2FV4B

Nmr solution structure of the yeast kinetochore spc24/spc25 globular domain
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
58
structure length
58
Chain Sequence
NENILKLKLYRSLGVILDLENDQVLINRKNDGNIDILPLDNNLSDFYKTKYIWERLGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a central component of the yeast kinetochore: the spc24p/spc25p globular domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein, protein binding
molecule keywords Hypothetical 25.2 kDa protein in AFG3-SEB2 intergenic region
total genus 16
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2006-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.430 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2fv4B00
5T6JA 2FTXB 4GEQB 2FV4B
chains in the Genus database with same CATH superfamily
2MDGA 2EM2A 2EL4A 1X6FA 1X3CA 1Z1BA 1BB8A 3C6KA 2YT4A 1HNZE 1IBLE 4DR7E 2NA2A 2YTEA 2EQ0A 2EM0A 2WCC3 5LL6R 2KONA 4DV3E 4WXDA 4LFBE 3VYYA 2YSOA 4DV7E 2RQLA 2M1SA 4LF9E 2HC5A 2EOHA 4LF5E 2EL5A 2LUPB 1N32E 1DGCA 2E5LE 5FLXC 2K4VA 2EM6A 2EJ4A 2HHHE 2ELZA 2CPNA 1LLMC 1N36E 4MLQA 2EOXA 2YU5A 3QG5C 2EPLX 4I8OA 2N3GA 4F9BB 2YZTA 2E72A 2ENHA 2EMKA 3T1HE 1DQ3A 2LMZA 2PRTA 4R8OA 1B69A 2EM7A 1J26A 2EPAA 2RTXA 3HPSA 4KHPE 4MLVA 1UN6B 4B3SE 4JI1E 4RHBB 5A2QC 2F8BA 3EPKA 1RQ0A 2EMWA 3IWBA 2FV4B 1XNQE 1NCSA 1P47A 1A1HA 1IBKE 2EOEA 3C4BA 1WJPA 1ZBQA 2J7JA 2FGGA 4F2JC 4LF7E 2YTOA 5A6AA 4DV5E 4AQYE 4LF4E 4N4RB 4DV6E 2DLKA 2EQ1A 3L00A 1TF6A 4O4KA 2YRHA 4B3ME 3H09A 3JU0A 4BMJA 4BHCA 2R1FA 2B3TB 1BBGA 5LLQA 1STUA 3VK6A 4JI4E 4FK5C 4BC9A 2JXPA 2DSYA 4R2EA 1FJGE 5A69A 1O0WA 2JY9A 1ZAAC 4WFTA 1T4OA 2LO3A 2V88A 5F3WA 1MEYC 4JI3E 1YPNA 2UUBE 2EM4A 1WHQA 5AC5A 2UUCE 1N33E 2LTRA 2EPNA 3LMLA 2KOUA 1A1LA 1PJSA 2DLQA 5AE2A 2LBSB 2WZOA 2EPXA 2R76A 1G2FC 1T39A 1SR9A 3KZYA 4ZYDA 2L33A 1QU6A 4JYAE 2UXDE 4R2RA 1XMQE 2LCEA 2JOXA 4F9CB 4Q28A 2EMCA 2EPZA 2I9IA 3J7Yp 1YFHA 4L8NA 4X8WA 3J81C 4TUGA 4GKJE 2A25A 2EMHA 3KZZA 4YHHE 2EP3A 5KL5A 4GZNC 2EOOA 2HGHA 2EOFA 2EMYA 1A1KA 2ENAA 2DIXA 3ZOQB 1YUJA 4O43A 2UU9E 4X9JA 2V89A 1T4LB 4LFCE 1EH8A 2EMAA 2YU8A 5A6JA 