1AAYA

Zif268 zinc finger-dna complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
85
structure length
85
Chain Sequence
RPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*CP*GP*T)-3')
publication title Zif268 protein-DNA complex refined at 1.6 A: a model system for understanding zinc finger-DNA interactions.
pubmed doi rcsb
source organism Mus musculus
total genus 27
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1997-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1aayA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1aayA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1aayA03
1X6EA 1RMDA 2CTDA 2EQ1A 2YTNA 1LLMC 1YSAC 2EPCA 4GZNC 2DMIA 2J7JA 2CSHA 2EOIA 2BB8A 5KL3A 2YRMA 2MKDA 2YTFA 2LV2A 2LT7A 2YRKA 1YUIA 1TF6A 2EN8A 2EN7A 2EP3A 4F2JC 2EMFA 4R2SA 2EMWA 2ADRA 1A1FA 2EPRA 3EPKA 3EPLA 2EN1A 2PRTA 1ZAAC 2EMXA 2EOHA 2LCEA 2EMHA 4R2QA 2EM5A 3MHHC 2EM4A 2EM2A 2EOJA 2EM7A 2EJ4A 3UK3C 2DLKA 2EOFA 2DLQA 3VHTB 1ZR9A 4X9JA 1NCSA 2EOQA 5KL7A 1BB8A 4F6NA 1X3CA 2LVHA 2E72A 2YTEA 2EOYA 2EPPA 1UN6B 2ENAA 2YSPA 2JPAA 2YTIA 2ELYA 2EE8A 2CT1A 2YTOA 2EMAA 1KJKA 2EM3A 2A25A 2EN4A 2EN6A 2GLIA 2EPZA 3M99B 2JP9A 2YSOA 1YUJA 2EM0A 2EL4A 2EM9A 4R2AA 4WSGA 2WBTA 2EORA 1P47A 4IJDA 1UBDC 1TF3A 2ENHA 1A1LA 5KL2A 2HGHA 2EPAA 2DGCA 2EMLA 2EMZA 2R1FA 5KL4A 1A1JA 2EN2A 2YTJA 4R2RA 4M9VC 1JK2A 2EM8A 1Z1BA 2EMYA 2YRHA 1A1IA 4R2DA 4R2PA 2EPXA 3EPJA 2WBUA 2EOZA 5KL5A 1A1HA 2YTPA 1X6FA 2EL6A 2EOEA 2WBSA 2EOSA 2LO3A 2VRDA 2NABA 3MHSC 2EMKA 1X5WA 2YU5A 4F6MA 2EMIA 2M9AA 1DGCA 1A1KA 1MEYC 2EN3A 1G2FC 2EMCA 2DRPA 2ELZA 2EMBA 2MDGA 2YU8A 2EPUA 5KL6A 1JK1A 2MKNA 2EOMA 2EQ3A 1WJPA 1B69A 2YTGA 1A1GA 1AAYA 1G2DC 1BBOA 2ENCA 1F2IG 2EM6A 2RPCA 2EMGA 4FK5C 4IS1C 4R2CA 4R2EA 2YTDA 2YTQA 3EPHA 2EOXA 2WCC3 1ZU1A 1X6HA 2EOOA 2EQ0A 2EL5A 2RSIA 2GHFA 1TN9A 2D9HA 2I13A
chains in the Genus database with same CATH superfamily
