADRA 3EPLA 1AAYA 2EORA 4WSGA 2BB8A 1A1JA 2EN2A 1A1GA 1A1FA 1DGCA 2EMWA 4X9JA 2EMFA 2EMZA 2EMXA 4R2QA 2EN1A 1JK1A 2DLQA 2EOQA 2EPAA 5KL7A 2EOYA 2EMHA 2EL6A 1G2FC 2EMAA 2EOEA 1TF3A 2EMIA 2ELZA 2EMLA 2YRMA 2YTJA 3VHTB 4R2EA 2YU8A 2WBTA 2GLIA 2YTNA 2DMIA 2YTEA 1X3CA 2LO3A 2EM5A 4M9VC 2EPCA 2EM4A 2WBSA 1ZR9A 2YTFA 2EE8A 2I13A 3M99B 4R2CA 1UBDC 2M9AA 1YUIA 1X6HA 1X6EA 1X6FA 2EM0A 2EOXA 2HGHA 1TN9A 2EOFA 1P47A 1X5WA 2E72A 2EM2A 2NABA 3EPKA 2YSPA 1A1LA 1KJKA 1JK2A
chains in the Genus database with same CATH superfamily
5KL4A 2YRKA 2YTGA 2YSOA 3DF6A 1TF6A 4BC7A 3KZZA 1YYWA 2EPLX 2ELYA 1Z1BA 3HXLA 2R1FA 4TUGA 3JTZA 3J80C 4I8OA 4X64E 2JXPA 2EM6A 2WBUA 4R2RA 2EN7A 2YU5A 4O24A 2LUPB 2BBGA 1B69A 2YTIA 4R03A 5AASA 3ADIA 4F6NA 4JI5E 2YT4A 2FTXB 1BBOA 3AV0A 2JP9A 4HEIA 5T6JA 2EMKA 1YPNA 3MHHC 2MC6A 5KL3A 4JI8E 1BB8A 1KYQA 4LU9A 2NUEA 4BMJA 2V83A 2DGCA 4DV7E 2V89A 3C6MA 1UN6B 1HNZE 1XMOE 2V88A 3EQ1A 4M2ZA 2EOSA 4DUZE 2EPOA 3BBGA 1ZBTA 3IWDA 2JVAA 1A1KA 2EM7A 2JYAA 2CT1A 2YRHA 4DV2E 4JV5E 3EPJA 2EMYA 1X49A 3UK3C 2EQ1A 4LF4E 2YTPA 5A6KA 1O0WA 4R8OA 1T4LB 2E1MA 2HHHE 1ZU1A 1MGTA 1WXRA 2KONA 4WSGA 4DV6E 3BF2A 3F6HA 3VYXA 2EN2A 3ADGA 4LFBE 4RHBB 1A1FA 2LJHA 1L4SA 3MSWA 1XMQE 2LE2A 2N8XA 2EOQA 4DR5E 2EPAA 4DR3E 5LLQA 2EPNA 1PKPA 4M30A 1G2FC 4GKKE 2EMAA 4GKJE 4LFAE 5LMUE 2EMIA 2ELZA 2EMLA 2MC5A 2F4VE 2YTJA 1BBGA 2JOBA 2V87A 2EM4A 4Q28A 4ZYDA 2WBSA 5A2QC 1ZR9A 4B3SE 2EE8A 3M99B 3FIGA 4R2CA 2M9AA 1YUIA 1X6HA 4F9CB 4WYQB 1X5WA 3EPKA 1KJKA 4OOGC 2L6MA 2YTOA 1N3GA 2EOHA 2EPXA 1XNRE 2M7QA 3HPZA 3EPHA 2A25A 4ZYEA 4X62E 1A1HA 2EPMX 1A1IA 4LF5E 2UXDE 4F9AB 1T39A 2EZ6A 4F6MA 4BCAA 2YWQA 4L5NC 5KL5A 2EN3A 5AC4A 2L3JA 1RMDA 1GZ6A 2EPPA 5LMNE 3HTXA 2WZOA 1A1LA 4ZYHA 2EOMA 2DRPA 3H09A 3KZYA 3F6GA 2J7JA 5A6BA 3VYYA 2JR1A 1EH8A 4BBYA 4BHCA 1HR0E 3MHSC 4P78A 4JI2E 2L8TA 4K0KE 3THOB 5ADZA 1LLMC 4BC9A 2EN6A 1YUJA 3K6QA 4P7DA 2EQ3A 2VE7C 2L3CA 1DQ3A 2DB2A 1T4OA 5IXMB 1YZ9A 2NUGA 4R2DA 1MEYC 2ADRA 3EPLA 4LF8E 3LLHA 1EH6A 2BB8A 4O4KA 2UUAE 1N32E 1UILA 4MLVA 2E5LE 1DGCA 4JI6E 2LTSA 4GEQB 2EMXA 4YY3E 2EN1A 2G7HA 4JI1E 3T1YE 2EOYA 