2YTDA 3VHTB 3ECRA 2YTGA 1WXRA 3EPLA 2EE8A 2LUQA 2L2MA 2JR1A 2GPIA 4GEQB 4R03A 1G2DC 3THOB 2Q8UA 2MKDA 4O24A 1GZ6A 2F4VE 2NABA 1EH6A 1HR0E 2EN2A 1JK2A 4LTYA 4LF8E 4ZYHA 4KWYA 4DV1E 1TF3A 4R2DA 5ADZA 4F6NA 1X6EA 1RC7A 1X47A 2V86A 4ZYGA 4KZSA 4DUZE 1ZR9A 4NXNE 2YPNA 2EL6A 3VYXA 1FKAE 2YTQA 5IXMB 2IHR1 1PJQA 2EOIA 3T1YE 1RMDA 3UK3C 2YTJA 3M99B 2EOSA 4R2CA 4BBYA 3MSWA 3TQMA 4JI5E 5AC4A 5IV8B 4RH8A 2L6MA 4DR6E 1YYWA 2DRPA 1HNXE 4JI0E 1A1GA 4M30A 4ZYEA 2EN6A 2EMLA 4BCAA 4TUIA 5KL3A 1NEIA 1YUIA 4LU9A 5KL7A 4WYQB 5IWAE 4OX9E 1XNRE 4JI2E 1X6HA 2ADRA 3MHSC 3EPHA 1J5EE 1UILA 3IWCA 4B3RE 2EM9A 2GLIA 2BBGA 5TSEA 1YZ9A 2EPPA 2EOYA 2CTDA 2L3CA 2EN1A 4BS9A 3JAMC 2M7QA 3AV0A 2YTPA 4DR5E 2LJUA 1A1FA 1YYOA 2K7IA 4R2SA 3OMLA 2NUGA 1HNWE 4J8ZA 1TN9A 2EMBA 1GQEA 2GHFA 4X62E 4DV2E 4P7DA 4NXME 2ODRD 2LT7A 4X66E 3C6MA 3HQ1A 4LF6E 2RS7A 4F54A 3F6HA 4P78A 2V87A 4M0VA 2RSIA 2BB8A 5T6JA 2L3JA 3KWRA 2EMIA 2EPRA 5KL4A 4B3TE 2EOJA 5LMUE 1IQOA 1YYKA 4WXCA 4DV0E 4NZVA 1PKPA 4R2PA 2EMZA 2RPCA 3RMPA 4JI6E 2VF1A 2YRMA 1UHZA 2RSMA 2LV2A 3C4TA 2JWOA 4M2ZA 2CT1A 3P1XA 2MDRA 3HTXA 3K6QA 4F9AB 2DMIA 2ODRC 4DR2E 2LVHA 4IS1C 4LFAE 2HJJA 3ADIA 2YTIA 4R2QA 1UBDC 1A1JA 5IT9C 2EM5A 4O5GA 4OOGC 2WBUA 4L5NC 3BIDA 2CSHA 2LJHA 5DNYA 2EZ6A 2EOMA 2VRDA 2EPUA 2L2NA 2EPOA 4BHBA 2B7TA 3IWDA 1IMUA 2L2KB 1WHNA 5AE3A 2V8QB 4BC7A 2EM3A 2EM8A 2JP9A 2MKNA 1F2IG 5CFFE 2JOBA 2EMFA 4YY3E 1T4NA 1GTKA 2EOZA 2DB2A 1KJKA 2YTNA 5KL2A 2EN4A 4WSPA 1YSAC 4K0KE 2ENCA 4JV5E 5A6BA 2DMYA 1PJTA 3DJWA 1SFEA 2UXBE 1DI2A 4DUYE 1JK1A 3J7AG 2EMGA 3THNA 1XMOE 5A6KA 1AH5A 2D9HA 2LTSA 2YTFA 2LRSA 2E1MA 2I13A 2M4IA 2EOQA 4X65E 2ELYA 5AE1A 2B7VA 2VE7C 4WPYA 5AASA 3BBGA 1ZU1A 3FIGA 3AUZA 2UXCE 4Q35B 4F6MA 3BF2A 1IQSA 2NUEA 2EPKX 2YRKA 3EQ1A 2UUAE 2RS6A 3LLHA 4M9VC 1EH7A 4JI8E 4GKKE 4DKKA 2ZM6E 1MGTA 2FTXB 2KHXA 4DR1E 2MC5A 1AAYA 1X48A 3MHHC 5BR8E 2EN8A 2V83A 2JPAA 4X64E 2L8TA 1N34E 1T38A 2G7HA 3HPZA 2EORA 2N8XA 2YWQA 2MC6A 4DMIA 2EQ3A 1KYQA 2JYAA 5KL6A 3ADGA 3J80C 2VQFE 4WSGA 1N3GA 2H36X 1L4SA 2YSPA 2L92A 1X5WA 3JTZA 3F6GA 2EPCA 4DR3E 1IBME 1A1IA 4NHRA 4JI7E 2EN7A 1X49A 2VQEE 2B9DA 4IJDA 2WBSA 1PDAA 2M9AA 3BGHA 3OTOE 2EPMX 3ADJA 3HXLA 2DGCA 1I94E 1EKZA 4WX9A 4R2AA 1QNTA 3DF6A 1BBOA 2EMXA 2EN3A 1ZBTA 2WBTA 2LE2A 4HEIA 5A6BD 2V85A 2JVAA 1WRJA 4DV4E 3EPJA 2NUFA 3ADLA 4DR4E 4HTGA 5LMNE 2EWLA 2N3HA
