2FV4B

Nmr solution structure of the yeast kinetochore spc24/spc25 globular domain
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
58
structure length
58
Chain Sequence
NENILKLKLYRSLGVILDLENDQVLINRKNDGNIDILPLDNNLSDFYKTKYIWERLGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hypothetical 25.2 kDa protein in AFG3-SEB2 intergenic region
publication title Structure of a central component of the yeast kinetochore: the spc24p/spc25p globular domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein, protein binding
total genus 16
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2006-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.430 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2fv4B00
5T6JA 4GEQB 2FV4B 2FTXB
chains in the Genus database with same CATH superfamily
3OTOE 2EM9A 2GPIA 2EM5A 2EN4A 2MDGA 3LLHA 4L8NA 2LBSB 5A2QC 1AAYA 1GZ6A 1WRJA 2UU9E 5CFFE 2ENAA 1X47A 2B9DA 4DV3E 2RSIA 4DV1E 4ZYHA 1A1FA 4GKJE 2JVAA 2YTPA 2R76A 4LFCE 2EZ6A 2EPOA 2VQEE 2V83A 3OMLA 2EN8A 2V88A 2EMFA 2DB2A 3C4BA 4MLVA 4P7DA 5LL6R 2YTEA 1RC7A 4L5NC 3EPKA 2UUCE 4DR3E 3BF2A 1UBDC 2YU8A 4WYQB 2EOSA 3HQ1A 1SR9A 2YZTA 5AASA 1QU6A 4O24A 2NUFA 4DR4E 1BBGA 2WZOA 2EPAA 1SFEA 4HEIA 5A6AA 4X66E 3JAMC 1XMOE 4WFTA 2EOYA 4DV6E 4BC9A 1QNTA 1BB8A 1X6EA 2YTFA 4Q35B 1YSAC 1TF6A 2EWLA 2K7IA 4X62E 3UK3C 3F6HA 2EMLA 1N34E 2JP9A 2LTSA 1O0WA 2YTQA 2EM8A 4AQYE 4DKKA 2EOFA 2YTOA 2R1FA 2JY9A 1A1IA 2G7HA 3LMLA 2L2NA 4F2JC 2LVHA 2DSYA 2B7VA 1B69A 2YSPA 5TSEA 2V86A 2EL5A 2EMXA 2EOIA 2EPKX 2L8TA 1A1KA 4B3TE 1PJQA 2EOOA 2WBUA 3J7AG 1MEYC 3ADJA 2EM4A 3TQMA 1ZBQA 1PKPA 2EPCA 4WX9A 4R2RA 2N3HA 4M9VC 5LMUE 5AC4A 4F54A 2DRPA 4WXDA 5IT9C 1P47A 2YPNA 2JOXA 2VE7C 4JYAE 1X6FA 4JI3E 5A6BD 4R2PA 2V85A 1T4LB 1A1HA 1ZAAC 2EPLX 3J7Yp 1HNXE 1IMUA 4Q28A 1WHNA 2LTRA 2RS6A 2EL6A 2YSOA 4X8WA 2ODRC 4F9AB 4R2DA 5ADZA 1T38A 1TN9A 1YYKA 1YUIA 4B3RE 5A69A 1GQEA 2MKDA 2EN3A 4J8ZA 4WSPA 5KL4A 3BIDA 4JI5E 2LV2A 2LUPB 1KJKA 4BS9A 2UUAE 2IHR1 2EPZA 4GZNC 1X3CA 2M9AA 4B3SE 1A1LA 4BC7A 4DV2E 2DIXA 2EPXA 2JXPA 2RPCA 4LFBE 3VHTB 1XMQE 2MDRA 2J7JA 2EPNA 