4YHHE 3L00A 1IBME 2EL6A 2B7VA 2EPKX 2EOEA 4NZVA 5LL6R 2L2KB 2VF1A 3QG5C 3J81C 5BR8E 4DV3E 2WBTA 2GLIA 4ZYGA 2RTXA 2EPCA 1STUA 2LRSA 4TUIA 2I9IA 5AE2A 2FGGA 2HC5A 2LMZA 4LF9E 2LBSB 1UBDC 1FJGE 3HQ1A 1X47A 5F3WA 3IWBA 2EOFA 5TSEA 2E72A 2EM2A 2UUBE 2NABA 4JI7E 5FLXC 2F8BA 2DMYA 2V86A 4WPYA 2ENHA 2KHXA 2EPRA 2EM9A 1ZAAC 1HNXE 1PDAA 3AUZA 1EH7A 2EMGA 2LCEA 3OMLA 2YPNA 2ENCA 2LV2A 3RMPA 2V85A 2ODRD 2EM8A 2EOOA 5KL6A 2MKNA 1WRJA 2DLKA 2EL5A 2PRTA 2EOZA 1YYKA 1N33E 2EOJA 4DKKA 4RH8A 2WCC3 2UXBE 4MLQA 4NHRA 1YFHA 2EWLA 2YTDA 4F9BB 3J7Yp 1I94E 2RQLA 2NUFA 4F2JC 4IS1C 1WJPA 4DR4E 2EL4A 2EPZA 3C6KA 1N34E 4JYAE 3P1XA 1QNTA 2LT7A 2EQ0A 4B3ME 2CTDA 1YSAC 5A6BD 2HJJA 4X65E 5A69A 3LMLA 5CFFE 2LVHA 2CPNA 4OX9E 2MDGA 4R2PA 3ZOQB 1PJQA 2YZTA 2B7TA 1J5EE 4B3RE 4DV5E 1AAYA 1A1JA 1A1GA 4O5GA 4JI4E 5AC5A 4WX9A 4DUYE 4X66E 4X9JA 1NEIA 1SR9A 2GPIA 4DV4E 5DNYA 3OTOE 1JK1A 4LF7E 2DLQA 4DR6E 2RSMA 5KL7A 2N3HA 2EMHA 2M4IA 4AQYE 5A6AA 1TF3A 1XNQE 2YRMA 3ADLA 1AH5A 4N4RB 2YTEA 1X3CA 2LO3A 2JY9A 4M9VC 3JU0A 5IWAE 4B3TE 2L33A 3ECRA 1X6EA 1X6FA 3C4BA 4BHBA 2V8QB 1FKAE 1TN9A 2UUCE 4LFCE 4NXNE 1QU6A 2RS7A 2RS6A 4J8ZA 4KHPE 1JK2A 4LTYA 4F54A 2K4VA 3IWCA 4GZNC 1X48A 4DR1E 2IHR1 1IQOA 3C4TA 3KWRA 1N36E 2DIXA 3HPSA 2CSHA 1IQSA 3ADJA 4JI0E 2JWOA 5IV8B 2EMBA 1UHZA 4DR7E 4O43A 2JPAA 2FV4B 1PJSA 4LF6E 2LUQA 2ZM6E 1T4NA 2UU9E 4FK5C 4M0VA 4IJDA 4R2SA 2MKDA 2EOIA 2VRDA 4R2AA 5IT9C 3TQMA 2YTQA 4WXCA 2RPCA 4NXME 2R76A 2EPUA 4DR2E 2L92A 4WFTA 1GQEA 2EM3A 4HTGA 1SFEA 1ZBQA 3VK6A 2EJ4A 2EP3A 3J7AG 1GTKA 4WSPA 1PJTA 1F2IG 2EMCA 1RC7A 1IBKE 2JOXA 4JI3E 2UXCE 2VQFE 2ODRC 2RSIA 3DJWA 2DSYA 1NCSA 1IBLE 2Q8UA 4DMIA 2D9HA 1G2DC 1EKZA 2LJUA 5KL2A 2NA2A 4L8NA 2EN4A 2ENAA 2GHFA 2EN8A 1YYOA 5AE1A 1DI2A 1HNWE 2L2MA 4DV1E 2EORA 1WHQA 3JAMC 2B9DA 2EMWA 1T38A 3BGHA 2EMFA 2EMZA 2N3GA 4R2QA 3THNA 1RQ0A 2MDRA 1IMUA 4X8WA 3VHTB 2M1SA 4WXDA 2KOUA 4R2EA 2YU8A 5A6JA 2YTNA 4Q35B 2DMIA 2EM5A 3T1HE 2L2NA 2YTFA 2LTRA 3BIDA 2I13A 1J26A 5AE3A 2EM0A 2EOXA 2HGHA 2K7IA 2H36X 1WHNA 4BS9A 2VQEE 1P47A 2B3TB 4KZSA 2YSPA 4DV0E 4KWYA
chains in the Genus database with same CATH topology