1X6EA 1HNXE 1YSAC 2V85A 2YTNA 5AASA 2B7TA 3ADGA 1UHZA 4X64E 4DV7E 4I8OA 3VYYA 3TQMA 2LV2A 4ZYDA 2YRKA 2EN8A 2EP3A 1WHNA 5A6BD 2V86A 2K4VA 2EN1A 1YPNA 3C6KA 1QU6A 4KHPE 2DSYA 1BBGA 1XNRE 2V87A 3JAMC 1I94E 2UXDE 2HHHE 2DLQA 2L3CA 1ZR9A 1GTKA 4MLQA 3ZOQB 5A69A 2ENAA 2JOBA 2CT1A 2YTOA 4OOGC 3VYXA 4BMJA 1EKZA 2EPZA 4N4RB 2L2NA 1RQ0A 2JP9A 5FLXC 2GPIA 5AC5A 5F3WA 4R8OA 4R2AA 4F9AB 3T1YE 2YWQA 2F4VE 1UBDC 2ENHA 4TUGA 4K0KE 2HGHA 2EPAA 2LMZA 3J7AG 5KL4A 2BBGA 2YTJA 2UU9E 4LF9E 3J80C 4GKKE 2EZ6A 2L8TA 2YRHA 4R2DA 4DUZE 3EPJA 2WBUA 1A1HA 1WXRA 2WBSA 1N33E 3F6HA 3OTOE 2EMKA 3JTZA 4X62E 4DV1E 2JXPA 2KOUA 1T4LB 2V88A 4DR6E 1G2FC 2EMCA 2V89A 2MC6A 2DRPA 4MLVA 2NUGA 5KL6A 4DR2E 5A6JA 2UXBE 3ADLA 1JK1A 3ADJA 2EOMA 4WXCA 3IWCA 1WHQA 1X47A 1IBKE 3MSWA 2LUPB 4JI5E 1EH7A 4FK5C 2CPNA 4O4KA 4OX9E 1FKAE 1PJSA 5CFFE 4BS9A 1X6HA 2HC5A 3AUZA 3KWRA 1EH6A 4DV4E 2I13A 2EQ1A 1LLMC 2RS6A 4DV6E 3KZZA 1SR9A 3C4TA 2CSHA 3HTXA 2MKDA 2YTFA 4NHRA 1YUIA 4NZVA 5LLQA 3OMLA 1PKPA 2EMFA 2ODRD 2EMWA 2JYAA 1A1FA 4LFAE 2EPRA 3EPKA 2PRTA 2EMXA 4F54A 2LCEA 4R2QA 1GQEA 2EM5A 2EOJA 2JR1A 1N3GA 1O0WA 2MC5A 2VQFE 2B9DA 4WX9A 1NCSA 4JI7E 5KL7A 1RC7A 1J5EE 5A6BA 3AV0A 1YYOA 3J7Yp 2YSPA 3HXLA 2JPAA 4O24A 2EE8A 5TSEA 4GKJE 2EM3A 2EN4A 3ECRA 2EN6A 4BCAA 4BHBA 2FTXB 2DB2A 1YUJA 2EM9A 3JU0A 2V8QB 2WBTA 1N32E 2LTRA 4DR3E 1ZBQA 4DV5E 2RQLA 3THOB 2EMLA 2EMZA 1A1JA 4O5GA 2EM8A 5AC4A 1PJTA 2EMYA 3IWDA 4J8ZA 3F6GA 4R2PA 2EPXA 2EOZA 5LL6R 2EL6A 1DI2A 2L6MA 2UUAE 2VRDA 1T4NA 3MHSC 3J81C 2EPOA 4O43A 4JI8E 2EPNA 1A1KA 2L3JA 5AE2A 2FGGA 2ELZA 2JOXA 2WZOA 4P78A 2MKNA 3HPZA 4TUIA 2EQ3A 2FV4B 3T1HE 4B3TE 1XNQE 4HTGA 4WPYA 5AE1A 4ZYGA 1A1GA 1G2DC 1BBOA 4BBYA 3KZYA 5ADZA 2LUQA 3L00A 1J26A 5BR8E 2YTDA 2M4IA 2YTQA 1N34E 2E5LE 1FJGE 1X48A 2LJUA 2L2MA 4L8NA 2EQ0A 1YFHA 1IQSA 1IMUA 3BF2A 2GHFA 1TN9A 2CTDA 2EPCA 2DMIA 2J7JA 2UXCE 2BB8A 5KL3A 2YRMA 3C6MA 1TF6A 4WSPA 4LF4E 4F2JC 4R2SA 4LFCE 2ADRA 4M30A 3VK6A 4WFTA 2KHXA 5A6AA 4R03A 2G7HA 2DMYA 2EPLX 2EOHA 1STUA 4DV0E 1QNTA 3BGHA 4GEQB 4WYQB 3HQ1A 1T4OA 3MHHC 2EM4A 5LMNE 2JY9A 5T6JA 2ZM6E 2EJ4A 1SFEA 3UK3C 2IHR1 3VHTB 3DJWA 