chains in the Genus database with same CATH topology
4JI2E 2LTRA 4WSPA 1J5EE 1UILA 2YT4A 3IWCA 3LMLA 1IBLE 1HNZE 2KOUA 4B3RE 4K0KE 4JV5E 4DR7E 5AE2A 2LBSB 2WZOA 2NA2A 2DMYA 3DJWA 1SR9A 1YZ9A 2UXBE 1DI2A 5LL6R 2KONA 4DV3E 4DUYE 3J7AG 2L33A 4LFBE 1QU6A 3VYYA 2L3CA 4JYAE 4BS9A 3JAMC 2UXDE 2M7QA 3AV0A 4DR5E 1XMOE 4DV7E 2M1SA 1YYOA 4LF9E 1XMQE 2LTSA 4LF5E 2JOXA 2LRSA 4F9CB 2E1MA 3OMLA 4Q28A 2NUGA 1WHQA 1HNWE 2LUPB 2M4IA 4J8ZA 4X65E 1N32E 3J7Yp 1GQEA 2E5LE 4L8NA 5FLXC 2K4VA 5AE1A 4X62E 4DV2E 2HHHE 4X8WA 2B7VA 3J81C 2VE7C 4P7DA 4TUGA 4GKJE 4WPYA 4NXME 2ODRD 5AASA 2CPNA 3AUZA 3FIGA 3HQ1A 4X66E 2RS7A 1N36E 4LF6E 4YHHE 4F54A 2UXCE 2DIXA 3F6HA 4P78A 4I8OA 2NUEA 2N3GA 3ZOQB 2UU9E 2UUAE 2V87A 2V89A 4M0VA 1T4LB 4F9BB 5T6JA 2L3JA 2YZTA 2RS6A 3LLHA 4LFCE 4JI8E 3KWRA 4GKKE 4B3TE 4DKKA 2ZM6E 5LMUE 2FTXB 2KHXA 1YYKA 4DR1E 3T1HE 1DQ3A 2MC5A 4DV0E 1WXRA 2LUQA 2LMZA 4R8OA 1X48A 2L2MA 2JR1A 5BR8E 4GEQB 2V83A 1PKPA 4R03A 1J26A 4X64E 2L8TA 2RTXA 1N34E 1GZ6A 2F4VE 3HPSA 4KHPE 3RMPA 2G7HA 2VF1A 1HR0E 4B3SE 4JI6E 4JI1E 3HPZA 5A2QC 1UHZA 2RSMA 4LTYA 2F8BA 4LF8E 3C4TA 1RQ0A 2MC6A 2JWOA 3IWBA 4M2ZA 4DMIA 2FV4B 4DV1E 2UUCE 3P1XA 2MDRA 3HTXA 5ADZA 1XNQE 3K6QA 4F9AB 3ADGA 1IBKE 1RC7A 1X47A 3J80C 3C4BA 2VQFE 2V86A 1ZBQA 2ODRC 2FGGA 4KZSA 4DR2E 2H36X 4DUZE 4LFAE 4NXNE 3ADIA 2L92A 4LF7E 3JTZA 3VYXA 1FKAE 3F6GA 5IT9C 2IHR1 4DV5E 4AQYE 4LF4E 4OOGC 4DR3E 4L5NC 4DV6E 1IBME 4JI7E 3T1YE 1N33E 1X49A 2LJHA 2VQEE 5DNYA 2EZ6A 2B9DA 4B3ME 3H09A 2L2NA 3JU0A 4BMJA 4BBYA 3OTOE 2B7TA 3IWDA 3ADJA 3MSWA 2L2KB 4JI5E 3HXLA 2L6MA 1I94E 1EKZA 2B3TB 1YYWA 4DR6E 1STUA 1WHNA 3VK6A 5AE3A 3DF6A 1HNXE 4JI0E 4JI4E 2V8QB 4M30A 4BC9A 2DSYA 1FJGE 1ZBTA 1O0WA 2JY9A 4BC7A 4WFTA 1T4OA 2LE2A 4BCAA 4TUIA 2V85A 2JVAA 5CFFE 2JOBA 4DV4E 2V88A 5F3WA 4YY3E 1T4NA 2NUFA 4LU9A 3ADLA 4WYQB 4JI3E 4DR4E 5IWAE 2UUBE 4OX9E 1XNRE 5LMNE 2EWLA 2DB2A 2N3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5T6J A;  2FTX B;  4GEQ B;  2FV4 B; 