2YTOA 5KL4A 2ENHA 2YRKA 2EOHA 2YTGA 2EPRA 2EM9A 2YSOA 1ZAAC 2EPXA 4GZNC 1TF6A 3EPHA 2EMGA 2A25A 2LCEA 2ELYA 1Z1BA 2ENCA 2LV2A 2R1FA 1A1HA 1A1IA 2CSHA 2EM8A 2EOOA 2EM6A 2WBUA 4R2RA 2EN7A 2YU5A 5KL6A 2MKNA 2DLKA 4F6MA 1B69A 2YTIA 2EL5A 2PRTA 2EOZA 5KL5A 2EN3A 2EOJA 2EMBA 4F6NA 2WCC3 2JPAA 1BBOA 1RMDA 2JP9A 2EPPA 2YTDA 4FK5C 2EMKA 3MHHC 4IJDA 4R2SA 5KL3A 2MKDA 4F2JC 4IS1C 1BB8A 1WJPA 2EOIA 2EOMA 2DRPA 2VRDA 4R2AA 2YTQA 2EL4A 2EPZA 2RPCA 2J7JA 2DGCA 2EPUA 1UN6B 2EM3A 3MHSC 2LT7A 2EJ4A 2EP3A 2EQ0A 2EOSA 1F2IG 2CTDA 1YSAC 2EMCA 1LLMC 2EN6A 2RSIA 1A1KA 2EM7A 2LVHA 1YUJA 2EQ3A 2CT1A 1NCSA 1G2DC 2MDGA 2YRHA 2D9HA 4R2PA 3EPJA 2EMYA 3UK3C 2EQ1A 2YTPA 5KL2A 2EN4A 2ENAA 2GHFA 2EN8A 4R2DA 1MEYC 1ZU1A 2ADRA 3EPLA 1AAYA 2EORA 4WSGA 2BB8A 1A1JA 2EN2A 1A1GA 1A1FA 1DGCA 2EMWA 4X9JA 2EMFA 2EMZA 2EMXA 4R2QA 2EN1A 1JK1A 2DLQA 2EOQA 2EPAA 5KL7A 2EOYA 2EMHA 2EL6A 1G2FC 2EMAA 2EOEA 1TF3A 2EMIA 2ELZA 2EMLA 2YRMA 2YTJA 3VHTB 4R2EA 2YU8A 2WBTA 2GLIA 2YTNA 2DMIA 2YTEA 1X3CA 2LO3A 2EM5A 4M9VC 2EPCA 2EM4A 2WBSA 1ZR9A 2YTFA 2EE8A 2I13A 3M99B 4R2CA 1UBDC 2M9AA 1YUIA 1X6HA 1X6EA 1X6FA 2EM0A 2EOXA 2HGHA 1TN9A 2EOFA 1P47A 1X5WA 2E72A 2EM2A 2NABA 3EPKA 2YSPA 1A1LA 1KJKA 1JK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YTO A;  5KL4 A;  2ENH A;  2YRK A;  2EOH A;  2YTG A;  2EPR A;  2EM9 A;  2YSO A;  1ZAA C;  2EPX A;  4GZN C;  1TF6 A;  3EPH A;  2EMG A;  2A25 A;  2LCE A;  2ELY A;  1Z1B A;  2ENC A;  2LV2 A;  2R1F A;  1A1H A;  1A1I A;  2CSH A;  2EM8 A;  2EOO A;  2EM6 A;  2WBU A;  4R2R A;  2EN7 A;  2YU5 A;  5KL6 A;  2MKN A;  2DLK A;  4F6M A;  1B69 A;  2YTI A;  2EL5 A;  2PRT A;  2EOZ A;  5KL5 A;  2EN3 A;  2EOJ A;  2EMB A;  4F6N A;  2WCC 3;  2JPA A;  1BBO A;  1RMD A;  2JP9 A;  2EPP A;  2YTD A;  4FK5 C;  2EMK A;  3MHH C;  4IJD A;  4R2S A;  5KL3 A;  2MKD A;  4F2J C;  4IS1 C;  1BB8 A;  1WJP A;  2EOI A;  2EOM A;  2DRP A;  2VRD A;  4R2A A;  2YTQ A;  2EL4 A;  2EPZ A;  2RPC A;  2J7J A;  2DGC A;  2EPU A;  1UN6 B;  2EM3 A;  3MHS C;  2LT7 A;  2EJ4 A;  2EP3 A;  2EQ0 A;  2EOS A;  1F2I G;  2CTD A;  1YSA C;  2EMC A;  