2UUCE 2EOQA 4L5NC 3LLHA 1N36E 4KZSA 1X3CA 2Q8UA 2LVHA 2E72A 1PJQA 2YTEA 2EOYA 5IXMB 4YHHE 2LTSA 2YTIA 2ELYA 1PDAA 2L33A 2VF1A 2EMAA 4M0VA 3H09A 2A25A 3QG5C 5A2QC 4JI6E 1IQOA 3M99B 2ODRC 4BHCA 4RHBB 4DR4E 2EORA 1A1LA 5KL2A 5DNYA 2DGCA 2B7VA 1XMOE 2EN2A 4M9VC 2I9IA 4BC7A 4R2RA 4DUYE 1JK2A 3BBGA 4B3SE 1Z1BA 2HJJA 2YPNA 2NA2A 5KL5A 2EOEA 2R76A 2LE2A 4LF7E 2EOSA 2NABA 1MGTA 2EWLA 1UILA 2YU5A 4F6MA 1YYWA 2EMIA 2V83A 2DIXA 3BIDA 1MEYC 2EN3A 2YT4A 4LFBE 2MDGA 2EPUA 4DMIA 1EH8A 4X8WA 2L92A 3LMLA 3C4BA 4LTYA 2EPMX 1WJPA 3ADIA 1B69A 2VQEE 4B3ME 3K6QA 2ENCA 2RPCA 1IBME 4R2CA 4R2EA 4NXNE 2M1SA 4ZYHA 3EPHA 2JWOA 1ZU1A 2EOOA 1HNWE 2F8BA 4JYAE 1WRJA 2YTPA 4DV3E 4P7DA 2D9HA 1RMDA 4B3RE 4GZNC 2EOIA 1XMQE 4LF6E 1ZBTA 2LRSA 3IWBA 2LT7A 2LBSB 2EN7A 3EQ1A 3EPLA 1DQ3A 4Q28A 1ZAAC 4X66E 5AE3A 1GZ6A 2EMHA 4JI4E 2EM2A 4JV5E 5IT9C 2EM7A 1HNZE 2RS7A 2EPKX 2DLKA 1X49A 4LF5E 2EOFA 4X9JA 2VE7C 4F9CB 3P1XA 5A6KA 2RSMA 1BB8A 4F6NA 3THNA 4DR5E 4ZYEA 2EPPA 4JI2E 1UN6B 4JI0E 1KJKA 2GLIA 3DF6A 4BC9A 2YSOA 4LF8E 2EM0A 2EL4A 1YYKA 4WSGA 2L2KB 1P47A 4IJDA 2NUEA 2MDRA 1L4SA 2N3GA 1T39A 1TF3A 4RH8A 3HPSA 3RMPA 4YY3E 4JI3E 1NEIA 5IWAE 2NUFA 2R1FA 1KYQA 2B3TB 1T38A 1AH5A 4Q35B 1A1IA 5IV8B 4NXME 4KWYA 1X6FA 2LJHA 4HEIA 2K7IA 2LO3A 4JI1E 4AQYE 2N8XA 1X5WA 4DR1E 2KONA 2M9AA 1DGCA 2UUBE 4DKKA 1HR0E 2EMBA 2YU8A 5LMUE 4M2ZA 4F9BB 2M7QA 2RTXA 2JVAA 4X65E 2YZTA 2YTGA 1IBLE 1AAYA 1F2IG 4LU9A 2EM6A 4DR7E 2EMGA 4IS1C 2E1MA 1YZ9A 2H36X 2EOXA 2WCC3 4DV2E 4WXDA 2EL5A 2N3HA 2RSIA 3FIGA
chains in the Genus database with same CATH topology
1X6EA 1RMDA 2CTDA 2EQ1A 2YTNA 1LLMC 1YSAC 2EPCA 4GZNC 2DMIA 2J7JA 2CSHA 2EOIA 2BB8A 5KL3A 2YRMA 2MKDA 2YTFA 2LV2A 2LT7A 2YRKA 1YUIA 1TF6A 2EN8A 2EN7A 2EP3A 4F2JC 2EMFA 4R2SA 2EMWA 2ADRA 1A1FA 2EPRA 3EPKA 3EPLA 2EN1A 2PRTA 1ZAAC 2EMXA 2EOHA 2LCEA 2EMHA 4R2QA 2EM5A 3MHHC 2EM4A 2EM2A 2EOJA 2EM7A 2EJ4A 3UK3C 2DLKA 2EOFA 2DLQA 3VHTB 1ZR9A 4X9JA 1NCSA 2EOQA 5KL7A 1BB8A 4F6NA 1X3CA 2LVHA 2E72A 2YTEA 2EOYA 2EPPA 1UN6B 2ENAA 