1AAYA

Zif268 zinc finger-dna complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
85
structure length
85
Chain Sequence
RPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Zif268 protein-DNA complex refined at 1.6 A: a model system for understanding zinc finger-DNA interactions.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*CP*GP*T)-3')
total genus 27
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1997-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1aayA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1aayA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1aayA03
1DGCA 2LV2A 2EOQA 1YUJA 2EOJA 2BB8A 2EMWA 2CT1A 1LLMC 1AAYA 2EOEA 1A1IA 2DRPA 2EPCA 2EMLA 1Z1BA 1A1HA 2EN7A 2PRTA 2RPCA 2EM7A 4F6MA 2EMZA 2EOYA 2EM5A 2LCEA 2EOMA 2A25A 2EM9A 2YRKA 2ADRA 4F2JC 2VRDA 2EOSA 2RSIA 1MEYC 2MDGA 2EPPA 1JK1A 2EN8A 5KL3A 2ELZA 2LO3A 2YTEA 2WBSA 4R2RA 2EQ1A 2MKDA 2ENCA 2CSHA 2EOIA 2DLKA 2R1FA 2DGCA 1YSAC 1X5WA 2EMAA 2YSPA 2EPAA 2EMYA 1G2FC 2EM6A 2EPZA 2YTPA 1BB8A 1ZAAC 1A1KA 1X3CA 4F6NA 2MKNA 2YTOA 2EE8A 5KL2A 2EOZA 2ELYA 3EPKA 2GLIA 4R2QA 2YTNA 2YU8A 1X6FA 4R2SA 4GZNC 4R2DA 2EJ4A 2EOFA 1A1FA 2YTFA 5KL7A 2EM2A 3UK3C 1A1LA 1NCSA 4IJDA 2YU5A 1A1GA 2DMIA 2YTJA 1UBDC 1RMDA 2EMBA 2EM4A 4WSGA 2EL5A 1WJPA 1X6HA 2HGHA 2YTDA 2EL4A 1A1JA 1ZU1A 3EPHA 2WCC3 2E72A 2YRHA 4R2AA 1JK2A 2M9AA 2YRMA 1UN6B 1BBOA 2EOOA 2J7JA 4R2EA 2WBUA 1F2IG 2EPUA 2EOHA 2NABA 5KL5A 2EN3A 1YUIA 2GHFA 2I13A 2EMGA 4FK5C 2YSOA 1X6EA 4X9JA 3EPJA 2EMIA 3M99B 1ZR9A 3EPLA 2CTDA 2EM0A 1G2DC 2JP9A 2EP3A 1B69A 2ENAA 1TN9A 2WBTA 2EMFA 2EN2A 1KJKA 4R2PA 2YTGA 2EMXA 2ENHA 2EQ3A 2EM3A 2EOXA 4R2CA 3MHHC 4M9VC 1P47A 2EQ0A 2D9HA 2EMHA 2LVHA 2YTQA 4IS1C 2EPRA 3VHTB 2YTIA 5KL6A 2DLQA 2LT7A 2EMCA 2EMKA 2EL6A 2EN1A 2EORA 2EM8A 3MHSC 1TF3A 2JPAA 2EN4A 2EN6A 1TF6A 5KL4A 2EPXA
chains in the Genus database with same CATH superfamily
