2EMGA

Solution structure of the c2h2 type zinc finger (region 463-495) of human zinc finger protein 484
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGENPFICSECGKVFTHKTNLIIHQKIHTGERPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 484
publication title Solution structure of the C2H2 type zinc finger (region 463-495) of human Zinc finger protein 484
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emgA01
2MKDA 4X9JA 2EM6A 2LVHA 3MHHC 2EMBA 2R1FA 2EMGA 2YTJA 2EMIA 2EOQA 1MEYC 2WBTA 1BB8A 2YU8A 2CTDA 1X5WA 2EM2A 2DRPA 2DGCA 1YUJA 2M9AA 2EQ3A 2LT7A 1DGCA 2YTPA 4R2EA 2EMFA 2GHFA 2MKNA 2EM8A 1B69A 2EP3A 1G2DC 1YSAC 2EPXA 1JK2A 2EMKA 1A1FA 2EPZA 2EN2A 2JPAA 2NABA 1A1GA 2EOEA 2EN4A 1G2FC 2EJ4A 2EPPA 2WCC3 2ADRA 1X3CA 5KL2A 1YUIA 2RSIA 2EPRA 2EE8A 2EM4A 4R2AA 1P47A 1WJPA 1A1HA 1UN6B 2RPCA 4WSGA 2EMHA 2EL5A 2E72A 2DMIA 4R2QA 1X6HA 4F6MA 3EPKA 2EM0A 3EPJA 2GLIA 2EM3A 2EN6A 2YSPA 1KJKA 2EN3A 2YRHA 2A25A 2YTEA 2YSOA 1X6FA 2EN8A 2EM9A 1JK1A 2HGHA 2ELYA 4R2RA 2J7JA 4R2PA 2EMZA 1TF6A 2YTOA 2ENHA 2MDGA 1ZAAC 1F2IG 2YU5A 2EM7A 2EM5A 3VHTB 1ZU1A 2EMAA 5KL7A 1A1KA 2VRDA 2YRMA 1A1IA 1BBOA 4M9VC 2YTNA 2EQ1A 2JP9A 2EOHA 2EORA 2WBSA 1AAYA 2EOIA 1NCSA 2LV2A 1X6EA 2EOXA 4IJDA 2WBUA 2I13A 4FK5C 2EOZA 2EOOA 5KL5A 4R2SA 1A1LA 1UBDC 2EN1A 4F2JC 2ELZA 2YTQA 2DLQA 2EN7A 2EQ0A 2D9HA 2YRKA 1RMDA 3EPLA 5KL4A 4F6NA 2CSHA 2EMXA 2YTIA 4GZNC 2EOMA 3UK3C 2ENAA 1A1JA 2EL6A 2DLKA 2EL4A 5KL3A 2EPUA 2EPAA 4R2DA 2BB8A 2CT1A 2EOSA 2LCEA 1TF3A 2EOJA 2YTDA 2EPCA 3M99B 1Z1BA 2EOYA 2EMYA 4IS1C 2PRTA 2EMWA 3EPHA 2YTFA 4R2CA 5KL6A 2YTGA 2EOFA 1ZR9A 2ENCA 2EMCA 1LLMC 3MHSC 2LO3A 2EMLA 1TN9A
chains in the Genus database with same CATH superfamily