2YSPA 2JPAA 2YTIA 2ELYA 2EE8A 2CT1A 2YTOA 2EMAA 1KJKA 2EM3A 2A25A 2EN4A 2EN6A 2GLIA 2EPZA 3M99B 2JP9A 2YSOA 1YUJA 2EM0A 2EL4A 2EM9A 4R2AA 4WSGA 2WBTA 2EORA 1P47A 4IJDA 1UBDC 1TF3A 2ENHA 1A1LA 5KL2A 2HGHA 2EPAA 2DGCA 2EMLA 2EMZA 2R1FA 5KL4A 1A1JA 2EN2A 2YTJA 4R2RA 4M9VC 1JK2A 2EM8A 1Z1BA 2EMYA 2YRHA 1A1IA 4R2DA 4R2PA 2EPXA 3EPJA 2WBUA 2EOZA 5KL5A 1A1HA 2YTPA 1X6FA 2EL6A 2EOEA 2WBSA 2EOSA 2LO3A 2VRDA 2NABA 3MHSC 2EMKA 1X5WA 2YU5A 4F6MA 2EMIA 2M9AA 1DGCA 1A1KA 1MEYC 2EN3A 1G2FC 2EMCA 2DRPA 2ELZA 2EMBA 2MDGA 2YU8A 2EPUA 5KL6A 1JK1A 2MKNA 2EOMA 2EQ3A 1WJPA 1B69A 2YTGA 1A1GA 1AAYA 1G2DC 1BBOA 2ENCA 1F2IG 2EM6A 2RPCA 2EMGA 4FK5C 4IS1C 4R2CA 4R2EA 2YTDA 2YTQA 3EPHA 2EOXA 2WCC3 1ZU1A 1X6HA 2EOOA 2EQ0A 2EL5A 2RSIA 2GHFA 1TN9A 2D9HA 2I13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X6E A;  1RMD A;  2CTD A;  2EQ1 A;  2YTN A;  1LLM C;  1YSA C;  2EPC A;  4GZN C;  2DMI A;  2J7J A;  2CSH A;  2EOI A;  2BB8 A;  5KL3 A;  2YRM A;  2MKD A;  2YTF A;  2LV2 A;  2LT7 A;  2YRK A;  1YUI A;  1TF6 A;  2EN8 A;  2EN7 A;  2EP3 A;  4F2J C;  2EMF A;  4R2S A;  2EMW A;  2ADR A;  1A1F A;  2EPR A;  3EPK A;  3EPL A;  2EN1 A;  2PRT A;  1ZAA C;  2EMX A;  2EOH A;  2LCE A;  2EMH A;  4R2Q A;  2EM5 A;  3MHH C;  2EM4 A;  2EM2 A;  2EOJ A;  2EM7 A;  2EJ4 A;  3UK3 C;  2DLK A;  2EOF A;  2DLQ A;  3VHT B;  1ZR9 A;  4X9J A;  1NCS A;  2EOQ A;  5KL7 A;  1BB8 A;  4F6N A;  1X3C A;  2LVH A;  2E72 A;  2YTE A;  2EOY A;  2EPP A;  1UN6 B;  2ENA A;  2YSP A;  2JPA A;  2YTI A;  2ELY A;  2EE8 A;  2CT1 A;  2YTO A;  2EMA A;  1KJK A;  2EM3 A;  2A25 A;  2EN4 A;  2EN6 A;  2GLI A;  2EPZ A;  3M99 B;  2JP9 A;  2YSO A;  1YUJ A;  2EM0 A;  2EL4 A;  2EM9 A;  4R2A A;  4WSG A;  2WBT A;  2EOR A;  1P47 A;  4IJD A;  1UBD C;  1TF3 A;  2ENH A;  1A1L A;  5KL2 A;  2HGH A;  2EPA A;  2DGC A;  2EML A;  2EMZ A;  2R1F A;  5KL4 A;  1A1J A;  2EN2 A;  2YTJ A;  4R2R A;  4M9V C;  1JK2 A;  2EM8 A;  1Z1B A;  2EMY A;  2YRH A;  1A1I A;  4R2D A;  4R2P A;  2EPX A;  3EPJ A;  2WBU A;  2EOZ A;  