1X48A 5LL6R 2BB8A 2CT1A 1LLMC 2EOEA 5AE1A 1A1IA 1PJSA 2JXPA 2EMLA 5A6KA 1A1HA 4DR7E 3C4TA 4JV5E 3JAMC 4X66E 2LCEA 2LUQA 2V8QB 2YRKA 4F2JC 2VE7C 3JU0A 2L8TA 2RSIA 1MEYC 1QNTA 2EPPA 2EZ6A 4F9AB 1RC7A 1UHZA 3F6GA 3BBGA 2EN8A 1T4OA 1YFHA 2WBSA 4R2RA 2EQ1A 2MKDA 4BC9A 2CSHA 4JI1E 1FKAE 4LFCE 4LFBE 4WXDA 1MGTA 4X8WA 4DR1E 1HNXE 1X3CA 2MKNA 5KL2A 1GZ6A 4ZYHA 3J80C 3EPKA 3BIDA 2L6MA 4R03A 2UXDE 3IWCA 2YTNA 2YU8A 1X6FA 4GZNC 2EOFA 2YTFA 5KL7A 3OTOE 2N3GA 2G7HA 1WHNA 3J7Yp 1A1GA 4X64E 2VF1A 1IMUA 2YTJA 1RMDA 2ODRC 2N3HA 1IQSA 3JTZA 2RS7A 1A1JA 1ZU1A 3IWDA 2YRHA 2UXCE 1RQ0A 2M9AA 2YRMA 1UN6B 4YHHE 3HPSA 2EN3A 1YUIA 2JR1A 4LFAE 1IQOA 4X9JA 2YSOA 2LJUA 2V83A 5AASA 3ADGA 3MSWA 1ZR9A 2I9IA 3EPLA 2CTDA 4JI4E 1I94E 3P1XA 4NXNE 2EP3A 2MC5A 2JWOA 2EN2A 4DR2E 2ENHA 2EQ3A 4P78A 4BC7A 3MHHC 4Q28A 4JI5E 4M9VC 2UUBE 4X62E 1YYWA 1YYKA 4DR5E 2YZTA 3RMPA 3ADIA 3VHTB 5A2QC 2EMCA 4JI8E 1XMOE 4JI7E 2EN6A 1IBKE 4KZSA 2L3CA 3BGHA 2DRPA 4B3SE 3L00A 4P7DA 2RSMA 3KWRA 4O5GA 4F6MA 5A6BD 5A6JA 2EOYA 2B7VA 2EM5A 2L2NA 4WYQB 2HJJA 2Q8UA 1SR9A 2EOSA 2CPNA 2B3TB 1YYOA 5A6AA 4B3TE 5AE3A 4KHPE 5KL3A 2ELZA 2LUPB 1WXRA 4GKJE 2DGCA 4LF8E 1GTKA 2RTXA 2EMAA 2FTXB 2YSPA 2VQFE 4K0KE 2EPZA 4DV5E 2YTPA 2M1SA 1BB8A 1ZAAC 2NA2A 3DJWA 3K6QA 2YTOA 3HQ1A 1IBME 4TUGA 4BMJA 1N3GA 2E5LE 4JI3E 4NXME 3THOB 2EOZA 2ELYA 4AQYE 5IWAE 4R2QA 3VYYA 1ZBTA 5LMNE 3TQMA 4R2DA 2BBGA 2EM2A 1QU6A 4OX9E 1PJTA 2EPKX 2YU5A 2V86A 5A6BA 3ECRA 5AC4A 3KZZA 4WSGA 1DI2A 1N32E 1X6HA 2YTDA 2UUCE 1EKZA 4DUYE 2EOOA 2DMYA 2KONA 2J7JA 4DUZE 4R2EA 4M30A 2LMZA 1N33E 2V87A 5KL5A 1BBGA 2M7QA 4FK5C 1X6EA 4JI6E 1SFEA 2YPNA 1XNQE 4LF7E 2JP9A 1HNWE 2ENAA 3T1YE 1TN9A 2WBTA 2EMFA 2NUGA 1O0WA 1TF6A 4R2PA 2YTGA 2ZM6E 4F54A 2EM3A 4R2CA 5T6JA 2K7IA 2LBSB 2D9HA 2B9DA 2YTQA 1YZ9A 4DV1E 2V85A 2EPRA 4KWYA 4GKKE 2EL6A 4I8OA 3LMLA 5TSEA 5IV8B 2EN4A 1DGCA 2LV2A 2EOQA 4HEIA 4RH8A 3VK6A 2EOJA 1YUJA 2EMWA 1AAYA 2EPCA 3HTXA 1Z1BA 2L2KB 3J81C 2EN7A 2RPCA 5LLQA 4DV2E 1XMQE 2EM7A 1IBLE 2NUEA 2LJHA 2JY9A 2A25A 2EM9A 1EH6A 3C6MA 3T1HE 4OOGC 2NUFA 1WHQA 2FV4B 2JVAA 2MC6A 4M0VA 3H09A 3AUZA 3EQ1A 4LTYA 3ADLA 2LO3A 4ZYGA 