1LLM C;  2EN6 A;  2RSI A;  1A1K A;  2EM7 A;  2LVH A;  1YUJ A;  2EQ3 A;  2CT1 A;  1NCS A;  1G2D C;  2MDG A;  2YRH A;  2D9H A;  4R2P A;  3EPJ A;  2EMY A;  3UK3 C;  2EQ1 A;  2YTP A;  5KL2 A;  2EN4 A;  2ENA A;  2GHF A;  2EN8 A;  4R2D A;  1MEY C;  1ZU1 A;  2ADR A;  3EPL A;  1AAY A;  2EOR A;  4WSG A;  2BB8 A;  1A1J A;  2EN2 A;  1A1G A;  1A1F A;  1DGC A;  2EMW A;  4X9J A;  2EMF A;  2EMZ A;  2EMX A;  4R2Q A;  2EN1 A;  1JK1 A;  2DLQ A;  2EOQ A;  2EPA A;  5KL7 A;  2EOY A;  2EMH A;  2EL6 A;  1G2F C;  2EMA A;  2EOE A;  1TF3 A;  2EMI A;  2ELZ A;  2EML A;  2YRM A;  2YTJ A;  3VHT B;  4R2E A;  2YU8 A;  2WBT A;  2GLI A;  2YTN A;  2DMI A;  2YTE A;  1X3C A;  2LO3 A;  2EM5 A;  4M9V C;  2EPC A;  2EM4 A;  2WBS A;  1ZR9 A;  2YTF A;  2EE8 A;  2I13 A;  3M99 B;  4R2C A;  1UBD C;  2M9A A;  1YUI A;  1X6H A;  1X6E A;  1X6F A;  2EM0 A;  2EOX A;  2HGH A;  1TN9 A;  2EOF A;  1P47 A;  1X5W A;  2E72 A;  2EM2 A;  2NAB A;  3EPK A;  2YSP A;  1A1L A;  1KJK A;  1JK2 A; 
#chains in the Genus database with same CATH topology
 5KL4 A;  2YRK A;  2YTG A;  2YSO A;  3DF6 A;  1TF6 A;  4BC7 A;  3KZZ A;  1YYW A;  2EPL X;  2ELY A;  1Z1B A;  3HXL A;  2R1F A;  4TUG A;  3JTZ A;  3J80 C;  4I8O A;  4X64 E;  2JXP A;  2EM6 A;  2WBU A;  4R2R A;  2EN7 A;  2YU5 A;  4O24 A;  2LUP B;  2BBG A;  1B69 A;  2YTI A;  4R03 A;  5AAS A;  3ADI A;  4F6N A;  4JI5 E;  2YT4 A;  2FTX B;  1BBO A;  3AV0 A;  2JP9 A;  4HEI A;  5T6J A;  2EMK A;  1YPN A;  3MHH C;  2MC6 A;  5KL3 A;  4JI8 E;  1BB8 A;  1KYQ A;  4LU9 A;  2NUE A;  4BMJ A;  2V83 A;  2DGC A;  4DV7 E;  2V89 A;  3C6M A;  1UN6 B;  1HNZ E;  1XMO E;  2V88 A;  3EQ1 A;  4M2Z A;  2EOS A;  4DUZ E;  2EPO A;  3BBG A;  1ZBT A;  3IWD A;  2JVA A;  1A1K A;  2EM7 A;  2JYA A;  2CT1 A;  2YRH A;  4DV2 E;  4JV5 E;  3EPJ A;  2EMY A;  1X49 A;  3UK3 C;  2EQ1 A;  4LF4 E;  2YTP A;  5A6K A;  1O0W A;  4R8O A;  1T4L B;  2E1M A;  2HHH E;  1ZU1 A;  1MGT A;  1WXR A;  2KON A;  4WSG A;  4DV6 E;  3BF2 A;  3F6H A;  3VYX A;  2EN2 A;  3ADG A;  4LFB E;  4RHB B;  1A1F A;  2LJH A;  1L4S A;  3MSW A;  1XMQ E;  2LE2 A;  2N8X A;  2EOQ A;  4DR5 