5KL5 A;  1A1H A;  2YTP A;  1X6F A;  2EL6 A;  2EOE A;  2WBS A;  2EOS A;  2LO3 A;  2VRD A;  2NAB A;  3MHS C;  2EMK A;  1X5W A;  2YU5 A;  4F6M A;  2EMI A;  2M9A A;  1DGC A;  1A1K A;  1MEY C;  2EN3 A;  1G2F C;  2EMC A;  2DRP A;  2ELZ A;  2EMB A;  2MDG A;  2YU8 A;  2EPU A;  5KL6 A;  1JK1 A;  2MKN A;  2EOM A;  2EQ3 A;  1WJP A;  1B69 A;  2YTG A;  1A1G A;  1AAY A;  1G2D C;  1BBO A;  2ENC A;  1F2I G;  2EM6 A;  2RPC A;  2EMG A;  4FK5 C;  4IS1 C;  4R2C A;  4R2E A;  2YTD A;  2YTQ A;  3EPH A;  2EOX A;  2WCC 3;  1ZU1 A;  1X6H A;  2EOO A;  2EQ0 A;  2EL5 A;  2RSI A;  2GHF A;  1TN9 A;  2D9H A;  2I13 A; 
#chains in the Genus database with same CATH topology
 1X6E A;  1HNX E;  1YSA C;  2V85 A;  2YTN A;  5AAS A;  2B7T A;  3ADG A;  1UHZ A;  4X64 E;  4DV7 E;  4I8O A;  3VYY A;  3TQM A;  2LV2 A;  4ZYD A;  2YRK A;  2EN8 A;  2EP3 A;  1WHN A;  5A6B D;  2V86 A;  2K4V A;  2EN1 A;  1YPN A;  3C6K A;  1QU6 A;  4KHP E;  2DSY A;  1BBG A;  1XNR E;  2V87 A;  3JAM C;  1I94 E;  2UXD E;  2HHH E;  2DLQ A;  2L3C A;  1ZR9 A;  1GTK A;  4MLQ A;  3ZOQ B;  5A69 A;  2ENA A;  2JOB A;  2CT1 A;  2YTO A;  4OOG C;  3VYX A;  4BMJ A;  1EKZ A;  2EPZ A;  4N4R B;  2L2N A;  1RQ0 A;  2JP9 A;  5FLX C;  2GPI A;  5AC5 A;  5F3W A;  4R8O A;  4R2A A;  4F9A B;  3T1Y E;  2YWQ A;  2F4V E;  1UBD C;  2ENH A;  4TUG A;  4K0K E;  2HGH A;  2EPA A;  2LMZ A;  3J7A G;  5KL4 A;  2BBG A;  2YTJ A;  2UU9 E;  4LF9 E;  3J80 C;  4GKK E;  2EZ6 A;  2L8T A;  2YRH A;  4R2D A;  4DUZ E;  3EPJ A;  2WBU A;  1A1H A;  1WXR A;  2WBS A;  1N33 E;  3F6H A;  3OTO E;  2EMK A;  3JTZ A;  4X62 E;  4DV1 E;  2JXP A;  2KOU A;  1T4L B;  2V88 A;  4DR6 E;  1G2F C;  2EMC A;  2V89 A;  2MC6 A;  2DRP A;  4MLV A;  2NUG A;  5KL6 A;  4DR2 E;  5A6J A;  2UXB E;  3ADL A;  1JK1 A;  3ADJ A;  2EOM A;  4WXC A;  3IWC A;  1WHQ A;  1X47 A;  1IBK E;  3MSW A;  2LUP B;  4JI5 E;  1EH7 A;  4FK5 C;  2CPN A;  4O4K A;  4OX9 E;  1FKA E;  1PJS A;  5CFF E;  4BS9 A;  1X6H A;  2HC5 A;  3AUZ A;  3KWR A;  1EH6 A;  4DV4 E;  2I13 A;  