2YTEA 3ADJA 1X47A 2EWLA 2EOIA 2RQLA 4BS9A 2DLKA 5AE2A 1X5WA 1HNZE 4BBYA 4GEQB 2EPAA 2EMYA 2EM6A 4WFTA 3THNA 4DMIA 2RS6A 2WZOA 1A1KA 1YPNA 1EH8A 4F6NA 2EPLX 2YT4A 3QG5C 4DR6E 4LF6E 2JYAA 2GLIA 2DB2A 2JOXA 2EJ4A 1A1FA 2IHR1 4WSPA 1X49A 2N8XA 1NCSA 2UUAE 4IJDA 3ZOQB 2M4IA 4O43A 4JI2E 2DMIA 4DR4E 1UBDC 2EPOA 2EMBA 2EM4A 4DV7E 2EL5A 4DKKA 4B3RE 2EL4A 2WCC3 2E72A 1JK2A 4O4KA 1XNRE 2DIXA 1BBOA 1PKPA 5F3WA 1KYQA 2WBUA 2EPUA 1HR0E 2F8BA 2GHFA 2L2MA 2HC5A 3HXLA 2I13A 1PJQA 3M99B 1PDAA 2E1MA 2EM0A 5LMUE 1J26A 4F9CB 4DV3E 4LF9E 4MLVA 2VQEE 1KJKA 2GPIA 5AC5A 3IWBA 2EMXA 4HTGA 2LE2A 1P47A 4JYAE 2EQ0A 1N34E 4Q35B 2LRSA 4IS1C 4J8ZA 1AH5A 4ZYDA 1T38A 5KL6A 2DLQA 2EMKA 2EPNA 2EN1A 2EORA 2EM8A 3MHSC 1T4LB 1TF3A 2JPAA 2MDRA 4NHRA 1T4NA 2EPXA 4YY3E 2YWQA 2DSYA 4DV4E 2L33A 2L3JA 3F6HA 2F4VE 3BF2A 2PRTA 4L8NA 2EMZA 4MLQA 2V88A 2EOMA 4JI0E 1J5EE 2ADRA 4LF5E 2VRDA 2MDGA 1DQ3A 1JK1A 2EPMX 4B3ME 3LLHA 2B7TA 4BCAA 2ENCA 2K4VA 3HPZA 2R1FA 1N36E 3C4BA 1YSAC 4L5NC 1ZBQA 2LTSA 4R8OA 5DNYA 4WX9A 1G2FC 4M2ZA 2LTRA 4TUIA 5IT9C 2V89A 4WXCA 5CFFE 2EE8A 2FGGA 1FJGE 1STUA 2ODRD 4R2SA 5BR8E 3UK3C 2H36X 3FIGA 5FLXC 4X65E 4DV6E 1A1LA 3AV0A 4LF4E 1UILA 4LU9A 3J7AG 2UXBE 4BHCA 1WJPA 2R76A 2HGHA 3EPHA 4ZYEA 4R2AA 5IXMB 4F9BB 1WRJA 1T39A 1GQEA 1F2IG 2EOHA 2NABA 2L92A 4NZVA 2EMGA 3EPJA 3DF6A 2EMIA 3C6KA 1EH7A 1G2DC 3KZYA 4DR3E 3OMLA 1B69A 2JOBA 4BHBA 3VYXA 4RHBB 5A69A 2EOXA 2HHHE 2KHXA 4DV0E 2EMHA 2LVHA 4O24A 1NEIA 4N4RB 1L4SA 2YTIA 2LT7A 4WPYA 2UU9E 5ADZA 2KOUA 5KL4A
chains in the Genus database with same CATH topology
1DGCA 2LV2A 2EOQA 1YUJA 2EOJA 2BB8A 2EMWA 2CT1A 1LLMC 1AAYA 2EOEA 1A1IA 2DRPA 2EPCA 2EMLA 1Z1BA 1A1HA 2EN7A 2PRTA 2RPCA 2EM7A 4F6MA 2EMZA 2EOYA 2EM5A 2LCEA 2EOMA 2A25A 2EM9A 2YRKA 2ADRA 4F2JC 2VRDA 2EOSA 2RSIA 1MEYC 2MDGA 2EPPA 1JK1A 2EN8A 5KL3A 2ELZA 2LO3A 2YTEA 2WBSA 4R2RA 2EQ1A 2MKDA 2ENCA 2CSHA 2EOIA 2DLKA 2R1FA 2DGCA 1YSAC 1X5WA 2EMAA 2YSPA 2EPAA 2EMYA 1G2FC 2EM6A 2EPZA 2YTPA 1BB8A 1ZAAC 1A1KA 1X3CA 4F6NA 2MKNA 2YTOA 