4WYQB 4X9JA 3L00A 4ZYGA 1ZBQA 3KZZA 3H09A 2EMBA 4YHHE 3FIGA 2EOQA 2WBTA 1BB8A 2N3GA 3LMLA 2MDRA 1YUJA 4DR4E 1IQOA 2EQ3A 2KOUA 3C4BA 4DV7E 2GHFA 2VE7C 2EP3A 1YSAC 1ZBTA 3HPZA 1A1FA 2EPZA 1HR0E 2JPAA 4B3RE 2EOEA 2EN4A 2EZ6A 4DV6E 2LJHA 2WCC3 3OMLA 2EPOA 1X3CA 3C4TA 3F6GA 2EM4A 1UN6B 1A1HA 2EWLA 2UU9E 2RS7A 2JWOA 1WRJA 1SFEA 2V85A 2EM0A 4KZSA 1N32E 1GZ6A 4M0VA 2VQEE 2EN3A 2M1SA 2HJJA 1FKAE 2DSYA 2HGHA 2JY9A 4WXDA 3BF2A 2LJUA 2ENHA 1ZAAC 2UXDE 2EM7A 4YY3E 2EMAA 3ADJA 1HNZE 2YRMA 2JYAA 5DNYA 2VF1A 2EORA 2WBSA 5A69A 3J81C 2LV2A 2I13A 5A6JA 4R2SA 5AC5A 2V89A 1YFHA 4TUGA 2DLQA 2EN7A 4B3SE 4LF8E 4O5GA 2D9HA 3RMPA 2NUEA 2YRKA 4NZVA 4F6NA 3VK6A 2EOMA 4WXCA 2ENAA 2CT1A 4NXNE 4JYAE 1TF3A 1N3GA 3P1XA 4P78A 2V8QB 5A2QC 5IV8B 2RTXA 2N8XA 4R2CA 5KL6A 2YTGA 3QG5C 1RC7A 4KHPE 2VQFE 1TN9A 2LO3A 4JI6E 1XNQE 2FGGA 1EH8A 4LU9A 3KWRA 3HTXA 4JI1E 1XMQE 1MGTA 3MHHC 2V86A 2R1FA 2YTJA 2EMIA 3C6KA 1YYWA 1YYOA 2YU8A 1PDAA 2CTDA 2ODRD 2DRPA 2CPNA 2DGCA 4L5NC 2BBGA 4LFBE 1PKPA 2UUCE 4BCAA 1GTKA 4R2EA 3T1YE 2MKNA 2LE2A 2RSMA 1G2DC 2K7IA 4X8WA 5LLQA 1N36E 1JK2A 2EN2A 3EQ1A 3KZYA 1A1GA 2NA2A 1G2FC 4LF5E 2EPPA 2KHXA 1YUIA 3BIDA 2UXCE 4JI3E 3J80C 5LL6R 2FV4B 2EMHA 2EL5A 2K4VA 2DMIA 4R2QA 4LFCE 4BC9A 4F6MA 4DV3E 2LMZA 4X65E 2EN6A 2YSPA 1KJKA 4R03A 1YPNA 1IBKE 2B7TA 2YSOA 1X6FA 2EN8A 2EM9A 1SR9A 4HTGA 3JAMC 2YTOA 1STUA 3BGHA 2N3HA 2MDGA 3DJWA 1DI2A 3IWDA 4ZYHA 3J7AG 1EKZA 5KL7A 2I9IA 1N33E 5A6KA 2M4IA 1AAYA 2L92A 1NCSA 4DR1E 2GPIA 2EOXA 2V87A 4FK5C 2F4VE 2EOZA 1KYQA 4Q35B 1A1LA 1UBDC 4B3ME 3OTOE 2EN1A 4F2JC 3K6QA 2YTQA 4LF6E 4BHBA 3C6MA 3F6HA 3EPLA 1T39A 2CSHA 2B7VA 2JOXA 3BBGA 5LMNE 4BC7A 2JVAA 2EL6A 2DLKA 2EL4A 2IHR1 3VYYA 5F3WA 2BB8A 4JI7E 4O24A 2JOBA 2EPCA 3M99B 2EOYA 2EMYA 4IS1C 2DB2A 1HNXE 3EPHA 2L2KB 2EOFA 2F8BA 2G7HA 4DUZE 2YWQA 2EMCA 4JV5E 1IBLE 1NEIA 3HPSA 2L2MA 5IXMB 1DQ3A 4Q28A 2MKDA 4ZYDA 3ADLA 5AE2A 2L3JA 4LTYA 2YZTA 4DR7E 2EMGA 3ADIA 2RQLA 2V83A 2H36X 4NHRA 4WX9A 4MLQA 2YT4A 2EPLX 1DGCA 4GEQB 4DV4E 2FTXB 2EM8A 2NUFA 1YZ9A 4F9CB 4OOGC 2LUQA 2EMKA 1J26A 1UILA 4MLVA 4F9BB 1N34E 2NUGA 4JI8E 4OX9E 2RSIA 4R2AA 1IMUA 2RPCA 1WHQA 5LMUE 4DV2E 2MC5A 4O4KA 1X6HA 3TQMA 3EPKA 2GLIA 2LRSA 4DR2E 2YRHA 2A25A 2YTEA 1JK1A 4R2RA 4X64E 2DIXA 1TF6A 4KWYA 5IWAE 2HHHE 4M30A 1RQ0A 