2EQ1 A;  1LLM C;  2RS6 A;  4DV6 E;  3KZZ A;  1SR9 A;  3C4T A;  2CSH A;  3HTX A;  2MKD A;  2YTF A;  4NHR A;  1YUI A;  4NZV A;  5LLQ A;  3OML A;  1PKP A;  2EMF A;  2ODR D;  2EMW A;  2JYA A;  1A1F A;  4LFA E;  2EPR A;  3EPK A;  2PRT A;  2EMX A;  4F54 A;  2LCE A;  4R2Q A;  1GQE A;  2EM5 A;  2EOJ A;  2JR1 A;  1N3G A;  1O0W A;  2MC5 A;  2VQF E;  2B9D A;  4WX9 A;  1NCS A;  4JI7 E;  5KL7 A;  1RC7 A;  1J5E E;  5A6B A;  3AV0 A;  1YYO A;  3J7Y p;  2YSP A;  3HXL A;  2JPA A;  4O24 A;  2EE8 A;  5TSE A;  4GKJ E;  2EM3 A;  2EN4 A;  3ECR A;  2EN6 A;  4BCA A;  4BHB A;  2FTX B;  2DB2 A;  1YUJ A;  2EM9 A;  3JU0 A;  2V8Q B;  2WBT A;  1N32 E;  2LTR A;  4DR3 E;  1ZBQ A;  4DV5 E;  2RQL A;  3THO B;  2EML A;  2EMZ A;  1A1J A;  4O5G A;  2EM8 A;  5AC4 A;  1PJT A;  2EMY A;  3IWD A;  4J8Z A;  3F6G A;  4R2P A;  2EPX A;  2EOZ A;  5LL6 R;  2EL6 A;  1DI2 A;  2L6M A;  2UUA E;  2VRD A;  1T4N A;  3MHS C;  3J81 C;  2EPO A;  4O43 A;  4JI8 E;  2EPN A;  1A1K A;  2L3J A;  5AE2 A;  2FGG A;  2ELZ A;  2JOX A;  2WZO A;  4P78 A;  2MKN A;  3HPZ A;  4TUI A;  2EQ3 A;  2FV4 B;  3T1H E;  4B3T E;  1XNQ E;  4HTG A;  4WPY A;  5AE1 A;  4ZYG A;  1A1G A;  1G2D C;  1BBO A;  4BBY A;  3KZY A;  5ADZ A;  2LUQ A;  3L00 A;  1J26 A;  5BR8 E;  2YTD A;  2M4I A;  2YTQ A;  1N34 E;  2E5L E;  1FJG E;  1X48 A;  2LJU A;  2L2M A;  4L8N A;  2EQ0 A;  1YFH A;  1IQS A;  1IMU A;  3BF2 A;  2GHF A;  1TN9 A;  2CTD A;  2EPC A;  2DMI A;  2J7J A;  2UXC E;  2BB8 A;  5KL3 A;  2YRM A;  3C6M A;  1TF6 A;  4WSP A;  4LF4 E;  4F2J C;  4R2S A;  4LFC E;  2ADR A;  4M30 A;  3VK6 A;  4WFT A;  2KHX A;  5A6A A;  4R03 A;  2G7H A;  2DMY A;  2EPL X;  2EOH A;  1STU A;  4DV0 E;  1QNT A;  3BGH A;  4GEQ B;  4WYQ B;  3HQ1 A;  1T4O A;  3MHH C;  2EM4 A;  5LMN E;  2JY9 A;  5T6J A;  2ZM6 E;  2EJ4 A;  1SFE A;  3UK3 C;  2IHR 1;  3VHT B;  3DJW A;  2UUC E;  2EOQ A;  4L5N C;  3LLH A;  1N36 E;  4KZS A;  1X3C A;  2Q8U A;  2LVH A;  2E72 A;  1PJQ A;  2YTE A;  2EOY A;  5IXM B;  4YHH E;  2LTS A;  2YTI A;  2ELY A;  