2VQFE 5AE1A 1ZR9A 4X9JA 1T4OA 2DMYA 1IBKE 2EMAA 1WXRA 4R2SA 4N4RB 2FV4B 2E72A 4M30A 2HGHA 1YZ9A 1KYQA 2JR1A 2ZM6E 4LU9A 4LTYA 3HPSA 4BHBA 3EPHA 2RS7A 4DR5E 2WBTA 2H36X 3DF6A 4LF4E 3J80C 4DUYE 4KHPE 4M0VA 2LO3A 3EPLA 2L3CA 2YRHA 2EOMA 4LFAE 3J81C 1JK2A 3T1HE 5A6BA 4O43A 2YU5A 1NEIA 4WSGA 4DR1E 2JPAA 2L33A 2HC5A 4X64E 4NZVA 4B3ME 2LMZA 2EM6A 2WBSA 2EPPA 3L00A 2EE8A 2NABA 2EN7A 1UN6B 1N32E 4DMIA 4TUGA 3KZYA 1FKAE 4IJDA 2UXCE 2YTJA 2DMIA 2MKNA 1ZU1A 1HNWE 4ZYEA 2YTNA 1N36E 4JI0E 2E1MA 2EPMX 2JWOA 3ZOQB 2ADRA 4JI6E 5FLXC 2UXDE 2FGGA 1XNQE 3BBGA 2LJHA 2UUBE 2KOUA 4RHBB 2EMIA 5KL7A 3C4TA 5F3WA 2V87A 4GKKE 3MHSC 1J5EE 2CTDA 5DNYA 2LUQA 2MC6A 3QG5C 5AC5A 2N3GA 2NUGA 3EPJA 3H09A 4TUIA 1YUJA 5BR8E 1PDAA 2V89A 4JI7E 3HTXA 1J26A 3VYYA 4RH8A 2UXBE 2LJUA 1F2IG 2CT1A 1DGCA 3JU0A 1PJSA 2M1SA 4YY3E 4K0KE 4DR7E 1BBOA 2EPUA 2YRMA 2PRTA 2EP3A 1I94E 2EORA 4R03A 4F6NA 3AUZA 2DGCA 3KZZA 4O4KA 1A1GA 3AV0A 2EM7A 4DV7E 3F6GA 2YTDA 2I13A 2KONA 1WJPA 2F8BA 1Z1BA 2YRKA 1PJTA 2B3TB 2KHXA 2LRSA 1L4SA 2EOZA 3C6MA 5KL3A 1TF3A 2RTXA 1A1JA 4LF6E 2CPNA 2RSMA 4WPYA 5A6KA 3KWRA 4LF9E 4IS1C 1XNRE 5IWAE 1HR0E 2YTGA 4LF8E 3M99B 2HJJA 2BB8A 2LCEA 1AH5A 3EQ1A 2GHFA 3VYXA 2B7TA 4F9CB 4KWYA 4X65E 4M2ZA 4JI8E 4DV4E 2M7QA 2YTIA 2JOBA 4GEQB 2L3JA 4R2CA 4F9BB 2F4VE 3ADLA 2EQ1A 3ADGA 2EOQA 1LLMC 1UHZA 4I8OA 2DLKA 1UILA 1YYWA 4R2QA 1RMDA 1T39A 1IBLE 2EM2A 4NXNE 4WXCA 4BBYA 2WCC3 3P1XA 1YFHA 4F6MA 4MLQA 1JK1A 2NA2A 2HHHE 3FIGA 1G2DC 1MGTA 1NCSA 2NUEA 2CSHA 1N3GA 4DV5E 2ENHA 4JI4E 2EOEA 2JYAA 4JV5E 2EMKA 2EQ0A 2L2MA 1FJGE 4OX9E 2EOXA 1ZBTA 2EN1A 4R2EA 2M4IA 5KL6A 1G2FC 2EM0A 1STUA 1WHQA 2D9HA 4BCAA 2EQ3A 4DR6E 1GTKA 2A25A 4JI2E 4BMJA 2I9IA 4DUZE 2EJ4A 2L92A 2EN6A 2ENCA 4NXME 3IWBA 2DLQA 4ZYDA 1X48A 4O5GA 1DI2A 3VK6A 2V8QB 4HTGA 5AE3A 5IXMB 1X5WA 3IWDA 3RMPA 3HPZA 4DR2E 4LF7E 3MHHC 2ELZA 2L2KB 4LF5E 2EMGA 3T1YE 2Q8UA 5LMNE 2EMBA 1IQSA 4DV0E 2LT7A 2EOJA 5AE2A 2EL4A 1YYOA 4ZYGA 3ECRA 2ODRD 2N8XA 2L6MA 2EMCA 4JI1E 1EKZA 2MC5A 2RQLA 4KZSA 2GLIA 3HXLA 2BBGA 1N33E 1T4NA 1HNZE 2K4VA 4FK5C 1YPNA 2EM3A 4R2AA 2FTXB 1IQOA 5T6JA 5LLQA 5KL2A 3THNA 4P78A 1EH7A 2EN2A 2EMYA 1EH6A 3K6QA 2EMHA 2VF1A 3JTZA 4OOGC 4BHCA 5KL5A 1X6HA 1RQ0A 1X49A 2EMZA 5A6JA 2EPRA 2EMWA 2YT4A 3THOB 5IV8B 2YWQA 2E5LE 2ELYA 2EOHA 2LE2A 1IBME 3BGHA 3IWCA 3DJWA 3ADIA 4NHRA 4R8OA 3MSWA 2VRDA 3C6KA 1DQ3A 1EH8A 4YHHE