#chains in the Genus database with same CATH topology
 2MDG A;  2EM2 A;  2EL4 A;  1X6F A;  1X3C A;  1Z1B A;  1BB8 A;  3C6K A;  2YT4 A;  1HNZ E;  1IBL E;  4DR7 E;  2NA2 A;  2YTE A;  2EQ0 A;  2EM0 A;  2WCC 3;  5LL6 R;  2KON A;  4DV3 E;  4WXD A;  4LFB E;  3VYY A;  2YSO A;  4DV7 E;  2RQL A;  2M1S A;  4LF9 E;  2HC5 A;  2EOH A;  4LF5 E;  2EL5 A;  2LUP B;  1N32 E;  1DGC A;  2E5L E;  5FLX C;  2K4V A;  2EM6 A;  2EJ4 A;  2HHH E;  2ELZ A;  2CPN A;  1LLM C;  1N36 E;  4MLQ A;  2EOX A;  2YU5 A;  3QG5 C;  2EPL X;  4I8O A;  2N3G A;  4F9B B;  2YZT A;  2E72 A;  2ENH A;  2EMK A;  3T1H E;  1DQ3 A;  2LMZ A;  2PRT A;  4R8O A;  1B69 A;  2EM7 A;  1J26 A;  2EPA A;  2RTX A;  3HPS A;  4KHP E;  4MLV A;  1UN6 B;  4B3S E;  4JI1 E;  4RHB B;  5A2Q C;  2F8B A;  3EPK A;  1RQ0 A;  2EMW A;  3IWB A;  2FV4 B;  1XNQ E;  1NCS A;  1P47 A;  1A1H A;  1IBK E;  2EOE A;  3C4B A;  1WJP A;  1ZBQ A;  2J7J A;  2FGG A;  4F2J C;  4LF7 E;  2YTO A;  5A6A A;  4DV5 E;  4AQY E;  4LF4 E;  4N4R B;  4DV6 E;  2DLK A;  2EQ1 A;  3L00 A;  1TF6 A;  4O4K A;  2YRH A;  4B3M E;  3H09 A;  3JU0 A;  4BMJ A;  4BHC A;  2R1F A;  2B3T B;  1BBG A;  5LLQ A;  1STU A;  3VK6 A;  4JI4 E;  4FK5 C;  4BC9 A;  2JXP A;  2DSY A;  4R2E A;  1FJG E;  5A69 A;  1O0W A;  2JY9 A;  1ZAA C;  4WFT A;  1T4O A;  2LO3 A;  2V88 A;  5F3W A;  1MEY C;  4JI3 E;  1YPN A;  2UUB E;  2EM4 A;  1WHQ A;  5AC5 A;  2UUC E;  1N33 E;  2LTR A;  2EPN A;  3LML A;  2KOU A;  1A1L A;  1PJS A;  2DLQ A;  5AE2 A;  2LBS B;  2WZO A;  2EPX A;  2R76 A;  1G2F C;  1T39 A;  1SR9 A;  3KZY A;  4ZYD A;  2L33 A;  1QU6 A;  4JYA E;  2UXD E;  4R2R A;  1XMQ E;  2LCE A;  2JOX A;  4F9C B;  4Q28 A;  2EMC A;  2EPZ A;  2I9I A;  3J7Y p;  1YFH A;  4L8N A;  4X8W A;  3J81 C;  4TUG A;  4GKJ E;  2A25 A;  2EMH A;  3KZZ A;  4YHH E;  2EP3 A;  5KL5 A;  4GZN C;  2EOO A;  2HGH A;  2EOF A;  2EMY A;  1A1K A;  2ENA A;  2DIX A;  3ZOQ B;  1YUJ A;  4O43 A;  2UU9 E;  4X9J A;  2V89 A;  1T4L B;  4LFC E;  1EH8 A;  2EMA A;  2YU8 A;  5A6J A;  2YTD A;  3VHT B;  3ECR A;  