1PDA A;  2L33 A;  2VF1 A;  2EMA A;  4M0V A;  3H09 A;  2A25 A;  3QG5 C;  5A2Q C;  4JI6 E;  1IQO A;  3M99 B;  2ODR C;  4BHC A;  4RHB B;  4DR4 E;  2EOR A;  1A1L A;  5KL2 A;  5DNY A;  2DGC A;  2B7V A;  1XMO E;  2EN2 A;  4M9V C;  2I9I A;  4BC7 A;  4R2R A;  4DUY E;  1JK2 A;  3BBG A;  4B3S E;  1Z1B A;  2HJJ A;  2YPN A;  2NA2 A;  5KL5 A;  2EOE A;  2R76 A;  2LE2 A;  4LF7 E;  2EOS A;  2NAB A;  1MGT A;  2EWL A;  1UIL A;  2YU5 A;  4F6M A;  1YYW A;  2EMI A;  2V83 A;  2DIX A;  3BID A;  1MEY C;  2EN3 A;  2YT4 A;  4LFB E;  2MDG A;  2EPU A;  4DMI A;  1EH8 A;  4X8W A;  2L92 A;  3LML A;  3C4B A;  4LTY A;  2EPM X;  1WJP A;  3ADI A;  1B69 A;  2VQE E;  4B3M E;  3K6Q A;  2ENC A;  2RPC A;  1IBM E;  4R2C A;  4R2E A;  4NXN E;  2M1S A;  4ZYH A;  3EPH A;  2JWO A;  1ZU1 A;  2EOO A;  1HNW E;  2F8B A;  4JYA E;  1WRJ A;  2YTP A;  4DV3 E;  4P7D A;  2D9H A;  1RMD A;  4B3R E;  4GZN C;  2EOI A;  1XMQ E;  4LF6 E;  1ZBT A;  2LRS A;  3IWB A;  2LT7 A;  2LBS B;  2EN7 A;  3EQ1 A;  3EPL A;  1DQ3 A;  4Q28 A;  1ZAA C;  4X66 E;  5AE3 A;  1GZ6 A;  2EMH A;  4JI4 E;  2EM2 A;  4JV5 E;  5IT9 C;  2EM7 A;  1HNZ E;  2RS7 A;  2EPK X;  2DLK A;  1X49 A;  4LF5 E;  2EOF A;  4X9J A;  2VE7 C;  4F9C B;  3P1X A;  5A6K A;  2RSM A;  1BB8 A;  4F6N A;  3THN A;  4DR5 E;  4ZYE A;  2EPP A;  4JI2 E;  1UN6 B;  4JI0 E;  1KJK A;  2GLI A;  3DF6 A;  4BC9 A;  2YSO A;  4LF8 E;  2EM0 A;  2EL4 A;  1YYK A;  4WSG A;  2L2K B;  1P47 A;  4IJD A;  2NUE A;  2MDR A;  1L4S A;  2N3G A;  1T39 A;  1TF3 A;  4RH8 A;  3HPS A;  3RMP A;  4YY3 E;  4JI3 E;  1NEI A;  5IWA E;  2NUF A;  2R1F A;  1KYQ A;  2B3T B;  1T38 A;  1AH5 A;  4Q35 B;  1A1I A;  5IV8 B;  4NXM E;  4KWY A;  1X6F A;  2LJH A;  4HEI A;  2K7I A;  2LO3 A;  4JI1 E;  4AQY E;  2N8X A;  1X5W A;  4DR1 E;  2KON A;  2M9A A;  1DGC A;  2UUB E;  4DKK A;  1HR0 E;  2EMB A;  2YU8 A;  5LMU E;  4M2Z A;  4F9B B;  2M7Q A;  2RTX A;  2JVA A;  4X65 E;  2YZT A;  2YTG A;  1IBL E;  1AAY A;  1F2I G;  4LU9 A;  2EM6 A;  4DR7 E;  2EMG A;  4IS1 C;  2E1M A;  1YZ9 A;  2H36 X;  2EOX A;  2WCC 3;  4DV2 E;  4WXD A;  2EL5 A;  2N3H A;  2RSI A;  3FIG A; 