2EE8A 5KL2A 2EOZA 2ELYA 3EPKA 2GLIA 4R2QA 2YTNA 2YU8A 1X6FA 4R2SA 4GZNC 4R2DA 2EJ4A 2EOFA 1A1FA 2YTFA 5KL7A 2EM2A 3UK3C 1A1LA 1NCSA 4IJDA 2YU5A 1A1GA 2DMIA 2YTJA 1UBDC 1RMDA 2EMBA 2EM4A 4WSGA 2EL5A 1WJPA 1X6HA 2HGHA 2YTDA 2EL4A 1A1JA 1ZU1A 3EPHA 2WCC3 2E72A 2YRHA 4R2AA 1JK2A 2M9AA 2YRMA 1UN6B 1BBOA 2EOOA 2J7JA 4R2EA 2WBUA 1F2IG 2EPUA 2EOHA 2NABA 5KL5A 2EN3A 1YUIA 2GHFA 2I13A 2EMGA 4FK5C 2YSOA 1X6EA 4X9JA 3EPJA 2EMIA 3M99B 1ZR9A 3EPLA 2CTDA 2EM0A 1G2DC 2JP9A 2EP3A 1B69A 2ENAA 1TN9A 2WBTA 2EMFA 2EN2A 1KJKA 4R2PA 2YTGA 2EMXA 2ENHA 2EQ3A 2EM3A 2EOXA 4R2CA 3MHHC 4M9VC 1P47A 2EQ0A 2D9HA 2EMHA 2LVHA 2YTQA 4IS1C 2EPRA 3VHTB 2YTIA 5KL6A 2DLQA 2LT7A 2EMCA 2EMKA 2EL6A 2EN1A 2EORA 2EM8A 3MHSC 1TF3A 2JPAA 2EN4A 2EN6A 1TF6A 5KL4A 2EPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DGC A;  2LV2 A;  2EOQ A;  1YUJ A;  2EOJ A;  2BB8 A;  2EMW A;  2CT1 A;  1LLM C;  1AAY A;  2EOE A;  1A1I A;  2DRP A;  2EPC A;  2EML A;  1Z1B A;  1A1H A;  2EN7 A;  2PRT A;  2RPC A;  2EM7 A;  4F6M A;  2EMZ A;  2EOY A;  2EM5 A;  2LCE A;  2EOM A;  2A25 A;  2EM9 A;  2YRK A;  2ADR A;  4F2J C;  2VRD A;  2EOS A;  2RSI A;  1MEY C;  2MDG A;  2EPP A;  1JK1 A;  2EN8 A;  5KL3 A;  2ELZ A;  2LO3 A;  2YTE A;  2WBS A;  4R2R A;  2EQ1 A;  2MKD A;  2ENC A;  2CSH A;  2EOI A;  2DLK A;  2R1F A;  2DGC A;  1YSA C;  1X5W A;  2EMA A;  2YSP A;  2EPA A;  2EMY A;  1G2F C;  2EM6 A;  2EPZ A;  2YTP A;  1BB8 A;  1ZAA C;  1A1K A;  1X3C A;  4F6N A;  2MKN A;  2YTO A;  2EE8 A;  5KL2 A;  2EOZ A;  2ELY A;  3EPK A;  2GLI A;  4R2Q A;  2YTN A;  2YU8 A;  1X6F A;  4R2S A;  4GZN C;  4R2D A;  2EJ4 A;  2EOF A;  1A1F A;  2YTF A;  5KL7 A;  2EM2 A;  3UK3 C;  1A1L A;  1NCS A;  4IJD A;  2YU5 A;  1A1G A;  2DMI A;  2YTJ A;  1UBD C;  1RMD A;  2EMB A;  2EM4 A;  4WSG A;  2EL5 A;  1WJP A;  1X6H A;  2HGH A;  2YTD A;  2EL4 A;  1A1J A;  1ZU1 A;  3EPH A;  2WCC 3;  2E72 A;  2YRH A;  4R2A A;  1JK2 A;  2M9A A;  2YRM A;  1UN6 B;  1BBO A;  2EOO A;  2J7J A;  4R2E A;  2WBU A;  1F2I G;  2EPU A;  2EOH