1AAYA

Zif268 zinc finger-dna complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
85
structure length
85
Chain Sequence
RPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*CP*GP*T)-3')
publication title Zif268 protein-DNA complex refined at 1.6 A: a model system for understanding zinc finger-DNA interactions.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 27
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1997-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1aayA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1aayA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1aayA03
2YSPA 1MEYC 5KL2A 1YUIA 2EOEA 2ELZA 2EN4A 2WBTA 2EOIA 1YSAC 2EN7A 3UK3C 2EE8A 2YTPA 2EOJA 4R2EA 2EOZA 2YTQA 2ADRA 1TF3A 3MHSC 2EOOA 1DGCA 2EOMA 1A1GA 4FK5C 2LO3A 2EMLA 2EM8A 1G2FC 1X5WA 2YSOA 2EMZA 2EQ3A 2M9AA 1UBDC 1WJPA 4R2DA 2EL6A 3EPLA 2EM3A 2EN2A 2EN3A 2BB8A 2EM7A 2YTJA 2ENHA 1X6HA 2EPAA 2JP9A 2EMFA 2EL5A 1A1LA 2EPRA 1A1HA 4IJDA 1TF6A 2EN1A 2EQ1A 3VHTB 4X9JA 2EOXA 4R2SA 5KL6A 1A1FA 2DLKA 2DMIA 2ELYA 2LT7A 2EOSA 2CTDA 2EM0A 2RSIA 2PRTA 5KL4A 4M9VC 5KL5A 4R2AA 1ZU1A 1X3CA 2E72A 2EMGA 2LV2A 2NABA 2A25A 2EMHA 2EM2A 2WBUA 2WCC3 2VRDA 2R1FA 2MKNA 3MHHC 2EOHA 1AAYA 2MKDA 1B69A 3EPHA 2YTIA 1KJKA 1UN6B 5KL7A 2EPCA 2YU5A 2GHFA 1BB8A 2EJ4A 2EM9A 2EMAA 2YTNA 2DGCA 2EPUA 2YTEA 2EMKA 1G2DC 1RMDA 1BBOA 1TN9A 2JPAA 1P47A 2CSHA 2YTDA 2EMBA 2EL4A 2ENCA 4WSGA 2WBSA 1Z1BA 2RPCA 1NCSA 1LLMC 2EQ0A 2EPXA 2YTOA 4R2CA 2EMIA 1A1IA 2EMYA 2EOYA 2DLQA 2EOFA 2YTGA 5KL3A 2D9HA 2EOQA 2EMWA 1ZR9A 1ZAAC 2EPPA 4GZNC 2DRPA 2EP3A 2I13A 2YTFA 2EM5A 2YRHA 2EORA 2CT1A 3EPJA 3M99B 4F6MA 2HGHA 1A1KA 2ENAA 4F2JC 2YU8A 2MDGA 3EPKA 1JK2A 2EM4A 2GLIA 2LVHA 2YRKA 4R2QA 2EM6A 2EMCA 2EMXA 2EN6A 2J7JA 2LCEA 1YUJA 2YRMA 4IS1C 4R2RA 1X6FA 1X6EA 2EN8A 4F6NA 1F2IG 1JK1A 2EPZA 1A1JA 4R2PA
chains in the Genus database with same CATH superfamily