E;  2EPA A;  4DR3 E;  5LLQ A;  2EPN A;  1PKP A;  4M30 A;  1G2F C;  4GKK E;  2EMA A;  4GKJ E;  4LFA E;  5LMU E;  2EMI A;  2ELZ A;  2EML A;  2MC5 A;  2F4V E;  2YTJ A;  1BBG A;  2JOB A;  2V87 A;  2EM4 A;  4Q28 A;  4ZYD A;  2WBS A;  5A2Q C;  1ZR9 A;  4B3S E;  2EE8 A;  3M99 B;  3FIG A;  4R2C A;  2M9A A;  1YUI A;  1X6H A;  4F9C B;  4WYQ B;  1X5W A;  3EPK A;  1KJK A;  4OOG C;  2L6M A;  2YTO A;  1N3G A;  2EOH A;  2EPX A;  1XNR E;  2M7Q A;  3HPZ A;  3EPH A;  2A25 A;  4ZYE A;  4X62 E;  1A1H A;  2EPM X;  1A1I A;  4LF5 E;  2UXD E;  4F9A B;  1T39 A;  2EZ6 A;  4F6M A;  4BCA A;  2YWQ A;  4L5N C;  5KL5 A;  2EN3 A;  5AC4 A;  2L3J A;  1RMD A;  1GZ6 A;  2EPP A;  5LMN E;  3HTX A;  2WZO A;  1A1L A;  4ZYH A;  2EOM A;  2DRP A;  3H09 A;  3KZY A;  3F6G A;  2J7J A;  5A6B A;  3VYY A;  2JR1 A;  1EH8 A;  4BBY A;  4BHC A;  1HR0 E;  3MHS C;  4P78 A;  4JI2 E;  2L8T A;  4K0K E;  3THO B;  5ADZ A;  1LLM C;  4BC9 A;  2EN6 A;  1YUJ A;  3K6Q A;  4P7D A;  2EQ3 A;  2VE7 C;  2L3C A;  1DQ3 A;  2DB2 A;  1T4O A;  5IXM B;  1YZ9 A;  2NUG A;  4R2D A;  1MEY C;  2ADR A;  3EPL A;  4LF8 E;  3LLH A;  1EH6 A;  2BB8 A;  4O4K A;  2UUA E;  1N32 E;  1UIL A;  4MLV A;  2E5L E;  1DGC A;  4JI6 E;  2LTS A;  4GEQ B;  2EMX A;  4YY3 E;  2EN1 A;  2G7H A;  4JI1 E;  3T1Y E;  2EOY A;  4YHH E;  3L00 A;  1IBM E;  2EL6 A;  2B7V A;  2EPK X;  2EOE A;  4NZV A;  5LL6 R;  2L2K B;  2VF1 A;  3QG5 C;  3J81 C;  5BR8 E;  4DV3 E;  2WBT A;  2GLI A;  4ZYG A;  2RTX A;  2EPC A;  1STU A;  2LRS A;  4TUI A;  2I9I A;  5AE2 A;  2FGG A;  2HC5 A;  2LMZ A;  4LF9 E;  2LBS B;  1UBD C;  1FJG E;  3HQ1 A;  1X47 A;  5F3W A;  3IWB A;  2EOF A;  5TSE A;  2E72 A;  2EM2 A;  2UUB E;  2NAB A;  4JI7 E;  5FLX C;  2F8B A;  2DMY A;  2V86 A;  4WPY A;  2ENH A;  2KHX A;  2EPR A;  2EM9 A;  1ZAA C;  1HNX E;  1PDA A;  3AUZ A;  1EH7 A;  2EMG A;  2LCE A;  3OML A;  2YPN A;  2ENC A;  2LV2 A;  3RMP A;  2V85 A;  2ODR D;  2EM8 A;  2EOO A;  5KL6 A;  2MKN A;  1WRJ A;  2DLK A;  2EL5 A;  2PRT A;  2EOZ A;  1YYK A;  1N33 E;  2EOJ A;  4DKK A;  4RH8 A;  2WCC 3;  2UXB E;  4MLQ A;  4NHR A;  1YFH A;  2EWL A;  2YTD