A;  2NAB A;  5KL5 A;  2EN3 A;  1YUI A;  2GHF A;  2I13 A;  2EMG A;  4FK5 C;  2YSO A;  1X6E A;  4X9J A;  3EPJ A;  2EMI A;  3M99 B;  1ZR9 A;  3EPL A;  2CTD A;  2EM0 A;  1G2D C;  2JP9 A;  2EP3 A;  1B69 A;  2ENA A;  1TN9 A;  2WBT A;  2EMF A;  2EN2 A;  1KJK A;  4R2P A;  2YTG A;  2EMX A;  2ENH A;  2EQ3 A;  2EM3 A;  2EOX A;  4R2C A;  3MHH C;  4M9V C;  1P47 A;  2EQ0 A;  2D9H A;  2EMH A;  2LVH A;  2YTQ A;  4IS1 C;  2EPR A;  3VHT B;  2YTI A;  5KL6 A;  2DLQ A;  2LT7 A;  2EMC A;  2EMK A;  2EL6 A;  2EN1 A;  2EOR A;  2EM8 A;  3MHS C;  1TF3 A;  2JPA A;  2EN4 A;  2EN6 A;  1TF6 A;  5KL4 A;  2EPX A; 
#chains in the Genus database with same CATH topology
 1X48 A;  5LL6 R;  2BB8 A;  2CT1 A;  1LLM C;  2EOE A;  5AE1 A;  1A1I A;  1PJS A;  2JXP A;  2EML A;  5A6K A;  1A1H A;  4DR7 E;  3C4T A;  4JV5 E;  3JAM C;  4X66 E;  2LCE A;  2LUQ A;  2V8Q B;  2YRK A;  4F2J C;  2VE7 C;  3JU0 A;  2L8T A;  2RSI A;  1MEY C;  1QNT A;  2EPP A;  2EZ6 A;  4F9A B;  1RC7 A;  1UHZ A;  3F6G A;  3BBG A;  2EN8 A;  1T4O A;  1YFH A;  2WBS A;  4R2R A;  2EQ1 A;  2MKD A;  4BC9 A;  2CSH A;  4JI1 E;  1FKA E;  4LFC E;  4LFB E;  4WXD A;  1MGT A;  4X8W A;  4DR1 E;  1HNX E;  1X3C A;  2MKN A;  5KL2 A;  1GZ6 A;  4ZYH A;  3J80 C;  3EPK A;  3BID A;  2L6M A;  4R03 A;  2UXD E;  3IWC A;  2YTN A;  2YU8 A;  1X6F A;  4GZN C;  2EOF A;  2YTF A;  5KL7 A;  3OTO E;  2N3G A;  2G7H A;  1WHN A;  3J7Y p;  1A1G A;  4X64 E;  2VF1 A;  1IMU A;  2YTJ A;  1RMD A;  2ODR C;  2N3H A;  1IQS A;  3JTZ A;  2RS7 A;  1A1J A;  1ZU1 A;  3IWD A;  2YRH A;  2UXC E;  1RQ0 A;  2M9A A;  2YRM A;  1UN6 B;  4YHH E;  3HPS A;  2EN3 A;  1YUI A;  2JR1 A;  4LFA E;  1IQO A;  4X9J A;  2YSO A;  2LJU A;  2V83 A;  5AAS A;  3ADG A;  3MSW A;  1ZR9 A;  2I9I A;  3EPL A;  2CTD A;  4JI4 E;  1I94 E;  3P1X A;  4NXN E;  2EP3 A;  2MC5 A;  2JWO A;  2EN2 A;  4DR2 E;  2ENH A;  2EQ3 A;  4P78 A;  4BC7 A;  3MHH C;  4Q28 A;  4JI5 E;  4M9V C;  2UUB E;  4X62 E;  1YYW A;  1YYK A;  4DR5 E;  2YZT A;  3RMP A;  3ADI A;  3VHT B;  5A2Q