chains in the Genus database with same CATH topology
4F54A 3OTOE 2KOUA 2L2MA 5F3WA 4OX9E 3C4TA 5IT9C 2V87A 1FJGE 4GKKE 1ZBTA 2JOXA 1J5EE 2M4IA 2VE7C 5DNYA 4JYAE 2LUQA 2MC6A 4JI3E 2N3GA 3LLHA 2NUGA 1STUA 4L8NA 2V85A 1T4LB 2LBSB 3H09A 1WHQA 4TUIA 5A2QC 5BR8E 3J7Yp 1HNXE 4BCAA 4DR6E 1GZ6A 4Q28A 2V89A 1WHNA 4JI7E 3HTXA 2LTRA 1J26A 3VYYA 2UU9E 2UXBE 5CFFE 2RS6A 4JI2E 4BMJA 4X8WA 3JU0A 4DUZE 2ODRC 4F9AB 2L92A 1X47A 5ADZA 4B3RE 2M1SA 4YY3E 4NXME 3IWBA 1YYKA 4K0KE 4DR7E 2B9DA 1GQEA 4DV3E 4J8ZA 4WSPA 1I94E 4JI5E 2LUPB 4R03A 4DV1E 1X48A 3AUZA 4GKJE 3VK6A 1DI2A 2JVAA 2V8QB 4BS9A 2UUAE 2IHR1 5AE3A 4LFCE 4B3SE 2EZ6A 2VQEE 2V83A 3AV0A 3OMLA 4BC7A 2V88A 4DV2E 3IWDA 2DB2A 2DIXA 3RMPA 3C4BA 3HPZA 4DR2E 4DV7E 3F6GA 1XMQE 2MDRA 4LF7E 4LFBE 2KONA 2F8BA 2L2KB 4P7DA 5LL6R 2VQFE 3T1YE 5AE1A 4JI4E 4LF5E 1RC7A 4L5NC 2B3TB 2UUCE 1T4OA 2DMYA 2KHXA 4DR3E 1IBKE 5LMNE 2LRSA 1WXRA 4DV0E 2FV4B 4WYQB 4M30A 5AE2A 2RTXA 3HQ1A 1SR9A 1YYOA 2YZTA 2CPNA 4LF6E 1YZ9A 5AASA 2ODRD 2L6MA 2JR1A 2RSMA 2ZM6E 4LU9A 4WPYA 4LTYA 1QU6A 2NUFA 4DR4E 3HPSA 3KWRA 4LF9E 2WZOA 4JI1E 2RS7A 4DR5E 1EKZA 1XNRE 2MC5A 5IWAE 2H36X 3DF6A 1HR0E 4LF4E 1XMOE 4X66E 3JAMC 3J80C 4DUYE 4KZSA 4LF8E 4WFTA 4KHPE 3HXLA 4BC9A 4DV6E 1N33E 1T4NA 4M0VA 1HNZE 2K4VA 2L3CA 4LFAE 2FTXB 3VYXA 3J81C 2B7TA 4F9CB 2EWLA 3T1HE 5T6JA 4X65E 4M2ZA 4X62E 3F6HA 1N34E 4P78A 4DR1E 2LTSA 4JI8E 4DV4E 1O0WA 2L33A 2VF1A 3K6QA 3JTZA 2M7QA 2JOBA 4X64E 4OOGC 4AQYE 4GEQB 2L3JA 4B3ME 4DKKA 4F9BB 2F4VE 3ADLA 1RQ0A 1X49A 3ADGA 2LMZA 1UHZA 4I8OA 1UILA 2JY9A 1YYWA 2G7HA 4YHHE 3LMLA 2YT4A 1N32E 4DMIA 1IBLE 2L2NA 4TUGA 2E5LE 1FKAE 4NXNE 2UXCE 4BBYA 3P1XA 2DSYA 2B7VA 2LE2A 1IBME 3IWCA 2V86A 2NA2A 3DJWA 1HNWE 2HHHE 3ADIA 1N36E 4JI0E 2L8TA 2E1MA 3FIGA 2JWOA 3ZOQB 4R8OA 4B3TE 3MSWA 2NUEA 3J7AG 1DQ3A 3ADJA 5FLXC 4JI6E 2UXDE 1ZBQA 4DV5E 2FGGA 1XNQE 1PKPA 2LJHA 2N3HA 2UUBE 4JV5E 5LMUE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5T6J A;  4GEQ B;  2FV4 B;  2FTX B; 