2V88A 2JXPA 4WSPA 4DV5E 4DUYE 2EPMX 3VHTB 1A1KA 1O0WA 2VRDA 4JI0E 1T4NA 4WFTA 4NXME 1A1IA 2YTNA 4RHBB 2JP9A 2EOHA 5IT9C 4BMJA 2L8TA 3J7Yp 4IJDA 2ZM6E 4GKJE 4WPYA 4RH8A 1WHNA 1XNRE 2L33A 2ELZA 3HXLA 2EQ0A 3THNA 2HC5A 3THOB 4GZNC 2LTRA 2EMXA 2B9DA 3AUZA 3UK3C 5A6BA 2L2NA 1EH6A 2EPAA 4R2DA 1GQEA 5FLXC 1J5EE 4M2ZA 4K0KE 1Z1BA 1X48A 1QNTA 5A6AA 4R8OA 2B3TB 2EMWA 3JU0A 2YTFA 3ECRA 1IQSA 4DR5E 1ZR9A 5A6BD 2ODRC 2ENCA 2EPKX 1LLMC 3MHSC 4O43A 3HQ1A 4N4RB 2UXBE 2LBSB 4DKKA 4GKKE 3ADGA 2EM6A 4ZYEA 2LVHA 4DR6E 4BS9A 3MSWA 5CFFE 1T4LB 1PJSA 1MEYC 4JI4E 1UHZA 1X5WA 2EM2A 1FJGE 2RS6A 2M9AA 3VYXA 3IWBA 2LT7A 4LFAE 5AE3A 4HEIA 2YTPA 2EMFA 4F54A 2KONA 1B69A 4LF7E 2EPXA 4DV1E 1AH5A 3AV0A 2NABA 2EJ4A 5AASA 2ADRA 1PJQA 1X47A 1X49A 1HNWE 5KL2A 2EPRA 1L4SA 2EE8A 1P47A 1WJPA 4WSGA 2E72A 2Q8UA 3EPJA 2EM3A 2EPNA 4BBYA 2E5LE 5AC4A 2ELYA 4DMIA 2J7JA 2UUBE 5AE1A 4I8OA 4BHCA 1QU6A 2EMZA 4R2PA 5T6JA 1T38A 2L6MA 3T1HE 1F2IG 2M7QA 4J8ZA 2YU5A 4DR3E 2EM5A 1ZU1A 4B3TE 1XMOE 1BBOA 2YPNA 4M9VC 2EQ1A 3LLHA 2MC6A 2EOIA 1BBGA 5TSEA 2E1MA 5BR8E 2UUAE 1I94E 1X6EA 2WBUA 4F9AB 4DV0E 4LF4E 2EOOA 5KL5A 4X66E 2JR1A 1YYKA 5ADZA 3JTZA 1RMDA 5KL4A 2WZOA 2YTIA 1IBME 2R76A 1A1JA 4P7DA 2EPUA 5KL3A 4JI2E 2DMYA 2EOSA 1T4OA 2LCEA 4AQYE 2EOJA 2YTDA 1EH7A 1WXRA 2LTSA 3ZOQB 4TUIA 2L3CA 2PRTA 3IWCA 3DF6A 1PJTA 4JI5E 4L8NA 4LF9E 4X62E 2LUPB 2EMLA
chains in the Genus database with same CATH topology
2MKDA 4X9JA 2EM6A 2LVHA 3MHHC 2EMBA 2R1FA 2EMGA 2YTJA 2EMIA 2EOQA 1MEYC 2WBTA 1BB8A 2YU8A 2CTDA 1X5WA 2EM2A 2DRPA 2DGCA 1YUJA 2M9AA 2EQ3A 2LT7A 1DGCA 2YTPA 4R2EA 2EMFA 2GHFA 2MKNA 2EM8A 1B69A 2EP3A 1G2DC 1YSAC 2EPXA 1JK2A 2EMKA 1A1FA 2EPZA 2EN2A 2JPAA 2NABA 1A1GA 2EOEA 2EN4A 1G2FC 2EJ4A 2EPPA 2WCC3 2ADRA 1X3CA 5KL2A 1YUIA 2RSIA 2EPRA 2EE8A 2EM4A 4R2AA 1P47A 1WJPA 1A1HA 1UN6B 2RPCA 4WSGA 2EMHA 2EL5A 2E72A 2DMIA 4R2QA 1X6HA 4F6MA 3EPKA 2EM0A 3EPJA 2GLIA 2EM3A 2EN6A 2YSPA 1KJKA 2EN3A 2YRHA 2A25A 2YTEA 2YSOA 1X6FA 2EN8A 2EM9A 1JK1A 2HGHA 