1YUIA 2ELZA 2YPNA 1YSAC 3ADLA 2YTPA 4R2EA 2ADRA 1DGCA 2RS7A 2JWOA 4DV2E 2EM8A 2JR1A 5AE1A 1X5WA 4DR5E 2RQLA 2YSOA 2M9AA 4R2DA 4JI7E 2JOXA 1YYOA 2LBSB 2LUQA 2YTJA 4ZYDA 5A6BA 4NXME 1YYWA 2EPAA 4LF7E 4BHBA 2K7IA 4MLVA 4WXDA 1ZBTA 3VHTB 4X9JA 2EOXA 1AH5A 5KL6A 1PJTA 3OTOE 2EM0A 2MDRA 1PJSA 2RSIA 3BGHA 4N4RB 4GKKE 1T39A 3LLHA 4WPYA 1ZBQA 1ZU1A 2EMGA 2LV2A 2VRDA 2DIXA 2CPNA 4F54A 4O24A 1J26A 2YTIA 2L6MA 3HQ1A 1WXRA 2YU5A 1BB8A 4WSPA 1X47A 2DGCA 1G2DC 2EMKA 2YZTA 1BBOA 2L8TA 4B3SE 2CSHA 1SR9A 5AE2A 5IV8B 2EMBA 2EL4A 2EPKX 3P1XA 4JV5E 3T1YE 2Q8UA 2WBSA 1YYKA 2RPCA 2L2NA 2LUPB 2H36X 3F6HA 3THNA 2EPXA 4X8WA 2YTOA 4R2CA 4BCAA 4DV6E 2WZOA 4P7DA 5ADZA 2EOFA 2K4VA 3DJWA 2D9HA 4R03A 1ZR9A 2EOQA 2LMZA 2YTFA 3K6QA 1XMQE 2I9IA 2EORA 3M99B 1MGTA 3DF6A 5LL6R 1J5EE 2BBGA 5A2QC 1UILA 4DUZE 1IQOA 2LVHA 2YRKA 1IBLE 2EM6A 2EMCA 2EN6A 4KZSA 2VE7C 1XNQE 2L3JA 4R2RA 4F6NA 1JK1A 3HTXA 3J81C 1KYQA 4AQYE 2L3CA 1MEYC 2EOEA 2EN4A 5LMNE 2B3TB 1RC7A 5TSEA 2HC5A 2EOZA 2YTQA 3ADGA 1TF3A 4JYAE 3HXLA 2EOOA 3BF2A 2FV4B 5A69A 3VYXA 1G2FC 4R8OA 1DI2A 2LTRA 1YZ9A 1WJPA 2EN2A 2EM7A 1UHZA 4F9AB 2NUFA 4O43A 2V86A 1FJGE 2JP9A 2EMFA 2UUCE 2UXCE 1A1LA 2EPRA 3HPZA 4IJDA 2R76A 2EN1A 2EQ1A 1EH6A 4R2SA 4L8NA 2JY9A 4NXNE 2ELYA 3BBGA 2NUEA 2PRTA 4M9VC 4NZVA 5LMUE 1IBKE 4R2AA 1X3CA 4BMJA 4P78A 4YHHE 2WCC3 3ADJA 2DSYA 2YT4A 2MKNA 2EPNA 1AAYA 5F3WA 1XNRE 2GHFA 2EMAA 1QU6A 1IBME 2YTEA 2EZ6A 4BS9A 1P47A 2N3GA 2V88A 4DR2E 3KZYA 3HPSA 1XMOE 2V87A 4DR1E 2EPMX 4JI0E 5IXMB 3QG5C 1Z1BA 1HNZE 4DKKA 1NCSA 1LLMC 4DR6E 1L4SA 4Q28A 4WFTA 3MSWA 2LE2A 2YWQA 2L33A 2IHR1 1T4LB 2EMIA 1I94E 2EOYA 4GEQB 4BC7A 2DLQA 4M0VA 1ZAAC 2EMWA 1GQEA 2VQFE 2EM5A 2YRHA 2M7QA 2CT1A 2KOUA 2M4IA 4YY3E 1DQ3A 1T4OA 2HGHA 4L5NC 3T1HE 1IMUA 4M2ZA 4LF6E 4LF9E 4F2JC 2MDGA 4O4KA 4OX9E 1JK2A 4HEIA 5IWAE 2GPIA 4R2QA 2ODRD 1N33E 2J7JA 2LCEA 1YUJA 1X48A 2YRMA 1HNWE 4IS1C 3J80C 3C4BA 4LTYA 3FIGA 1N34E 4R2PA 2ODRC 5KL2A 4TUIA 4LF8E 2EN7A 4WXCA 4DR7E 5CFFE 3MHSC 1FKAE 1PJQA 4K0KE 4X64E 1A1GA 1GTKA 1YPNA 2EMLA 4O5GA 4BHCA 2V89A 3KZZA 2VQEE 1QNTA 3EPLA 2LRSA 2EN3A 5LLQA 5IT9C 4JI2E 1IQSA 2MC6A 3JTZA 