#chains in the Genus database with same CATH topology
 3OTO E;  2EM9 A;  2GPI A;  2EM5 A;  2EN4 A;  2MDG A;  3LLH A;  4L8N A;  2LBS B;  5A2Q C;  1AAY A;  1GZ6 A;  1WRJ A;  2UU9 E;  5CFF E;  2ENA A;  1X47 A;  2B9D A;  4DV3 E;  2RSI A;  4DV1 E;  4ZYH A;  1A1F A;  4GKJ E;  2JVA A;  2YTP A;  2R76 A;  4LFC E;  2EZ6 A;  2EPO A;  2VQE E;  2V83 A;  3OML A;  2EN8 A;  2V88 A;  2EMF A;  2DB2 A;  3C4B A;  4MLV A;  4P7D A;  5LL6 R;  2YTE A;  1RC7 A;  4L5N C;  3EPK A;  2UUC E;  4DR3 E;  3BF2 A;  1UBD C;  2YU8 A;  4WYQ B;  2EOS A;  3HQ1 A;  1SR9 A;  2YZT A;  5AAS A;  1QU6 A;  4O24 A;  2NUF A;  4DR4 E;  1BBG A;  2WZO A;  2EPA A;  1SFE A;  4HEI A;  5A6A A;  4X66 E;  3JAM C;  1XMO E;  4WFT A;  2EOY A;  4DV6 E;  4BC9 A;  1QNT A;  1BB8 A;  1X6E A;  2YTF A;  4Q35 B;  1YSA C;  1TF6 A;  2EWL A;  2K7I A;  4X62 E;  3UK3 C;  3F6H A;  2EML A;  1N34 E;  2JP9 A;  2LTS A;  1O0W A;  2YTQ A;  2EM8 A;  4AQY E;  4DKK A;  2EOF A;  2YTO A;  2R1F A;  2JY9 A;  1A1I A;  2G7H A;  3LML A;  2L2N A;  4F2J C;  2LVH A;  2DSY A;  2B7V A;  1B69 A;  2YSP A;  5TSE A;  2V86 A;  2EL5 A;  2EMX A;  2EOI A;  2EPK X;  2L8T A;  1A1K A;  4B3T E;  1PJQ A;  2EOO A;  2WBU A;  3J7A G;  1MEY C;  3ADJ A;  2EM4 A;  3TQM A;  1ZBQ A;  1PKP A;  2EPC A;  4WX9 A;  4R2R A;  2N3H A;  4M9V C;  5LMU E;  5AC4 A;  4F54 A;  2DRP A;  4WXD A;  5IT9 C;  1P47 A;  2YPN A;  2JOX A;  2VE7 C;  4JYA E;  1X6F A;  4JI3 E;  5A6B D;  4R2P A;  2V85 A;  1T4L B;  1A1H A;  1ZAA C;  2EPL X;  3J7Y p;  1HNX E;  1IMU A;  4Q28 A;  1WHN A;  2LTR A;  2RS6 A;  2EL6 A;  2YSO A;  4X8W A;  2ODR C;  4F9A B;  4R2D A;  5ADZ A;  1T38 A;  1TN9 A;  1YYK A;  1YUI A;  4B3R E;  5A69 A;  1GQE A;  2MKD A;  2EN3 A;  4J8Z A;  4WSP A;  5KL4 A;  3BID A;  4JI5 E;  2LV2 A;  2LUP B;  1KJK A;  4BS9 A;  2UUA E;  2IHR 1;  2EPZ A;  4GZN C;  1X3C A;  2M9A A;  4B3S E;  1A1L A;  4BC7 A;  4DV2 E;  2DIX A;  2EPX A;  2JXP A;  2RPC A;  4LFB E;  3VHT B;  1XMQ E;  2MDR A;  2J7J A;  2EPN A;  2VQF E;  5AE1 A;  1ZR9 A;  4X9J A;  1T4O