2ELYA 4R2RA 2J7JA 4R2PA 2EMZA 1TF6A 2YTOA 2ENHA 2MDGA 1ZAAC 1F2IG 2YU5A 2EM7A 2EM5A 3VHTB 1ZU1A 2EMAA 5KL7A 1A1KA 2VRDA 2YRMA 1A1IA 1BBOA 4M9VC 2YTNA 2EQ1A 2JP9A 2EOHA 2EORA 2WBSA 1AAYA 2EOIA 1NCSA 2LV2A 1X6EA 2EOXA 4IJDA 2WBUA 2I13A 4FK5C 2EOZA 2EOOA 5KL5A 4R2SA 1A1LA 1UBDC 2EN1A 4F2JC 2ELZA 2YTQA 2DLQA 2EN7A 2EQ0A 2D9HA 2YRKA 1RMDA 3EPLA 5KL4A 4F6NA 2CSHA 2EMXA 2YTIA 4GZNC 2EOMA 3UK3C 2ENAA 1A1JA 2EL6A 2DLKA 2EL4A 5KL3A 2EPUA 2EPAA 4R2DA 2BB8A 2CT1A 2EOSA 2LCEA 1TF3A 2EOJA 2YTDA 2EPCA 3M99B 1Z1BA 2EOYA 2EMYA 4IS1C 2PRTA 2EMWA 3EPHA 2YTFA 4R2CA 5KL6A 2YTGA 2EOFA 1ZR9A 2ENCA 2EMCA 1LLMC 3MHSC 2LO3A 2EMLA 1TN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MKD A;  4X9J A;  2EM6 A;  2LVH A;  3MHH C;  2EMB A;  2R1F A;  2EMG A;  2YTJ A;  2EMI A;  2EOQ A;  1MEY C;  2WBT A;  1BB8 A;  2YU8 A;  2CTD A;  1X5W A;  2EM2 A;  2DRP A;  2DGC A;  1YUJ A;  2M9A A;  2EQ3 A;  2LT7 A;  1DGC A;  2YTP A;  4R2E A;  2EMF A;  2GHF A;  2MKN A;  2EM8 A;  1B69 A;  2EP3 A;  1G2D C;  1YSA C;  2EPX A;  1JK2 A;  2EMK A;  1A1F A;  2EPZ A;  2EN2 A;  2JPA A;  2NAB A;  1A1G A;  2EOE A;  2EN4 A;  1G2F C;  2EJ4 A;  2EPP A;  2WCC 3;  2ADR A;  1X3C A;  5KL2 A;  1YUI A;  2RSI A;  2EPR A;  2EE8 A;  2EM4 A;  4R2A A;  1P47 A;  1WJP A;  1A1H A;  1UN6 B;  2RPC A;  4WSG A;  2EMH A;  2EL5 A;  2E72 A;  2DMI A;  4R2Q A;  1X6H A;  4F6M A;  3EPK A;  2EM0 A;  3EPJ A;  2GLI A;  2EM3 A;  2EN6 A;  2YSP A;  1KJK A;  2EN3 A;  2YRH A;  2A25 A;  2YTE A;  2YSO A;  1X6F A;  2EN8 A;  2EM9 A;  1JK1 A;  2HGH A;  2ELY A;  4R2R A;  2J7J A;  4R2P A;  2EMZ A;  1TF6 A;  2YTO A;  2ENH A;  2MDG A;  1ZAA C;  1F2I G;  2YU5 A;  2EM7 A;  2EM5 A;  3VHT B;  1ZU1 A;  2EMA A;  5KL7 A;  1A1K A;  2VRD A;  2YRM A;  1A1I A;  1BBO A;  4M9V C;  2YTN A;  2EQ1 A;  2JP9 A;  2EOH A;  2EOR A;  2WBS A;  1AAY A;  2EOI A;  1NCS A;  2LV2 A;  1X6E A;  2EOX A;  4IJD A;  2WBU A;  2I13 A;  4FK5 C;  2EOZ A;  2EOO A;  5KL5 A;  4R2S A;  1A1L A;  1UBD C;  2EN1 A;  4F2J