C;  2EMC A;  4JI8 E;  1XMO E;  4JI7 E;  2EN6 A;  1IBK E;  4KZS A;  2L3C A;  3BGH A;  2DRP A;  4B3S E;  3L00 A;  4P7D A;  2RSM A;  3KWR A;  4O5G A;  4F6M A;  5A6B D;  5A6J A;  2EOY A;  2B7V A;  2EM5 A;  2L2N A;  4WYQ B;  2HJJ A;  2Q8U A;  1SR9 A;  2EOS A;  2CPN A;  2B3T B;  1YYO A;  5A6A A;  4B3T E;  5AE3 A;  4KHP E;  5KL3 A;  2ELZ A;  2LUP B;  1WXR A;  4GKJ E;  2DGC A;  4LF8 E;  1GTK A;  2RTX A;  2EMA A;  2FTX B;  2YSP A;  2VQF E;  4K0K E;  2EPZ A;  4DV5 E;  2YTP A;  2M1S A;  1BB8 A;  1ZAA C;  2NA2 A;  3DJW A;  3K6Q A;  2YTO A;  3HQ1 A;  1IBM E;  4TUG A;  4BMJ A;  1N3G A;  2E5L E;  4JI3 E;  4NXM E;  3THO B;  2EOZ A;  2ELY A;  4AQY E;  5IWA E;  4R2Q A;  3VYY A;  1ZBT A;  5LMN E;  3TQM A;  4R2D A;  2BBG A;  2EM2 A;  1QU6 A;  4OX9 E;  1PJT A;  2EPK X;  2YU5 A;  2V86 A;  5A6B A;  3ECR A;  5AC4 A;  3KZZ A;  4WSG A;  1DI2 A;  1N32 E;  1X6H A;  2YTD A;  2UUC E;  1EKZ A;  4DUY E;  2EOO A;  2DMY A;  2KON A;  2J7J A;  4DUZ E;  4R2E A;  4M30 A;  2LMZ A;  1N33 E;  2V87 A;  5KL5 A;  1BBG A;  2M7Q A;  4FK5 C;  1X6E A;  4JI6 E;  1SFE A;  2YPN A;  1XNQ E;  4LF7 E;  2JP9 A;  1HNW E;  2ENA A;  3T1Y E;  1TN9 A;  2WBT A;  2EMF A;  2NUG A;  1O0W A;  1TF6 A;  4R2P A;  2YTG A;  2ZM6 E;  4F54 A;  2EM3 A;  4R2C A;  5T6J A;  2K7I A;  2LBS B;  2D9H A;  2B9D A;  2YTQ A;  1YZ9 A;  4DV1 E;  2V85 A;  2EPR A;  4KWY A;  4GKK E;  2EL6 A;  4I8O A;  3LML A;  5TSE A;  5IV8 B;  2EN4 A;  1DGC A;  2LV2 A;  2EOQ A;  4HEI A;  4RH8 A;  3VK6 A;  2EOJ A;  1YUJ A;  2EMW A;  1AAY A;  2EPC A;  3HTX A;  1Z1B A;  2L2K B;  3J81 C;  2EN7 A;  2RPC A;  5LLQ A;  4DV2 E;  1XMQ E;  2EM7 A;  1IBL E;  2NUE A;  2LJH A;  2JY9 A;  2A25 A;  2EM9 A;  1EH6 A;  3C6M A;  3T1H E;  4OOG C;  2NUF A;  1WHQ A;  2FV4 B;  2JVA A;  2MC6 A;  4M0V A;  3H09 A;  3AUZ A;  3EQ1 A;  4LTY A;  3ADL A;  2LO3 A;  4ZYG A;  2YTE A;  3ADJ A;  1X47 A;  2EWL A;  2EOI A;  2RQL A;  4BS9 A;  2DLK A;  5AE2 A;  1X5W A;  1HNZ E;  4BBY A;  4GEQ B;  2EPA A;  2EMY A;  2EM6 A;  4WFT A;  3THN