3OMLA 2HJJA 3JU0A 4Q35B 2EL5A 1A1HA 4DV1E 2LJUA 1A1FA 4JI8E 2DLKA 2N3HA 2EOSA 3ECRA 1SFEA 4B3TE 5KL5A 2E72A 4LFCE 1T4NA 2A25A 2WBUA 2EM2A 3RMPA 4M30A 2B9DA 3L00A 4DV7E 1B69A 4X62E 4DV0E 4MLQA 5KL7A 2EJ4A 3J7AG 2EPUA 1RMDA 2RSMA 1TN9A 3C6KA 2DMYA 4DR3E 4DV4E 2ENCA 4WSGA 1YFHA 2B7VA 1PDAA 4TUGA 2UUAE 4B3ME 4JI1E 3J7Yp 4LFBE 2EPOA 2EQ0A 1WRJA 4F9CB 4HTGA 2YTGA 3VK6A 2EPPA 2EP3A 2I13A 1EKZA 2L2MA 2DB2A 3LMLA 2V83A 2KHXA 2MC5A 4F6MA 1A1KA 2LTSA 5FLXC 1BBGA 2N8XA 2GLIA 4LF4E 1WHQA 3ZOQB 2EMXA 3F6GA 2RTXA 2EPLX 1X6FA 4KHPE 4DV5E 4JI4E 1A1JA 2HHHE 2B7TA 2YSPA 4WYQB 4B3RE 2WBTA 2EOIA 2NUGA 3UK3C 3THOB 2EE8A 2EOJA 1NEIA 5A6KA 4ZYHA 2EOMA 4LF5E 4FK5C 2LO3A 4J8ZA 2UUBE 2EMZA 2EQ3A 1UBDC 2EL6A 2FTXB 3BIDA 2EM3A 4DUYE 2BB8A 4JI6E 1N32E 4NHRA 2ENHA 2UU9E 2F4VE 4JI5E 1X6HA 1HR0E 2UXBE 2V8QB 2VF1A 1TF6A 4LU9A 3IWDA 5AE3A 2EWLA 1X49A 4DMIA 3TQMA 2DMIA 2LT7A 1O0WA 2CTDA 4DV3E 2F8BA 2RS6A 2JXPA 5KL4A 2NA2A 3IWCA 2JOBA 2NABA 2FGGA 2EMHA 5A6AA 2R1FA 5AC5A 4DR4E 3MHHC 2EOHA 2MKDA 3EPHA 1N36E 3AV0A 1KJKA 1UN6B 5AC4A 2EPCA 2LJHA 2EM9A 2YTNA 2JYAA 1HNXE 2L2KB 5A6BD 2JPAA 5A6JA 2E1MA 4RHBB 4I8OA 4X66E 4X65E 1PKPA 1GZ6A 2YTDA 5BR8E 4F9BB 5DNYA 1N3GA 3C4TA 3IWBA 1EH7A 1RQ0A 4WX9A 4ZYGA 1WHNA 1STUA 2KONA 3H09A 1EH8A 1A1IA 2EMYA 4OOGC 2UXDE 5KL3A 4GKJE 3JAMC 4GZNC 2DRPA 4KWYA 2JVAA 4BBYA 4RH8A 3EPJA 1T38A 3VYYA 3AUZA 4LFAE 2E5LE 2ENAA 2L92A 5T6JA 2YU8A 3C6MA 4ZYEA 3EPKA 2EM4A 2M1SA 3KWRA 2ZM6E 2V85A 1F2IG 1X6EA 2EN8A 2G7HA 4BC9A 5AASA 2EPZA 3ADIA 3EQ1A 4JI3E
chains in the Genus database with same CATH topology
2YSPA 1MEYC 5KL2A 1YUIA 2EOEA 2ELZA 2EN4A 2WBTA 2EOIA 1YSAC 2EN7A 3UK3C 2EE8A 2YTPA 2EOJA 4R2EA 2EOZA 2YTQA 2ADRA 1TF3A 3MHSC 2EOOA 1DGCA 2EOMA 1A1GA 4FK5C 2LO3A 2EMLA 2EM8A 1G2FC 1X5WA 2YSOA 2EMZA 2EQ3A 2M9AA 1UBDC 1WJPA 4R2DA 2EL6A 3EPLA 2EM3A 2EN2A 2EN3A 2BB8A 2EM7A 2YTJA 2ENHA 1X6HA 2EPAA 2JP9A 2EMFA 2EL5A 1A1LA 2EPRA 1A1HA 4IJDA 1TF6A 2EN1A 2EQ1A 3VHTB 4X9JA 2EOXA 4R2SA 5KL6A 1A1FA 2DLKA 2DMIA 2ELYA 2LT7A 2EOSA 