A;  2DMY A;  1IBK E;  2EMA A;  1WXR A;  4R2S A;  4N4R B;  2FV4 B;  2E72 A;  4M30 A;  2HGH A;  1YZ9 A;  1KYQ A;  2JR1 A;  2ZM6 E;  4LU9 A;  4LTY A;  3HPS A;  4BHB A;  3EPH A;  2RS7 A;  4DR5 E;  2WBT A;  2H36 X;  3DF6 A;  4LF4 E;  3J80 C;  4DUY E;  4KHP E;  4M0V A;  2LO3 A;  3EPL A;  2L3C A;  2YRH A;  2EOM A;  4LFA E;  3J81 C;  1JK2 A;  3T1H E;  5A6B A;  4O43 A;  2YU5 A;  1NEI A;  4WSG A;  4DR1 E;  2JPA A;  2L33 A;  2HC5 A;  4X64 E;  4NZV A;  4B3M E;  2LMZ A;  2EM6 A;  2WBS A;  2EPP A;  3L00 A;  2EE8 A;  2NAB A;  2EN7 A;  1UN6 B;  1N32 E;  4DMI A;  4TUG A;  3KZY A;  1FKA E;  4IJD A;  2UXC E;  2YTJ A;  2DMI A;  2MKN A;  1ZU1 A;  1HNW E;  4ZYE A;  2YTN A;  1N36 E;  4JI0 E;  2E1M A;  2EPM X;  2JWO A;  3ZOQ B;  2ADR A;  4JI6 E;  5FLX C;  2UXD E;  2FGG A;  1XNQ E;  3BBG A;  2LJH A;  2UUB E;  2KOU A;  4RHB B;  2EMI A;  5KL7 A;  3C4T A;  5F3W A;  2V87 A;  4GKK E;  3MHS C;  1J5E E;  2CTD A;  5DNY A;  2LUQ A;  2MC6 A;  3QG5 C;  5AC5 A;  2N3G A;  2NUG A;  3EPJ A;  3H09 A;  4TUI A;  1YUJ A;  5BR8 E;  1PDA A;  2V89 A;  4JI7 E;  3HTX A;  1J26 A;  3VYY A;  4RH8 A;  2UXB E;  2LJU A;  1F2I G;  2CT1 A;  1DGC A;  3JU0 A;  1PJS A;  2M1S A;  4YY3 E;  4K0K E;  4DR7 E;  1BBO A;  2EPU A;  2YRM A;  2PRT A;  2EP3 A;  1I94 E;  2EOR A;  4R03 A;  4F6N A;  3AUZ A;  2DGC A;  3KZZ A;  4O4K A;  1A1G A;  3AV0 A;  2EM7 A;  4DV7 E;  3F6G A;  2YTD A;  2I13 A;  2KON A;  1WJP A;  2F8B A;  1Z1B A;  2YRK A;  1PJT A;  2B3T B;  2KHX A;  2LRS A;  1L4S A;  2EOZ A;  3C6M A;  5KL3 A;  1TF3 A;  2RTX A;  1A1J A;  4LF6 E;  2CPN A;  2RSM A;  4WPY A;  5A6K A;  3KWR A;  4LF9 E;  4IS1 C;  1XNR E;  5IWA E;  1HR0 E;  2YTG A;  4LF8 E;  3M99 B;  2HJJ A;  2BB8 A;  2LCE A;  1AH5 A;  3EQ1 A;  2GHF A;  3VYX A;  2B7T A;  4F9C B;  4KWY A;  4X65 E;  4M2Z A;  4JI8 E;  4DV4 E;  2M7Q A;  2YTI A;  2JOB A;  4GEQ B;  2L3J A;  4R2C A;  4F9B B;  2F4V E;  3ADL A;  2EQ1 A;  3ADG A;  2EOQ A;  1LLM C;  1UHZ A;  4I8O A;  2DLK A;  1UIL A;  1YYW A;  4R2Q A;  1RMD A;  1T39 A;  1IBL E;  2EM2 A;  4NXN E;  4WXC A;  4BBY A;  2WCC 3;  3P1X A;  1YFH A;  4F6M A;  4MLQ A;  