A;  4DMI A;  2RS6 A;  2WZO A;  1A1K A;  1YPN A;  1EH8 A;  4F6N A;  2EPL X;  2YT4 A;  3QG5 C;  4DR6 E;  4LF6 E;  2JYA A;  2GLI A;  2DB2 A;  2JOX A;  2EJ4 A;  1A1F A;  2IHR 1;  4WSP A;  1X49 A;  2N8X A;  1NCS A;  2UUA E;  4IJD A;  3ZOQ B;  2M4I A;  4O43 A;  4JI2 E;  2DMI A;  4DR4 E;  1UBD C;  2EPO A;  2EMB A;  2EM4 A;  4DV7 E;  2EL5 A;  4DKK A;  4B3R E;  2EL4 A;  2WCC 3;  2E72 A;  1JK2 A;  4O4K A;  1XNR E;  2DIX A;  1BBO A;  1PKP A;  5F3W A;  1KYQ A;  2WBU A;  2EPU A;  1HR0 E;  2F8B A;  2GHF A;  2L2M A;  2HC5 A;  3HXL A;  2I13 A;  1PJQ A;  3M99 B;  1PDA A;  2E1M A;  2EM0 A;  5LMU E;  1J26 A;  4F9C B;  4DV3 E;  4LF9 E;  4MLV A;  2VQE E;  1KJK A;  2GPI A;  5AC5 A;  3IWB A;  2EMX A;  4HTG A;  2LE2 A;  1P47 A;  4JYA E;  2EQ0 A;  1N34 E;  4Q35 B;  2LRS A;  4IS1 C;  4J8Z A;  1AH5 A;  4ZYD A;  1T38 A;  5KL6 A;  2DLQ A;  2EMK A;  2EPN A;  2EN1 A;  2EOR A;  2EM8 A;  3MHS C;  1T4L B;  1TF3 A;  2JPA A;  2MDR A;  4NHR A;  1T4N A;  2EPX A;  4YY3 E;  2YWQ A;  2DSY A;  4DV4 E;  2L33 A;  2L3J A;  3F6H A;  2F4V E;  3BF2 A;  2PRT A;  4L8N A;  2EMZ A;  4MLQ A;  2V88 A;  2EOM A;  4JI0 E;  1J5E E;  2ADR A;  4LF5 E;  2VRD A;  2MDG A;  1DQ3 A;  1JK1 A;  2EPM X;  4B3M E;  3LLH A;  2B7T A;  4BCA A;  2ENC A;  2K4V A;  3HPZ A;  2R1F A;  1N36 E;  3C4B A;  1YSA C;  4L5N C;  1ZBQ A;  2LTS A;  4R8O A;  5DNY A;  4WX9 A;  1G2F C;  4M2Z A;  2LTR A;  4TUI A;  5IT9 C;  2V89 A;  4WXC A;  5CFF E;  2EE8 A;  2FGG A;  1FJG E;  1STU A;  2ODR D;  4R2S A;  5BR8 E;  3UK3 C;  2H36 X;  3FIG A;  5FLX C;  4X65 E;  4DV6 E;  1A1L A;  3AV0 A;  4LF4 E;  1UIL A;  4LU9 A;  3J7A G;  2UXB E;  4BHC A;  1WJP A;  2R76 A;  2HGH A;  3EPH A;  4ZYE A;  4R2A A;  5IXM B;  4F9B B;  1WRJ A;  1T39 A;  1GQE A;  1F2I G;  2EOH A;  2NAB A;  2L92 A;  4NZV A;  2EMG A;  3EPJ A;  3DF6 A;  2EMI A;  3C6K A;  1EH7 A;  1G2D C;  3KZY A;  4DR3 E;  3OML A;  1B69 A;  2JOB A;  4BHB A;  3VYX A;  4RHB B;  5A69 A;  2EOX A;  2HHH E;  2KHX A;  4DV0 E;  2EMH A;  2LVH A;  4O24 A;  1NEI A;  4N4R B;  1L4S A;  2YTI A;  2LT7 A;  4WPY A;  2UU9 E;  5ADZ A;  2KOU A;  5KL4 A; 