2CTDA 2EM0A 2RSIA 2PRTA 5KL4A 4M9VC 5KL5A 4R2AA 1ZU1A 1X3CA 2E72A 2EMGA 2LV2A 2NABA 2A25A 2EMHA 2EM2A 2WBUA 2WCC3 2VRDA 2R1FA 2MKNA 3MHHC 2EOHA 1AAYA 2MKDA 1B69A 3EPHA 2YTIA 1KJKA 1UN6B 5KL7A 2EPCA 2YU5A 2GHFA 1BB8A 2EJ4A 2EM9A 2EMAA 2YTNA 2DGCA 2EPUA 2YTEA 2EMKA 1G2DC 1RMDA 1BBOA 1TN9A 2JPAA 1P47A 2CSHA 2YTDA 2EMBA 2EL4A 2ENCA 4WSGA 2WBSA 1Z1BA 2RPCA 1NCSA 1LLMC 2EQ0A 2EPXA 2YTOA 4R2CA 2EMIA 1A1IA 2EMYA 2EOYA 2DLQA 2EOFA 2YTGA 5KL3A 2D9HA 2EOQA 2EMWA 1ZR9A 1ZAAC 2EPPA 4GZNC 2DRPA 2EP3A 2I13A 2YTFA 2EM5A 2YRHA 2EORA 2CT1A 3EPJA 3M99B 4F6MA 2HGHA 1A1KA 2ENAA 4F2JC 2YU8A 2MDGA 3EPKA 1JK2A 2EM4A 2GLIA 2LVHA 2YRKA 4R2QA 2EM6A 2EMCA 2EMXA 2EN6A 2J7JA 2LCEA 1YUJA 2YRMA 4IS1C 4R2RA 1X6FA 1X6EA 2EN8A 4F6NA 1F2IG 1JK1A 2EPZA 1A1JA 4R2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YSP A;  1MEY C;  5KL2 A;  1YUI A;  2EOE A;  2ELZ A;  2EN4 A;  2WBT A;  2EOI A;  1YSA C;  2EN7 A;  3UK3 C;  2EE8 A;  2YTP A;  2EOJ A;  4R2E A;  2EOZ A;  2YTQ A;  2ADR A;  1TF3 A;  3MHS C;  2EOO A;  1DGC A;  2EOM A;  1A1G A;  4FK5 C;  2LO3 A;  2EML A;  2EM8 A;  1G2F C;  1X5W A;  2YSO A;  2EMZ A;  2EQ3 A;  2M9A A;  1UBD C;  1WJP A;  4R2D A;  2EL6 A;  3EPL A;  2EM3 A;  2EN2 A;  2EN3 A;  2BB8 A;  2EM7 A;  2YTJ A;  2ENH A;  1X6H A;  2EPA A;  2JP9 A;  2EMF A;  2EL5 A;  1A1L A;  2EPR A;  1A1H A;  4IJD A;  1TF6 A;  2EN1 A;  2EQ1 A;  3VHT B;  4X9J A;  2EOX A;  4R2S A;  5KL6 A;  1A1F A;  2DLK A;  2DMI A;  2ELY A;  2LT7 A;  2EOS A;  2CTD A;  2EM0 A;  2RSI A;  2PRT A;  5KL4 A;  4M9V C;  5KL5 A;  4R2A A;  1ZU1 A;  1X3C A;  2E72 A;  2EMG A;  2LV2 A;  2NAB A;  2A25 A;  2EMH A;  2EM2 A;  2WBU A;  2WCC 3;  2VRD A;  2R1F A;  2MKN A;  3MHH C;  2EOH A;  1AAY A;  2MKD A;  1B69 A;  3EPH A;  2YTI A;  1KJK A;  1UN6 B;  5KL7 A;  2EPC A;  2YU5 A;  2GHF A;  1BB8 A;  2EJ4 A;  2EM9 A;  2EMA A;  2YTN A;  2DGC A;  2EPU A;  2YTE A;  2EMK A;  1G2D C;  1RMD A;  1BBO A;  1TN9 A;  2JPA A;  1P47 A;  2CSH A;  2YTD A;  2EMB A;  2EL4 A;  2ENC A;  4WSG A;  2WBS A;  