C;  2ELZ A;  2YTQ A;  2DLQ A;  2EN7 A;  2EQ0 A;  2D9H A;  2YRK A;  1RMD A;  3EPL A;  5KL4 A;  4F6N A;  2CSH A;  2EMX A;  2YTI A;  4GZN C;  2EOM A;  3UK3 C;  2ENA A;  1A1J A;  2EL6 A;  2DLK A;  2EL4 A;  5KL3 A;  2EPU A;  2EPA A;  4R2D A;  2BB8 A;  2CT1 A;  2EOS A;  2LCE A;  1TF3 A;  2EOJ A;  2YTD A;  2EPC A;  3M99 B;  1Z1B A;  2EOY A;  2EMY A;  4IS1 C;  2PRT A;  2EMW A;  3EPH A;  2YTF A;  4R2C A;  5KL6 A;  2YTG A;  2EOF A;  1ZR9 A;  2ENC A;  2EMC A;  1LLM C;  3MHS C;  2LO3 A;  2EML A;  1TN9 A; 
#chains in the Genus database with same CATH topology
 4WYQ B;  4X9J A;  3L00 A;  4ZYG A;  1ZBQ A;  3KZZ A;  3H09 A;  2EMB A;  4YHH E;  3FIG A;  2EOQ A;  2WBT A;  1BB8 A;  2N3G A;  3LML A;  2MDR A;  1YUJ A;  4DR4 E;  1IQO A;  2EQ3 A;  2KOU A;  3C4B A;  4DV7 E;  2GHF A;  2VE7 C;  2EP3 A;  1YSA C;  1ZBT A;  3HPZ A;  1A1F A;  2EPZ A;  1HR0 E;  2JPA A;  4B3R E;  2EOE A;  2EN4 A;  2EZ6 A;  4DV6 E;  2LJH A;  2WCC 3;  3OML A;  2EPO A;  1X3C A;  3C4T A;  3F6G A;  2EM4 A;  1UN6 B;  1A1H A;  2EWL A;  2UU9 E;  2RS7 A;  2JWO A;  1WRJ A;  1SFE A;  2V85 A;  2EM0 A;  4KZS A;  1N32 E;  1GZ6 A;  4M0V A;  2VQE E;  2EN3 A;  2M1S A;  2HJJ A;  1FKA E;  2DSY A;  2HGH A;  2JY9 A;  4WXD A;  3BF2 A;  2LJU A;  2ENH A;  1ZAA C;  2UXD E;  2EM7 A;  4YY3 E;  2EMA A;  3ADJ A;  1HNZ E;  2YRM A;  2JYA A;  5DNY A;  2VF1 A;  2EOR A;  2WBS A;  5A69 A;  3J81 C;  2LV2 A;  2I13 A;  5A6J A;  4R2S A;  5AC5 A;  2V89 A;  1YFH A;  4TUG A;  2DLQ A;  2EN7 A;  4B3S E;  4LF8 E;  4O5G A;  2D9H A;  3RMP A;  2NUE A;  2YRK A;  4NZV A;  4F6N A;  3VK6 A;  2EOM A;  4WXC A;  2ENA A;  2CT1 A;  4NXN E;  4JYA E;  1TF3 A;  1N3G A;  3P1X A;  4P78 A;  2V8Q B;  5A2Q C;  5IV8 B;  2RTX A;  2N8X A;  4R2C A;  5KL6 A;  2YTG A;  3QG5 C;  1RC7 A;  4KHP E;  2VQF E;  1TN9 A;  2LO3 A;  4JI6 E;  1XNQ E;  2FGG A;  1EH8 A;  4LU9 A;  3KWR A;  3HTX A;  4JI1 E;  1XMQ E;  1MGT A;  3MHH C;  2V86 A;  2R1F A;  2YTJ A;  2EMI A;  3C6K A;  1YYW A;  1YYO A;  2YU8 A;  