2YTG A;  1WXR A;  3EPL A;  2EE8 A;  2LUQ A;  2L2M A;  2JR1 A;  2GPI A;  4GEQ B;  4R03 A;  1G2D C;  3THO B;  2Q8U A;  2MKD A;  4O24 A;  1GZ6 A;  2F4V E;  2NAB A;  1EH6 A;  1HR0 E;  2EN2 A;  1JK2 A;  4LTY A;  4LF8 E;  4ZYH A;  4KWY A;  4DV1 E;  1TF3 A;  4R2D A;  5ADZ A;  4F6N A;  1X6E A;  1RC7 A;  1X47 A;  2V86 A;  4ZYG A;  4KZS A;  4DUZ E;  1ZR9 A;  4NXN E;  2YPN A;  2EL6 A;  3VYX A;  1FKA E;  2YTQ A;  5IXM B;  2IHR 1;  1PJQ A;  2EOI A;  3T1Y E;  1RMD A;  3UK3 C;  2YTJ A;  3M99 B;  2EOS A;  4R2C A;  4BBY A;  3MSW A;  3TQM A;  4JI5 E;  5AC4 A;  5IV8 B;  4RH8 A;  2L6M A;  4DR6 E;  1YYW A;  2DRP A;  1HNX E;  4JI0 E;  1A1G A;  4M30 A;  4ZYE A;  2EN6 A;  2EML A;  4BCA A;  4TUI A;  5KL3 A;  1NEI A;  1YUI A;  4LU9 A;  5KL7 A;  4WYQ B;  5IWA E;  4OX9 E;  1XNR E;  4JI2 E;  1X6H A;  2ADR A;  3MHS C;  3EPH A;  1J5E E;  1UIL A;  3IWC A;  4B3R E;  2EM9 A;  2GLI A;  2BBG A;  5TSE A;  1YZ9 A;  2EPP A;  2EOY A;  2CTD A;  2L3C A;  2EN1 A;  4BS9 A;  3JAM C;  2M7Q A;  3AV0 A;  2YTP A;  4DR5 E;  2LJU A;  1A1F A;  1YYO A;  2K7I A;  4R2S A;  3OML A;  2NUG A;  1HNW E;  4J8Z A;  1TN9 A;  2EMB A;  1GQE A;  2GHF A;  4X62 E;  4DV2 E;  4P7D A;  4NXM E;  2ODR D;  2LT7 A;  4X66 E;  3C6M A;  3HQ1 A;  4LF6 E;  2RS7 A;  4F54 A;  3F6H A;  4P78 A;  2V87 A;  4M0V A;  2RSI A;  2BB8 A;  5T6J A;  2L3J A;  3KWR A;  2EMI A;  2EPR A;  5KL4 A;  4B3T E;  2EOJ A;  5LMU E;  1IQO A;  1YYK A;  4WXC A;  4DV0 E;  4NZV A;  1PKP A;  4R2P A;  2EMZ A;  2RPC A;  3RMP A;  4JI6 E;  2VF1 A;  2YRM A;  1UHZ A;  2RSM A;  2LV2 A;  3C4T A;  2JWO A;  4M2Z A;  2CT1 A;  3P1X A;  2MDR A;  3HTX A;  3K6Q A;  4F9A B;  2DMI A;  2ODR C;  4DR2 E;  2LVH A;  4IS1 C;  4LFA E;  2HJJ A;  3ADI A;  2YTI A;  4R2Q A;  1UBD C;  1A1J A;  5IT9 C;  2EM5 A;  4O5G A;  4OOG C;  2WBU A;  4L5N C;  3BID A;  2CSH A;  2LJH A;  5DNY A;  2EZ6 A;  2EOM A;  2VRD A;  2EPU A;  2L2N A;  2EPO A;  4BHB A;  2B7T A;  3IWD A;  1IMU A;  2L2K B;  1WHN A;  5AE3 A;  2V8Q B;  4BC7 A;  2EM3 A;  2EM8 A;  2JP9 A;  2MKN A;  1F2I G;  5CFF E;  2JOB A;  2EMF A;  4YY3 E;  1T4N A;  1GTK A;  2EOZ A;  2DB2 