#chains in the Genus database with same CATH homology
 1DGC A;  2LV2 A;  2EOQ A;  1YUJ A;  2EOJ A;  2BB8 A;  2EMW A;  2CT1 A;  1LLM C;  1AAY A;  2EOE A;  1A1I A;  2DRP A;  2EPC A;  2EML A;  1Z1B A;  1A1H A;  2EN7 A;  2PRT A;  2RPC A;  2EM7 A;  4F6M A;  2EMZ A;  2EOY A;  2EM5 A;  2LCE A;  2EOM A;  2A25 A;  2EM9 A;  2YRK A;  2ADR A;  4F2J C;  2VRD A;  2EOS A;  2RSI A;  1MEY C;  2MDG A;  2EPP A;  1JK1 A;  2EN8 A;  5KL3 A;  2ELZ A;  2LO3 A;  2YTE A;  2WBS A;  4R2R A;  2EQ1 A;  2MKD A;  2ENC A;  2CSH A;  2EOI A;  2DLK A;  2R1F A;  2DGC A;  1YSA C;  1X5W A;  2EMA A;  2YSP A;  2EPA A;  2EMY A;  1G2F C;  2EM6 A;  2EPZ A;  2YTP A;  1BB8 A;  1ZAA C;  1A1K A;  1X3C A;  4F6N A;  2MKN A;  2YTO A;  2EE8 A;  5KL2 A;  2EOZ A;  2ELY A;  3EPK A;  2GLI A;  4R2Q A;  2YTN A;  2YU8 A;  1X6F A;  4R2S A;  4GZN C;  4R2D A;  2EJ4 A;  2EOF A;  1A1F A;  2YTF A;  5KL7 A;  2EM2 A;  3UK3 C;  1A1L A;  1NCS A;  4IJD A;  2YU5 A;  1A1G A;  2DMI A;  2YTJ A;  1UBD C;  1RMD A;  2EMB A;  2EM4 A;  4WSG A;  2EL5 A;  1WJP A;  1X6H A;  2HGH A;  2YTD A;  2EL4 A;  1A1J A;  1ZU1 A;  3EPH A;  2WCC 3;  2E72 A;  2YRH A;  4R2A A;  1JK2 A;  2M9A A;  2YRM A;  1UN6 B;  1BBO A;  2EOO A;  2J7J A;  4R2E A;  2WBU A;  1F2I G;  2EPU A;  2EOH A;  2NAB A;  5KL5 A;  2EN3 A;  1YUI A;  2GHF A;  2I13 A;  2EMG A;  4FK5 C;  2YSO A;  1X6E A;  4X9J A;  3EPJ A;  2EMI A;  3M99 B;  1ZR9 A;  3EPL A;  2CTD A;  2EM0 A;  1G2D C;  2JP9 A;  2EP3 A;  1B69 A;  2ENA A;  1TN9 A;  2WBT A;  2EMF A;  2EN2 A;  1KJK A;  4R2P A;  2YTG A;  2EMX A;  2ENH A;  2EQ3 A;  2EM3 A;  2EOX A;  4R2C A;  3MHH C;  4M9V C;  1P47 A;  2EQ0 A;  2D9H A;  2EMH A;  2LVH A;  2YTQ A;  4IS1 C;  2EPR A;  3VHT B;  2YTI A;  5KL6 A;  2DLQ A;  2LT7 A;  2EMC A;  2EMK A;  2EL6 A;  2EN1 A;  2EOR A;  2EM8 A;  3MHS C;  1TF3 A;  2JPA A;  2EN4 A;  2EN6 A;  1TF6 A;  5KL4 A;  2EPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...