1JK1 A;  2NA2 A;  2HHH E;  3FIG A;  1G2D C;  1MGT A;  1NCS A;  2NUE A;  2CSH A;  1N3G A;  4DV5 E;  2ENH A;  4JI4 E;  2EOE A;  2JYA A;  4JV5 E;  2EMK A;  2EQ0 A;  2L2M A;  1FJG E;  4OX9 E;  2EOX A;  1ZBT A;  2EN1 A;  4R2E A;  2M4I A;  5KL6 A;  1G2F C;  2EM0 A;  1STU A;  1WHQ A;  2D9H A;  4BCA A;  2EQ3 A;  4DR6 E;  1GTK A;  2A25 A;  4JI2 E;  4BMJ A;  2I9I A;  4DUZ E;  2EJ4 A;  2L92 A;  2EN6 A;  2ENC A;  4NXM E;  3IWB A;  2DLQ A;  4ZYD A;  1X48 A;  4O5G A;  1DI2 A;  3VK6 A;  2V8Q B;  4HTG A;  5AE3 A;  5IXM B;  1X5W A;  3IWD A;  3RMP A;  3HPZ A;  4DR2 E;  4LF7 E;  3MHH C;  2ELZ A;  2L2K B;  4LF5 E;  2EMG A;  3T1Y E;  2Q8U A;  5LMN E;  2EMB A;  1IQS A;  4DV0 E;  2LT7 A;  2EOJ A;  5AE2 A;  2EL4 A;  1YYO A;  4ZYG A;  3ECR A;  2ODR D;  2N8X A;  2L6M A;  2EMC A;  4JI1 E;  1EKZ A;  2MC5 A;  2RQL A;  4KZS A;  2GLI A;  3HXL A;  2BBG A;  1N33 E;  1T4N A;  1HNZ E;  2K4V A;  4FK5 C;  1YPN A;  2EM3 A;  4R2A A;  2FTX B;  1IQO A;  5T6J A;  5LLQ A;  5KL2 A;  3THN A;  4P78 A;  1EH7 A;  2EN2 A;  2EMY A;  1EH6 A;  3K6Q A;  2EMH A;  2VF1 A;  3JTZ A;  4OOG C;  4BHC A;  5KL5 A;  1X6H A;  1RQ0 A;  1X49 A;  2EMZ A;  5A6J A;  2EPR A;  2EMW A;  2YT4 A;  3THO B;  5IV8 B;  2YWQ A;  2E5L E;  2ELY A;  2EOH A;  2LE2 A;  1IBM E;  3BGH A;  3IWC A;  3DJW A;  3ADI A;  4NHR A;  4R8O A;  3MSW A;  2VRD A;  3C6K A;  1DQ3 A;  1EH8 A;  4YHH E; 
#chains in the Genus database with same CATH homology
 4F54 A;  3OTO E;  2KOU A;  2L2M A;  5F3W A;  4OX9 E;  3C4T A;  5IT9 C;  2V87 A;  1FJG E;  4GKK E;  1ZBT A;  2JOX A;  1J5E E;  2M4I A;  2VE7 C;  5DNY A;  4JYA E;  2LUQ A;  2MC6 A;  4JI3 E;  2N3G A;  3LLH A;  2NUG A;  1STU A;  4L8N A;  2V85 A;  1T4L B;  2LBS B;  3H09 A;  1WHQ A;  4TUI A;  5A2Q C;  5BR8 E;  3J7Y p;  1HNX E;  4BCA A;  4DR6 E;  1GZ6 A;  4Q28 A;  2V89 A;  1WHN A;  4JI7 E;  3HTX A;  2LTR A;  1J26 A;  3VYY A;  2UU9 E;  2UXB E;  5CFF E;  2RS6 A;  4JI2 E;  4BMJ A;  4X8W A;  3JU0 A;  4DUZ E;  2ODR C;  4F9A B;  2L92 A;  1X47 A;  5ADZ A;  4B3R E;  2M1S A;  4YY3 E;  4NXM E;  3IWB A;  1YYK A;  4K0K E;  4DR7 E;  2B9D A;  1GQE A;  4DV3 E;  