1Z1B A;  2RPC A;  1NCS A;  1LLM C;  2EQ0 A;  2EPX A;  2YTO A;  4R2C A;  2EMI A;  1A1I A;  2EMY A;  2EOY A;  2DLQ A;  2EOF A;  2YTG A;  5KL3 A;  2D9H A;  2EOQ A;  2EMW A;  1ZR9 A;  1ZAA C;  2EPP A;  4GZN C;  2DRP A;  2EP3 A;  2I13 A;  2YTF A;  2EM5 A;  2YRH A;  2EOR A;  2CT1 A;  3EPJ A;  3M99 B;  4F6M A;  2HGH A;  1A1K A;  2ENA A;  4F2J C;  2YU8 A;  2MDG A;  3EPK A;  1JK2 A;  2EM4 A;  2GLI A;  2LVH A;  2YRK A;  4R2Q A;  2EM6 A;  2EMC A;  2EMX A;  2EN6 A;  2J7J A;  2LCE A;  1YUJ A;  2YRM A;  4IS1 C;  4R2R A;  1X6F A;  1X6E A;  2EN8 A;  4F6N A;  1F2I G;  1JK1 A;  2EPZ A;  1A1J A;  4R2P A; 
#chains in the Genus database with same CATH topology
 1YUI A;  2ELZ A;  2YPN A;  1YSA C;  3ADL A;  2YTP A;  4R2E A;  2ADR A;  1DGC A;  2RS7 A;  2JWO A;  4DV2 E;  2EM8 A;  2JR1 A;  5AE1 A;  1X5W A;  4DR5 E;  2RQL A;  2YSO A;  2M9A A;  4R2D A;  4JI7 E;  2JOX A;  1YYO A;  2LBS B;  2LUQ A;  2YTJ A;  4ZYD A;  5A6B A;  4NXM E;  1YYW A;  2EPA A;  4LF7 E;  4BHB A;  2K7I A;  4MLV A;  4WXD A;  1ZBT A;  3VHT B;  4X9J A;  2EOX A;  1AH5 A;  5KL6 A;  1PJT A;  3OTO E;  2EM0 A;  2MDR A;  1PJS A;  2RSI A;  3BGH A;  4N4R B;  4GKK E;  1T39 A;  3LLH A;  4WPY A;  1ZBQ A;  1ZU1 A;  2EMG A;  2LV2 A;  2VRD A;  2DIX A;  2CPN A;  4F54 A;  4O24 A;  1J26 A;  2YTI A;  2L6M A;  3HQ1 A;  1WXR A;  2YU5 A;  1BB8 A;  4WSP A;  1X47 A;  2DGC A;  1G2D C;  2EMK A;  2YZT A;  1BBO A;  2L8T A;  4B3S E;  2CSH A;  1SR9 A;  5AE2 A;  5IV8 B;  2EMB A;  2EL4 A;  2EPK X;  3P1X A;  4JV5 E;  3T1Y E;  2Q8U A;  2WBS A;  1YYK A;  2RPC A;  2L2N A;  2LUP B;  2H36 X;  3F6H A;  3THN A;  2EPX A;  4X8W A;  2YTO A;  4R2C A;  4BCA A;  4DV6 E;  2WZO A;  4P7D A;  5ADZ A;  2EOF A;  2K4V A;  3DJW A;  2D9H A;  4R03 A;  1ZR9 A;  2EOQ A;  2LMZ A;  2YTF A;  3K6Q A;  1XMQ E;  2I9I A;  2EOR A;  3M99 B;  1MGT A;  3DF6 A;  5LL6 R;  1J5E E;  2BBG A;  5A2Q C;  1UIL A;  4DUZ E;  1IQO A;  2LVH A;  2YRK A;  1IBL E;  2EM6 A;  2EMC A;  2EN6 A;  4KZS A;  2VE7 C;  1XNQ E;  2L3J A;  4R2R A;  