A;  4F9B B;  3J7Y p;  1I94 E;  2RQL A;  2NUF A;  4F2J C;  4IS1 C;  1WJP A;  4DR4 E;  2EL4 A;  2EPZ A;  3C6K A;  1N34 E;  4JYA E;  3P1X A;  1QNT A;  2LT7 A;  2EQ0 A;  4B3M E;  2CTD A;  1YSA C;  5A6B D;  2HJJ A;  4X65 E;  5A69 A;  3LML A;  5CFF E;  2LVH A;  2CPN A;  4OX9 E;  2MDG A;  4R2P A;  3ZOQ B;  1PJQ A;  2YZT A;  2B7T A;  1J5E E;  4B3R E;  4DV5 E;  1AAY A;  1A1J A;  1A1G A;  4O5G A;  4JI4 E;  5AC5 A;  4WX9 A;  4DUY E;  4X66 E;  4X9J A;  1NEI A;  1SR9 A;  2GPI A;  4DV4 E;  5DNY A;  3OTO E;  1JK1 A;  4LF7 E;  2DLQ A;  4DR6 E;  2RSM A;  5KL7 A;  2N3H A;  2EMH A;  2M4I A;  4AQY E;  5A6A A;  1TF3 A;  1XNQ E;  2YRM A;  3ADL A;  1AH5 A;  4N4R B;  2YTE A;  1X3C A;  2LO3 A;  2JY9 A;  4M9V C;  3JU0 A;  5IWA E;  4B3T E;  2L33 A;  3ECR A;  1X6E A;  1X6F A;  3C4B A;  4BHB A;  2V8Q B;  1FKA E;  1TN9 A;  2UUC E;  4LFC E;  4NXN E;  1QU6 A;  2RS7 A;  2RS6 A;  4J8Z A;  4KHP E;  1JK2 A;  4LTY A;  4F54 A;  2K4V A;  3IWC A;  4GZN C;  1X48 A;  4DR1 E;  2IHR 1;  1IQO A;  3C4T A;  3KWR A;  1N36 E;  2DIX A;  3HPS A;  2CSH A;  1IQS A;  3ADJ A;  4JI0 E;  2JWO A;  5IV8 B;  2EMB A;  1UHZ A;  4DR7 E;  4O43 A;  2JPA A;  2FV4 B;  1PJS A;  4LF6 E;  2LUQ A;  2ZM6 E;  1T4N A;  2UU9 E;  4FK5 C;  4M0V A;  4IJD A;  4R2S A;  2MKD A;  2EOI A;  2VRD A;  4R2A A;  5IT9 C;  3TQM A;  2YTQ A;  4WXC A;  2RPC A;  4NXM E;  2R76 A;  2EPU A;  4DR2 E;  2L92 A;  4WFT A;  1GQE A;  2EM3 A;  4HTG A;  1SFE A;  1ZBQ A;  3VK6 A;  2EJ4 A;  2EP3 A;  3J7A G;  1GTK A;  4WSP A;  1PJT A;  1F2I G;  2EMC A;  1RC7 A;  1IBK E;  2JOX A;  4JI3 E;  2UXC E;  2VQF E;  2ODR C;  2RSI A;  3DJW A;  2DSY A;  1NCS A;  1IBL E;  2Q8U A;  4DMI A;  2D9H A;  1G2D C;  1EKZ A;  2LJU A;  5KL2 A;  2NA2 A;  4L8N A;  2EN4 A;  2ENA A;  2GHF A;  2EN8 A;  1YYO A;  5AE1 A;  1DI2 A;  1HNW E;  2L2M A;  4DV1 E;  2EOR A;  1WHQ A;  3JAM C;  2B9D A;  2EMW A;  1T38 A;  3BGH A;  2EMF A;  2EMZ A;  2N3G A;  4R2Q A;  3THN A;  1RQ0 A;  2MDR A;  1IMU A;  4X8W A;  3VHT B;  2M1S A;  4WXD A;  2KOU A;  4R2E A;  2YU8 A;  5A6J A;  2YTN A;  4Q35 B;  2DMI A;  2EM5 A;  3T1H E;  2L2N A;  2YTF A;  2LTR A;  3BID A;  2I13 A;  1J26 A;  5AE3 A;  2EM0 A;  2EOX A;  2HGH A;  2K7I A;  2H36 X;  1WHN A;  4BS9 A;  2VQE E;  1P47 A;  2B3T B;  4KZS A;  2YSP A;  4DV0 E;  4KWY A; 