4J8Z A;  4WSP A;  1I94 E;  4JI5 E;  2LUP B;  4R03 A;  4DV1 E;  1X48 A;  3AUZ A;  4GKJ E;  3VK6 A;  1DI2 A;  2JVA A;  2V8Q B;  4BS9 A;  2UUA E;  2IHR 1;  5AE3 A;  4LFC E;  4B3S E;  2EZ6 A;  2VQE E;  2V83 A;  3AV0 A;  3OML A;  4BC7 A;  2V88 A;  4DV2 E;  3IWD A;  2DB2 A;  2DIX A;  3RMP A;  3C4B A;  3HPZ A;  4DR2 E;  4DV7 E;  3F6G A;  1XMQ E;  2MDR A;  4LF7 E;  4LFB E;  2KON A;  2F8B A;  2L2K B;  4P7D A;  5LL6 R;  2VQF E;  3T1Y E;  5AE1 A;  4JI4 E;  4LF5 E;  1RC7 A;  4L5N C;  2B3T B;  2UUC E;  1T4O A;  2DMY A;  2KHX A;  4DR3 E;  1IBK E;  5LMN E;  2LRS A;  1WXR A;  4DV0 E;  2FV4 B;  4WYQ B;  4M30 A;  5AE2 A;  2RTX A;  3HQ1 A;  1SR9 A;  1YYO A;  2YZT A;  2CPN A;  4LF6 E;  1YZ9 A;  5AAS A;  2ODR D;  2L6M A;  2JR1 A;  2RSM A;  2ZM6 E;  4LU9 A;  4WPY A;  4LTY A;  1QU6 A;  2NUF A;  4DR4 E;  3HPS A;  3KWR A;  4LF9 E;  2WZO A;  4JI1 E;  2RS7 A;  4DR5 E;  1EKZ A;  1XNR E;  2MC5 A;  5IWA E;  2H36 X;  3DF6 A;  1HR0 E;  4LF4 E;  1XMO E;  4X66 E;  3JAM C;  3J80 C;  4DUY E;  4KZS A;  4LF8 E;  4WFT A;  4KHP E;  3HXL A;  4BC9 A;  4DV6 E;  1N33 E;  1T4N A;  4M0V A;  1HNZ E;  2K4V A;  2L3C A;  4LFA E;  2FTX B;  3VYX A;  3J81 C;  2B7T A;  4F9C B;  2EWL A;  3T1H E;  5T6J A;  4X65 E;  4M2Z A;  4X62 E;  3F6H A;  1N34 E;  4P78 A;  4DR1 E;  2LTS A;  4JI8 E;  4DV4 E;  1O0W A;  2L33 A;  2VF1 A;  3K6Q A;  3JTZ A;  2M7Q A;  2JOB A;  4X64 E;  4OOG C;  4AQY E;  4GEQ B;  2L3J A;  4B3M E;  4DKK A;  4F9B B;  2F4V E;  3ADL A;  1RQ0 A;  1X49 A;  3ADG A;  2LMZ A;  1UHZ A;  4I8O A;  1UIL A;  2JY9 A;  1YYW A;  2G7H A;  4YHH E;  3LML A;  2YT4 A;  1N32 E;  4DMI A;  1IBL E;  2L2N A;  4TUG A;  2E5L E;  1FKA E;  4NXN E;  2UXC E;  4BBY A;  3P1X A;  2DSY A;  2B7V A;  2LE2 A;  1IBM E;  3IWC A;  2V86 A;  2NA2 A;  3DJW A;  1HNW E;  2HHH E;  3ADI A;  1N36 E;  4JI0 E;  2L8T A;  2E1M A;  3FIG A;  2JWO A;  3ZOQ B;  4R8O A;  4B3T E;  3MSW A;  2NUE A;  3J7A G;  1DQ3 A;  3ADJ A;  5FLX C;  4JI6 E;  2UXD E;  1ZBQ A;  4DV5 E;  2FGG A;  1XNQ E;  1PKP A;  2LJH A;  2N3H A;  2UUB E;  4JV5 E;  5LMU E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...