1PDA A;  2CTD A;  2ODR D;  2DRP A;  2CPN A;  2DGC A;  4L5N C;  2BBG A;  4LFB E;  1PKP A;  2UUC E;  4BCA A;  1GTK A;  4R2E A;  3T1Y E;  2MKN A;  2LE2 A;  2RSM A;  1G2D C;  2K7I A;  4X8W A;  5LLQ A;  1N36 E;  1JK2 A;  2EN2 A;  3EQ1 A;  3KZY A;  1A1G A;  2NA2 A;  1G2F C;  4LF5 E;  2EPP A;  2KHX A;  1YUI A;  3BID A;  2UXC E;  4JI3 E;  3J80 C;  5LL6 R;  2FV4 B;  2EMH A;  2EL5 A;  2K4V A;  2DMI A;  4R2Q A;  4LFC E;  4BC9 A;  4F6M A;  4DV3 E;  2LMZ A;  4X65 E;  2EN6 A;  2YSP A;  1KJK A;  4R03 A;  1YPN A;  1IBK E;  2B7T A;  2YSO A;  1X6F A;  2EN8 A;  2EM9 A;  1SR9 A;  4HTG A;  3JAM C;  2YTO A;  1STU A;  3BGH A;  2N3H A;  2MDG A;  3DJW A;  1DI2 A;  3IWD A;  4ZYH A;  3J7A G;  1EKZ A;  5KL7 A;  2I9I A;  1N33 E;  5A6K A;  2M4I A;  1AAY A;  2L92 A;  1NCS A;  4DR1 E;  2GPI A;  2EOX A;  2V87 A;  4FK5 C;  2F4V E;  2EOZ A;  1KYQ A;  4Q35 B;  1A1L A;  1UBD C;  4B3M E;  3OTO E;  2EN1 A;  4F2J C;  3K6Q A;  2YTQ A;  4LF6 E;  4BHB A;  3C6M A;  3F6H A;  3EPL A;  1T39 A;  2CSH A;  2B7V A;  2JOX A;  3BBG A;  5LMN E;  4BC7 A;  2JVA A;  2EL6 A;  2DLK A;  2EL4 A;  2IHR 1;  3VYY A;  5F3W A;  2BB8 A;  4JI7 E;  4O24 A;  2JOB A;  2EPC A;  3M99 B;  2EOY A;  2EMY A;  4IS1 C;  2DB2 A;  1HNX E;  3EPH A;  2L2K B;  2EOF A;  2F8B A;  2G7H A;  4DUZ E;  2YWQ A;  2EMC A;  4JV5 E;  1IBL E;  1NEI A;  3HPS A;  2L2M A;  5IXM B;  1DQ3 A;  4Q28 A;  2MKD A;  4ZYD A;  3ADL A;  5AE2 A;  2L3J A;  4LTY A;  2YZT A;  4DR7 E;  2EMG A;  3ADI A;  2RQL A;  2V83 A;  2H36 X;  4NHR A;  4WX9 A;  4MLQ A;  2YT4 A;  2EPL X;  1DGC A;  4GEQ B;  4DV4 E;  2FTX B;  2EM8 A;  2NUF A;  1YZ9 A;  4F9C B;  4OOG C;  2LUQ A;  2EMK A;  1J26 A;  1UIL A;  4MLV A;  4F9B B;  1N34 E;  2NUG A;  4JI8 E;  4OX9 E;  2RSI A;  4R2A A;  1IMU A;  2RPC A;  1WHQ A;  5LMU E;  4DV2 E;  2MC5 A;  4O4K A;  1X6H A;  3TQM A;  3EPK A;  2GLI A;  2LRS A;  4DR2 E;  2YRH A;  2A25 A;  2YTE A;  1JK1 A;  4R2R A;  4X64 E;  2DIX A;  1TF6 A;  4KWY A;  5IWA E;  2HHH E;  4M30 A;  1RQ0 