4F6N A;  1JK1 A;  3HTX A;  3J81 C;  1KYQ A;  4AQY E;  2L3C A;  1MEY C;  2EOE A;  2EN4 A;  5LMN E;  2B3T B;  1RC7 A;  5TSE A;  2HC5 A;  2EOZ A;  2YTQ A;  3ADG A;  1TF3 A;  4JYA E;  3HXL A;  2EOO A;  3BF2 A;  2FV4 B;  5A69 A;  3VYX A;  1G2F C;  4R8O A;  1DI2 A;  2LTR A;  1YZ9 A;  1WJP A;  2EN2 A;  2EM7 A;  1UHZ A;  4F9A B;  2NUF A;  4O43 A;  2V86 A;  1FJG E;  2JP9 A;  2EMF A;  2UUC E;  2UXC E;  1A1L A;  2EPR A;  3HPZ A;  4IJD A;  2R76 A;  2EN1 A;  2EQ1 A;  1EH6 A;  4R2S A;  4L8N A;  2JY9 A;  4NXN E;  2ELY A;  3BBG A;  2NUE A;  2PRT A;  4M9V C;  4NZV A;  5LMU E;  1IBK E;  4R2A A;  1X3C A;  4BMJ A;  4P78 A;  4YHH E;  2WCC 3;  3ADJ A;  2DSY A;  2YT4 A;  2MKN A;  2EPN A;  1AAY A;  5F3W A;  1XNR E;  2GHF A;  2EMA A;  1QU6 A;  1IBM E;  2YTE A;  2EZ6 A;  4BS9 A;  1P47 A;  2N3G A;  2V88 A;  4DR2 E;  3KZY A;  3HPS A;  1XMO E;  2V87 A;  4DR1 E;  2EPM X;  4JI0 E;  5IXM B;  3QG5 C;  1Z1B A;  1HNZ E;  4DKK A;  1NCS A;  1LLM C;  4DR6 E;  1L4S A;  4Q28 A;  4WFT A;  3MSW A;  2LE2 A;  2YWQ A;  2L33 A;  2IHR 1;  1T4L B;  2EMI A;  1I94 E;  2EOY A;  4GEQ B;  4BC7 A;  2DLQ A;  4M0V A;  1ZAA C;  2EMW A;  1GQE A;  2VQF E;  2EM5 A;  2YRH A;  2M7Q A;  2CT1 A;  2KOU A;  2M4I A;  4YY3 E;  1DQ3 A;  1T4O A;  2HGH A;  4L5N C;  3T1H E;  1IMU A;  4M2Z A;  4LF6 E;  4LF9 E;  4F2J C;  2MDG A;  4O4K A;  4OX9 E;  1JK2 A;  4HEI A;  5IWA E;  2GPI A;  4R2Q A;  2ODR D;  1N33 E;  2J7J A;  2LCE A;  1YUJ A;  1X48 A;  2YRM A;  1HNW E;  4IS1 C;  3J80 C;  3C4B A;  4LTY A;  3FIG A;  1N34 E;  4R2P A;  2ODR C;  5KL2 A;  4TUI A;  4LF8 E;  2EN7 A;  4WXC A;  4DR7 E;  5CFF E;  3MHS C;  1FKA E;  1PJQ A;  4K0K E;  4X64 E;  1A1G A;  1GTK A;  1YPN A;  2EML A;  4O5G A;  4BHC A;  2V89 A;  3KZZ A;  2VQE E;  1QNT A;  3EPL A;  2LRS A;  2EN3 A;  5LLQ A;  5IT9 C;  4JI2 E;  1IQS A;  2MC6 A;  3JTZ A;  3OML A;  2HJJ A;  3JU0 A;  4Q35 B;  2EL5 A;  1A1H A;  4DV1 E;  2LJU A;  1A1F A;  4JI8 E;  2DLK A;  2N3H A;  2EOS A;  3ECR A;  1SFE A;  4B3T E;  5KL5 A;  2E72 A;  4LFC