#chains in the Genus database with same CATH homology
 2YTO A;  5KL4 A;  2ENH A;  2YRK A;  2EOH A;  2YTG A;  2EPR A;  2EM9 A;  2YSO A;  1ZAA C;  2EPX A;  4GZN C;  1TF6 A;  3EPH A;  2EMG A;  2A25 A;  2LCE A;  2ELY A;  1Z1B A;  2ENC A;  2LV2 A;  2R1F A;  1A1H A;  1A1I A;  2CSH A;  2EM8 A;  2EOO A;  2EM6 A;  2WBU A;  4R2R A;  2EN7 A;  2YU5 A;  5KL6 A;  2MKN A;  2DLK A;  4F6M A;  1B69 A;  2YTI A;  2EL5 A;  2PRT A;  2EOZ A;  5KL5 A;  2EN3 A;  2EOJ A;  2EMB A;  4F6N A;  2WCC 3;  2JPA A;  1BBO A;  1RMD A;  2JP9 A;  2EPP A;  2YTD A;  4FK5 C;  2EMK A;  3MHH C;  4IJD A;  4R2S A;  5KL3 A;  2MKD A;  4F2J C;  4IS1 C;  1BB8 A;  1WJP A;  2EOI A;  2EOM A;  2DRP A;  2VRD A;  4R2A A;  2YTQ A;  2EL4 A;  2EPZ A;  2RPC A;  2J7J A;  2DGC A;  2EPU A;  1UN6 B;  2EM3 A;  3MHS C;  2LT7 A;  2EJ4 A;  2EP3 A;  2EQ0 A;  2EOS A;  1F2I G;  2CTD A;  1YSA C;  2EMC A;  1LLM C;  2EN6 A;  2RSI A;  1A1K A;  2EM7 A;  2LVH A;  1YUJ A;  2EQ3 A;  2CT1 A;  1NCS A;  1G2D C;  2MDG A;  2YRH A;  2D9H A;  4R2P A;  3EPJ A;  2EMY A;  3UK3 C;  2EQ1 A;  2YTP A;  5KL2 A;  2EN4 A;  2ENA A;  2GHF A;  2EN8 A;  4R2D A;  1MEY C;  1ZU1 A;  2ADR A;  3EPL A;  1AAY A;  2EOR A;  4WSG A;  2BB8 A;  1A1J A;  2EN2 A;  1A1G A;  1A1F A;  1DGC A;  2EMW A;  4X9J A;  2EMF A;  2EMZ A;  2EMX A;  4R2Q A;  2EN1 A;  1JK1 A;  2DLQ A;  2EOQ A;  2EPA A;  5KL7 A;  2EOY A;  2EMH A;  2EL6 A;  1G2F C;  2EMA A;  2EOE A;  1TF3 A;  2EMI A;  2ELZ A;  2EML A;  2YRM A;  2YTJ A;  3VHT B;  4R2E A;  2YU8 A;  2WBT A;  2GLI A;  2YTN A;  2DMI A;  2YTE A;  1X3C A;  2LO3 A;  2EM5 A;  4M9V C;  2EPC A;  2EM4 A;  2WBS A;  1ZR9 A;  2YTF A;  2EE8 A;  2I13 A;  3M99 B;  4R2C A;  1UBD C;  2M9A A;  1YUI A;  1X6H A;  1X6E A;  1X6F A;  2EM0 A;  2EOX A;  2HGH A;  1TN9 A;  2EOF A;  1P47 A;  1X5W A;  2E72 A;  2EM2 A;  2NAB A;  3EPK A;  2YSP A;  1A1L A;  1KJK A;  1JK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...