A;  1KJK A;  2YTN A;  5KL2 A;  2EN4 A;  4WSP A;  1YSA C;  4K0K E;  2ENC A;  4JV5 E;  5A6B A;  2DMY A;  1PJT A;  3DJW A;  1SFE A;  2UXB E;  1DI2 A;  4DUY E;  1JK1 A;  3J7A G;  2EMG A;  3THN A;  1XMO E;  5A6K A;  1AH5 A;  2D9H A;  2LTS A;  2YTF A;  2LRS A;  2E1M A;  2I13 A;  2M4I A;  2EOQ A;  4X65 E;  2ELY A;  5AE1 A;  2B7V A;  2VE7 C;  4WPY A;  5AAS A;  3BBG A;  1ZU1 A;  3FIG A;  3AUZ A;  2UXC E;  4Q35 B;  4F6M A;  3BF2 A;  1IQS A;  2NUE A;  2EPK X;  2YRK A;  3EQ1 A;  2UUA E;  2RS6 A;  3LLH A;  4M9V C;  1EH7 A;  4JI8 E;  4GKK E;  4DKK A;  2ZM6 E;  1MGT A;  2FTX B;  2KHX A;  4DR1 E;  2MC5 A;  1AAY A;  1X48 A;  3MHH C;  5BR8 E;  2EN8 A;  2V83 A;  2JPA A;  4X64 E;  2L8T A;  1N34 E;  1T38 A;  2G7H A;  3HPZ A;  2EOR A;  2N8X A;  2YWQ A;  2MC6 A;  4DMI A;  2EQ3 A;  1KYQ A;  2JYA A;  5KL6 A;  3ADG A;  3J80 C;  2VQF E;  4WSG A;  1N3G A;  2H36 X;  1L4S A;  2YSP A;  2L92 A;  1X5W A;  3JTZ A;  3F6G A;  2EPC A;  4DR3 E;  1IBM E;  1A1I A;  4NHR A;  4JI7 E;  2EN7 A;  1X49 A;  2VQE E;  2B9D A;  4IJD A;  2WBS A;  1PDA A;  2M9A A;  3BGH A;  3OTO E;  2EPM X;  3ADJ A;  3HXL A;  2DGC A;  1I94 E;  1EKZ A;  4WX9 A;  4R2A A;  1QNT A;  3DF6 A;  1BBO A;  2EMX A;  2EN3 A;  1ZBT A;  2WBT A;  2LE2 A;  4HEI A;  5A6B D;  2V85 A;  2JVA A;  1WRJ A;  4DV4 E;  3EPJ A;  2NUF A;  3ADL A;  4DR4 E;  4HTG A;  5LMN E;  2EWL A;  2N3H A; 
#chains in the Genus database with same CATH homology
 4JI2 E;  2LTR A;  4WSP A;  1J5E E;  1UIL A;  2YT4 A;  3IWC A;  3LML A;  1IBL E;  1HNZ E;  2KOU A;  4B3R E;  4K0K E;  4JV5 E;  4DR7 E;  5AE2 A;  2LBS B;  2WZO A;  2NA2 A;  2DMY A;  3DJW A;  1SR9 A;  1YZ9 A;  2UXB E;  1DI2 A;  5LL6 R;  2KON A;  4DV3 E;  4DUY E;  3J7A G;  2L33 A;  4LFB E;  1QU6 A;  3VYY A;  2L3C A;  4JYA E;  4BS9 A;  3JAM C;  2UXD E;  2M7Q A;  3AV0 A;  4DR5 E;  1XMO E;  4DV7 E;  2M1S A;  1YYO A;  4LF9 E;  1XMQ E;  2LTS A;  4LF5 E;  2JOX A;  2LRS A;  4F9C B;  2E1M A;  3OML A;  4Q28 A;  2NUG A;  1WHQ A;  1HNW E;  2LUP B;  2M4I A;  4J8Z A;  4X65 E;  1N32 E;  3J7Y p;  1GQE A;  2E5L E;  4L8N A;  5FLX C;  2K4V A;  5AE1 A;  4X62 E;  