A;  2V88 A;  2JXP A;  4WSP A;  4DV5 E;  4DUY E;  2EPM X;  3VHT B;  1A1K A;  1O0W A;  2VRD A;  4JI0 E;  1T4N A;  4WFT A;  4NXM E;  1A1I A;  2YTN A;  4RHB B;  2JP9 A;  2EOH A;  5IT9 C;  4BMJ A;  2L8T A;  3J7Y p;  4IJD A;  2ZM6 E;  4GKJ E;  4WPY A;  4RH8 A;  1WHN A;  1XNR E;  2L33 A;  2ELZ A;  3HXL A;  2EQ0 A;  3THN A;  2HC5 A;  3THO B;  4GZN C;  2LTR A;  2EMX A;  2B9D A;  3AUZ A;  3UK3 C;  5A6B A;  2L2N A;  1EH6 A;  2EPA A;  4R2D A;  1GQE A;  5FLX C;  1J5E E;  4M2Z A;  4K0K E;  1Z1B A;  1X48 A;  1QNT A;  5A6A A;  4R8O A;  2B3T B;  2EMW A;  3JU0 A;  2YTF A;  3ECR A;  1IQS A;  4DR5 E;  1ZR9 A;  5A6B D;  2ODR C;  2ENC A;  2EPK X;  1LLM C;  3MHS C;  4O43 A;  3HQ1 A;  4N4R B;  2UXB E;  2LBS B;  4DKK A;  4GKK E;  3ADG A;  2EM6 A;  4ZYE A;  2LVH A;  4DR6 E;  4BS9 A;  3MSW A;  5CFF E;  1T4L B;  1PJS A;  1MEY C;  4JI4 E;  1UHZ A;  1X5W A;  2EM2 A;  1FJG E;  2RS6 A;  2M9A A;  3VYX A;  3IWB A;  2LT7 A;  4LFA E;  5AE3 A;  4HEI A;  2YTP A;  2EMF A;  4F54 A;  2KON A;  1B69 A;  4LF7 E;  2EPX A;  4DV1 E;  1AH5 A;  3AV0 A;  2NAB A;  2EJ4 A;  5AAS A;  2ADR A;  1PJQ A;  1X47 A;  1X49 A;  1HNW E;  5KL2 A;  2EPR A;  1L4S A;  2EE8 A;  1P47 A;  1WJP A;  4WSG A;  2E72 A;  2Q8U A;  3EPJ A;  2EM3 A;  2EPN A;  4BBY A;  2E5L E;  5AC4 A;  2ELY A;  4DMI A;  2J7J A;  2UUB E;  5AE1 A;  4I8O A;  4BHC A;  1QU6 A;  2EMZ A;  4R2P A;  5T6J A;  1T38 A;  2L6M A;  3T1H E;  1F2I G;  2M7Q A;  4J8Z A;  2YU5 A;  4DR3 E;  2EM5 A;  1ZU1 A;  4B3T E;  1XMO E;  1BBO A;  2YPN A;  4M9V C;  2EQ1 A;  3LLH A;  2MC6 A;  2EOI A;  1BBG A;  5TSE A;  2E1M A;  5BR8 E;  2UUA E;  1I94 E;  1X6E A;  2WBU A;  4F9A B;  4DV0 E;  4LF4 E;  2EOO A;  5KL5 A;  4X66 E;  2JR1 A;  1YYK A;  5ADZ A;  3JTZ A;  1RMD A;  5KL4 A;  2WZO A;  2YTI A;  1IBM E;  2R76 A;  1A1J A;  4P7D A;  2EPU A;  5KL3 A;  4JI2 E;  2DMY A;  2EOS A;  1T4O A;  2LCE A;  4AQY E;  2EOJ A;  2YTD A;  1EH7 A;  1WXR A;  2LTS A;  3ZOQ B;  4TUI A;  2L3C A;  2PRT A;  3IWC A;  3DF6 A;  1PJT A;  4JI5 E;  4L8N A;  4LF9 E;  4X62 E;  2LUP B;  2EML A; 