#chains in the Genus database with same CATH homology
 1X6E A;  1RMD A;  2CTD A;  2EQ1 A;  2YTN A;  1LLM C;  1YSA C;  2EPC A;  4GZN C;  2DMI A;  2J7J A;  2CSH A;  2EOI A;  2BB8 A;  5KL3 A;  2YRM A;  2MKD A;  2YTF A;  2LV2 A;  2LT7 A;  2YRK A;  1YUI A;  1TF6 A;  2EN8 A;  2EN7 A;  2EP3 A;  4F2J C;  2EMF A;  4R2S A;  2EMW A;  2ADR A;  1A1F A;  2EPR A;  3EPK A;  3EPL A;  2EN1 A;  2PRT A;  1ZAA C;  2EMX A;  2EOH A;  2LCE A;  2EMH A;  4R2Q A;  2EM5 A;  3MHH C;  2EM4 A;  2EM2 A;  2EOJ A;  2EM7 A;  2EJ4 A;  3UK3 C;  2DLK A;  2EOF A;  2DLQ A;  3VHT B;  1ZR9 A;  4X9J A;  1NCS A;  2EOQ A;  5KL7 A;  1BB8 A;  4F6N A;  1X3C A;  2LVH A;  2E72 A;  2YTE A;  2EOY A;  2EPP A;  1UN6 B;  2ENA A;  2YSP A;  2JPA A;  2YTI A;  2ELY A;  2EE8 A;  2CT1 A;  2YTO A;  2EMA A;  1KJK A;  2EM3 A;  2A25 A;  2EN4 A;  2EN6 A;  2GLI A;  2EPZ A;  3M99 B;  2JP9 A;  2YSO A;  1YUJ A;  2EM0 A;  2EL4 A;  2EM9 A;  4R2A A;  4WSG A;  2WBT A;  2EOR A;  1P47 A;  4IJD A;  1UBD C;  1TF3 A;  2ENH A;  1A1L A;  5KL2 A;  2HGH A;  2EPA A;  2DGC A;  2EML A;  2EMZ A;  2R1F A;  5KL4 A;  1A1J A;  2EN2 A;  2YTJ A;  4R2R A;  4M9V C;  1JK2 A;  2EM8 A;  1Z1B A;  2EMY A;  2YRH A;  1A1I A;  4R2D A;  4R2P A;  2EPX A;  3EPJ A;  2WBU A;  2EOZ A;  5KL5 A;  1A1H A;  2YTP A;  1X6F A;  2EL6 A;  2EOE A;  2WBS A;  2EOS A;  2LO3 A;  2VRD A;  2NAB A;  3MHS C;  2EMK A;  1X5W A;  2YU5 A;  4F6M A;  2EMI A;  2M9A A;  1DGC A;  1A1K A;  1MEY C;  2EN3 A;  1G2F C;  2EMC A;  2DRP A;  2ELZ A;  2EMB A;  2MDG A;  2YU8 A;  2EPU A;  5KL6 A;  1JK1 A;  2MKN A;  2EOM A;  2EQ3 A;  1WJP A;  1B69 A;  2YTG A;  1A1G A;  1AAY A;  1G2D C;  1BBO A;  2ENC A;  1F2I G;  2EM6 A;  2RPC A;  2EMG A;  4FK5 C;  4IS1 C;  4R2C A;  4R2E A;  2YTD A;  2YTQ A;  3EPH A;  2EOX A;  2WCC 3;  1ZU1 A;  1X6H A;  2EOO A;  2EQ0 A;  2EL5 A;  2RSI A;  2GHF A;  1TN9 A;  2D9H A;  2I13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...