E;  1T4N A;  2A25 A;  2WBU A;  2EM2 A;  3RMP A;  4M30 A;  2B9D A;  3L00 A;  4DV7 E;  1B69 A;  4X62 E;  4DV0 E;  4MLQ A;  5KL7 A;  2EJ4 A;  3J7A G;  2EPU A;  1RMD A;  2RSM A;  1TN9 A;  3C6K A;  2DMY A;  4DR3 E;  4DV4 E;  2ENC A;  4WSG A;  1YFH A;  2B7V A;  1PDA A;  4TUG A;  2UUA E;  4B3M E;  4JI1 E;  3J7Y p;  4LFB E;  2EPO A;  2EQ0 A;  1WRJ A;  4F9C B;  4HTG A;  2YTG A;  3VK6 A;  2EPP A;  2EP3 A;  2I13 A;  1EKZ A;  2L2M A;  2DB2 A;  3LML A;  2V83 A;  2KHX A;  2MC5 A;  4F6M A;  1A1K A;  2LTS A;  5FLX C;  1BBG A;  2N8X A;  2GLI A;  4LF4 E;  1WHQ A;  3ZOQ B;  2EMX A;  3F6G A;  2RTX A;  2EPL X;  1X6F A;  4KHP E;  4DV5 E;  4JI4 E;  1A1J A;  2HHH E;  2B7T A;  2YSP A;  4WYQ B;  4B3R E;  2WBT A;  2EOI A;  2NUG A;  3UK3 C;  3THO B;  2EE8 A;  2EOJ A;  1NEI A;  5A6K A;  4ZYH A;  2EOM A;  4LF5 E;  4FK5 C;  2LO3 A;  4J8Z A;  2UUB E;  2EMZ A;  2EQ3 A;  1UBD C;  2EL6 A;  2FTX B;  3BID A;  2EM3 A;  4DUY E;  2BB8 A;  4JI6 E;  1N32 E;  4NHR A;  2ENH A;  2UU9 E;  2F4V E;  4JI5 E;  1X6H A;  1HR0 E;  2UXB E;  2V8Q B;  2VF1 A;  1TF6 A;  4LU9 A;  3IWD A;  5AE3 A;  2EWL A;  1X49 A;  4DMI A;  3TQM A;  2DMI A;  2LT7 A;  1O0W A;  2CTD A;  4DV3 E;  2F8B A;  2RS6 A;  2JXP A;  5KL4 A;  2NA2 A;  3IWC A;  2JOB A;  2NAB A;  2FGG A;  2EMH A;  5A6A A;  2R1F A;  5AC5 A;  4DR4 E;  3MHH C;  2EOH A;  2MKD A;  3EPH A;  1N36 E;  3AV0 A;  1KJK A;  1UN6 B;  5AC4 A;  2EPC A;  2LJH A;  2EM9 A;  2YTN A;  2JYA A;  1HNX E;  2L2K B;  5A6B D;  2JPA A;  5A6J A;  2E1M A;  4RHB B;  4I8O A;  4X66 E;  4X65 E;  1PKP A;  1GZ6 A;  2YTD A;  5BR8 E;  4F9B B;  5DNY A;  1N3G A;  3C4T A;  3IWB A;  1EH7 A;  1RQ0 A;  4WX9 A;  4ZYG A;  1WHN A;  1STU A;  2KON A;  3H09 A;  1EH8 A;  1A1I A;  2EMY A;  4OOG C;  2UXD E;  5KL3 A;  4GKJ E;  3JAM C;  4GZN C;  2DRP A;  4KWY A;  2JVA A;  4BBY A;  4RH8 A;  3EPJ A;  1T38 A;  3VYY A;  3AUZ A;  4LFA E;  2E5L E;  2ENA A;  2L92 A;  5T6J A;  2YU8 A;  3C6M A;  4ZYE A;  3EPK A;  2EM4 A;  2M1S A;  3KWR A;  2ZM6 E;  2V85 A;  1F2I G;  1X6E A;  2EN8 A;  2G7H A;  4BC9 A;  5AAS A;  2EPZ A;  3ADI A;  3EQ1 A;  4JI3 E; 