#chains in the Genus database with same CATH homology
 2MKD A;  4X9J A;  2EM6 A;  2LVH A;  3MHH C;  2EMB A;  2R1F A;  2EMG A;  2YTJ A;  2EMI A;  2EOQ A;  1MEY C;  2WBT A;  1BB8 A;  2YU8 A;  2CTD A;  1X5W A;  2EM2 A;  2DRP A;  2DGC A;  1YUJ A;  2M9A A;  2EQ3 A;  2LT7 A;  1DGC A;  2YTP A;  4R2E A;  2EMF A;  2GHF A;  2MKN A;  2EM8 A;  1B69 A;  2EP3 A;  1G2D C;  1YSA C;  2EPX A;  1JK2 A;  2EMK A;  1A1F A;  2EPZ A;  2EN2 A;  2JPA A;  2NAB A;  1A1G A;  2EOE A;  2EN4 A;  1G2F C;  2EJ4 A;  2EPP A;  2WCC 3;  2ADR A;  1X3C A;  5KL2 A;  1YUI A;  2RSI A;  2EPR A;  2EE8 A;  2EM4 A;  4R2A A;  1P47 A;  1WJP A;  1A1H A;  1UN6 B;  2RPC A;  4WSG A;  2EMH A;  2EL5 A;  2E72 A;  2DMI A;  4R2Q A;  1X6H A;  4F6M A;  3EPK A;  2EM0 A;  3EPJ A;  2GLI A;  2EM3 A;  2EN6 A;  2YSP A;  1KJK A;  2EN3 A;  2YRH A;  2A25 A;  2YTE A;  2YSO A;  1X6F A;  2EN8 A;  2EM9 A;  1JK1 A;  2HGH A;  2ELY A;  4R2R A;  2J7J A;  4R2P A;  2EMZ A;  1TF6 A;  2YTO A;  2ENH A;  2MDG A;  1ZAA C;  1F2I G;  2YU5 A;  2EM7 A;  2EM5 A;  3VHT B;  1ZU1 A;  2EMA A;  5KL7 A;  1A1K A;  2VRD A;  2YRM A;  1A1I A;  1BBO A;  4M9V C;  2YTN A;  2EQ1 A;  2JP9 A;  2EOH A;  2EOR A;  2WBS A;  1AAY A;  2EOI A;  1NCS A;  2LV2 A;  1X6E A;  2EOX A;  4IJD A;  2WBU A;  2I13 A;  4FK5 C;  2EOZ A;  2EOO A;  5KL5 A;  4R2S A;  1A1L A;  1UBD C;  2EN1 A;  4F2J C;  2ELZ A;  2YTQ A;  2DLQ A;  2EN7 A;  2EQ0 A;  2D9H A;  2YRK A;  1RMD A;  3EPL A;  5KL4 A;  4F6N A;  2CSH A;  2EMX A;  2YTI A;  4GZN C;  2EOM A;  3UK3 C;  2ENA A;  1A1J A;  2EL6 A;  2DLK A;  2EL4 A;  5KL3 A;  2EPU A;  2EPA A;  4R2D A;  2BB8 A;  2CT1 A;  2EOS A;  2LCE A;  1TF3 A;  2EOJ A;  2YTD A;  2EPC A;  3M99 B;  1Z1B A;  2EOY A;  2EMY A;  4IS1 C;  2PRT A;  2EMW A;  3EPH A;  2YTF A;  4R2C A;  5KL6 A;  2YTG A;  2EOF A;  1ZR9 A;  2ENC A;  2EMC A;  1LLM C;  3MHS C;  2LO3 A;  2EML A;  1TN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...