4DV2 E;  2HHH E;  4X8W A;  2B7V A;  3J81 C;  2VE7 C;  4P7D A;  4TUG A;  4GKJ E;  4WPY A;  4NXM E;  2ODR D;  5AAS A;  2CPN A;  3AUZ A;  3FIG A;  3HQ1 A;  4X66 E;  2RS7 A;  1N36 E;  4LF6 E;  4YHH E;  4F54 A;  2UXC E;  2DIX A;  3F6H A;  4P78 A;  4I8O A;  2NUE A;  2N3G A;  3ZOQ B;  2UU9 E;  2UUA E;  2V87 A;  2V89 A;  4M0V A;  1T4L B;  4F9B B;  5T6J A;  2L3J A;  2YZT A;  2RS6 A;  3LLH A;  4LFC E;  4JI8 E;  3KWR A;  4GKK E;  4B3T E;  4DKK A;  2ZM6 E;  5LMU E;  2FTX B;  2KHX A;  1YYK A;  4DR1 E;  3T1H E;  1DQ3 A;  2MC5 A;  4DV0 E;  1WXR A;  2LUQ A;  2LMZ A;  4R8O A;  1X48 A;  2L2M A;  2JR1 A;  5BR8 E;  4GEQ B;  2V83 A;  1PKP A;  4R03 A;  1J26 A;  4X64 E;  2L8T A;  2RTX A;  1N34 E;  1GZ6 A;  2F4V E;  3HPS A;  4KHP E;  3RMP A;  2G7H A;  2VF1 A;  1HR0 E;  4B3S E;  4JI6 E;  4JI1 E;  3HPZ A;  5A2Q C;  1UHZ A;  2RSM A;  4LTY A;  2F8B A;  4LF8 E;  3C4T A;  1RQ0 A;  2MC6 A;  2JWO A;  3IWB A;  4M2Z A;  4DMI A;  2FV4 B;  4DV1 E;  2UUC E;  3P1X A;  2MDR A;  3HTX A;  5ADZ A;  1XNQ E;  3K6Q A;  4F9A B;  3ADG A;  1IBK E;  1RC7 A;  1X47 A;  3J80 C;  3C4B A;  2VQF E;  2V86 A;  1ZBQ A;  2ODR C;  2FGG A;  4KZS A;  4DR2 E;  2H36 X;  4DUZ E;  4LFA E;  4NXN E;  3ADI A;  2L92 A;  4LF7 E;  3JTZ A;  3VYX A;  1FKA E;  3F6G A;  5IT9 C;  2IHR 1;  4DV5 E;  4AQY E;  4LF4 E;  4OOG C;  4DR3 E;  4L5N C;  4DV6 E;  1IBM E;  4JI7 E;  3T1Y E;  1N33 E;  1X49 A;  2LJH A;  2VQE E;  5DNY A;  2EZ6 A;  2B9D A;  4B3M E;  3H09 A;  2L2N A;  3JU0 A;  4BMJ A;  4BBY A;  3OTO E;  2B7T A;  3IWD A;  3ADJ A;  3MSW A;  2L2K B;  4JI5 E;  3HXL A;  2L6M A;  1I94 E;  1EKZ A;  2B3T B;  1YYW A;  4DR6 E;  1STU A;  1WHN A;  3VK6 A;  5AE3 A;  3DF6 A;  1HNX E;  4JI0 E;  4JI4 E;  2V8Q B;  4M30 A;  4BC9 A;  2DSY A;  1FJG E;  1ZBT A;  1O0W A;  2JY9 A;  4BC7 A;  4WFT A;  1T4O A;  2LE2 A;  4BCA A;  4TUI A;  2V85 A;  2JVA A;  5CFF E;  2JOB A;  4DV4 E;  2V88 A;  5F3W A;  4YY3 E;  1T4N A;  2NUF A;  4LU9 A;  3ADL A;  4WYQ B;  4JI3 E;  4DR4 E;  5IWA E;  2UUB E;  4OX9 E;  1XNR E;  5LMN E;  2EWL A;  2DB2 A;  2N3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...