#chains in the Genus database with same CATH homology
 2YSP A;  1MEY C;  5KL2 A;  1YUI A;  2EOE A;  2ELZ A;  2EN4 A;  2WBT A;  2EOI A;  1YSA C;  2EN7 A;  3UK3 C;  2EE8 A;  2YTP A;  2EOJ A;  4R2E A;  2EOZ A;  2YTQ A;  2ADR A;  1TF3 A;  3MHS C;  2EOO A;  1DGC A;  2EOM A;  1A1G A;  4FK5 C;  2LO3 A;  2EML A;  2EM8 A;  1G2F C;  1X5W A;  2YSO A;  2EMZ A;  2EQ3 A;  2M9A A;  1UBD C;  1WJP A;  4R2D A;  2EL6 A;  3EPL A;  2EM3 A;  2EN2 A;  2EN3 A;  2BB8 A;  2EM7 A;  2YTJ A;  2ENH A;  1X6H A;  2EPA A;  2JP9 A;  2EMF A;  2EL5 A;  1A1L A;  2EPR A;  1A1H A;  4IJD A;  1TF6 A;  2EN1 A;  2EQ1 A;  3VHT B;  4X9J A;  2EOX A;  4R2S A;  5KL6 A;  1A1F A;  2DLK A;  2DMI A;  2ELY A;  2LT7 A;  2EOS A;  2CTD A;  2EM0 A;  2RSI A;  2PRT A;  5KL4 A;  4M9V C;  5KL5 A;  4R2A A;  1ZU1 A;  1X3C A;  2E72 A;  2EMG A;  2LV2 A;  2NAB A;  2A25 A;  2EMH A;  2EM2 A;  2WBU A;  2WCC 3;  2VRD A;  2R1F A;  2MKN A;  3MHH C;  2EOH A;  1AAY A;  2MKD A;  1B69 A;  3EPH A;  2YTI A;  1KJK A;  1UN6 B;  5KL7 A;  2EPC A;  2YU5 A;  2GHF A;  1BB8 A;  2EJ4 A;  2EM9 A;  2EMA A;  2YTN A;  2DGC A;  2EPU A;  2YTE A;  2EMK A;  1G2D C;  1RMD A;  1BBO A;  1TN9 A;  2JPA A;  1P47 A;  2CSH A;  2YTD A;  2EMB A;  2EL4 A;  2ENC A;  4WSG A;  2WBS A;  1Z1B A;  2RPC A;  1NCS A;  1LLM C;  2EQ0 A;  2EPX A;  2YTO A;  4R2C A;  2EMI A;  1A1I A;  2EMY A;  2EOY A;  2DLQ A;  2EOF A;  2YTG A;  5KL3 A;  2D9H A;  2EOQ A;  2EMW A;  1ZR9 A;  1ZAA C;  2EPP A;  4GZN C;  2DRP A;  2EP3 A;  2I13 A;  2YTF A;  2EM5 A;  2YRH A;  2EOR A;  2CT1 A;  3EPJ A;  3M99 B;  4F6M A;  2HGH A;  1A1K A;  2ENA A;  4F2J C;  2YU8 A;  2MDG A;  3EPK A;  1JK2 A;  2EM4 A;  2GLI A;  2LVH A;  2YRK A;  4R2Q A;  2EM6 A;  2EMC A;  2EMX A;  2EN6 A;  2J7J A;  2LCE A;  1YUJ A;  2YRM A;  4IS1 C;  4R2R A;  1X6F A;  1X6E A;  2EN8 A;  4F6N A;  1F2I G;  1JK1 A;  2EPZ A;  1A1J A;  4R2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...