2FV4B

Nmr solution structure of the yeast kinetochore spc24/spc25 globular domain
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
58
structure length
58
Chain Sequence
b'NENILKLKLYRSLGVILDLENDQVLINRKNDGNIDILPLDNNLSDFYKTKYIWERLGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hypothetical 25.2 kDa protein in AFG3-SEB2 intergenic region
publication title Structure of a central component of the yeast kinetochore: the spc24p/spc25p globular domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein, protein binding
total genus 16
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2006-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.430 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2fv4B00
2FTXB 5T6JA 4GEQB 2FV4B
chains in the Genus database with same CATH superfamily
2VQFE 2GLIA 2M7QA 2BB8A 1STUA 3KZYA 2CSHA 2EORA 1L4SA 5ADZA 2MC5A 3M99B 4M0VA 2RPCA 2WCC3 2UUBE 1WJPA 1T39A 2EMCA 2EN4A 2EM6A 1DI2A 4LU9A 2LRSA 5KL5A 2HGHA 3MHHC 4JI4E 1RMDA 5A6BA 1J5EE 2EOHA 2JY9A 3K6QA 1Z1BA 1A1IA 3OMLA 3ADLA 2EPNA 4B3TE 1XNRE 4MLQA 1A1KA 3EQ1A 4X64E 2D9HA 1AH5A 4B3SE 2L3CA 4ZYHA 2NA2A 1T4NA 3AV0A 3C4BA 4GZNC 1GTKA 1G2FC 4DKKA 2EMGA 1SR9A 1N33E 2EPZA 3F6GA 3VHTB 4O5GA 1BB8A 2EMAA 4F9AB 3JTZA 3ECRA 3KWRA 2LUPB 2JR1A 2EOFA 4Q28A 1EH6A 2V89A 4JI8E 2YSPA 1JK2A 2B7VA 1X48A 4GEQB 4F54A 2ENHA 2YTJA 3IWCA 2GHFA 2V8QB 4DV2E 2EN7A 5BR8E 1SFEA 2EM4A 1PJTA 2LTRA 2EOOA 4DV3E 4YHHE 1I94E 3F6HA 5AC4A 4JYAE 2VF1A 2EE8A 1N32E 3DF6A 2UXBE 4TUIA 2DGCA 4WSPA 4OOGC 1BBOA 4LFCE 1DQ3A 2EN2A 2JOXA 2H36X 2RS7A 4M9VC 2Q8UA 2V85A 2YZTA 3THOB 4JI0E 4LF4E 4WYQB 4AQYE 2EMLA 1X47A 2E72A 2EOMA 1FJGE 2B7TA 2EM3A 2ODRD 4O24A 3EPKA 1X6FA 2EN1A 4NHRA 5LL6R 5KL3A 4K0KE 1GZ6A 5KL2A 2FGGA 2B3TB 2WBUA 2YRHA 2HC5A 4F6MA 4WXCA 2UUAE 4F6NA 2EMWA 2J7JA 2EN8A 2FTXB 1IBKE 4BCAA 1WHQA 2I9IA 4R2CA 4DMIA 2RSMA 2KONA 4L8NA 1TN9A 2EQ3A 2EOXA 2NUEA 1A1HA 2DIXA 4RH8A 2RTXA 5KL4A 1MGTA 1NEIA 4WFTA 2YRKA 1WXRA 5IWAE 3RMPA 3DJWA 1O0WA 4GKKE 4DV0E 1YUIA 2YWQA 2R1FA 3L00A 4RHBB 3JAMC 2LJHA 1A1GA 2JOBA 4M30A 2I13A 4LF7E 2ZM6E 4JI1E 4R2RA 1UILA 2YTIA 3C4TA 2DLQA 2UUCE 1X5WA 2EOJA 2EM2A 1IQOA 2L92A 2HJJA 2RS6A 2CT1A 5AE2A 5A2QC 5KL6A 4DR4E 3H09A 3OTOE 2N3GA 2E5LE 1HNZE 1YFHA 1QNTA 4R2DA 5LMUE 2ODRC 4I8OA 2ELYA 2YTEA 1ZBTA 2LTSA 2L2KB 1XNQE 2LJUA 4DR6E 2K7IA 2M1SA 2EOEA 1DGCA 4LF8E 1YYOA 4BBYA 2EMYA 2DMIA 3VYXA 2M4IA 2L6MA 2DLKA 2EN6A 2L8TA 1YYWA 1T4LB 2NUGA 4M2ZA 2KHXA 2YTFA 2LBSB 4LTYA 4L5NC 1J26A 2YU5A 2L2NA 2ADRA 2EPMX 4NXNE 2GPIA 4KHPE 4BMJA 1EH7A 2KOUA 2YSOA 4WXDA 4KWYA 2EOSA 4LFAE 1JK1A 2NUFA 3ZOQB 2MDGA 5FLXC 1F2IG 1G2DC 3EPHA 2DSYA 4R2EA 4DR7E 1EKZA 4P7DA 4X65E 2YTOA 2EOQA 2YTNA 3J7Yp 4JI7E 3EPLA 1PDAA 2CPNA 1EH8A 2L33A 1P47A 3IWBA 3T1HE 1HNWE 1HR0E 2EMFA 2EM9A 1N34E 2B9DA 4B3RE 4R2SA 2UU9E 4X8WA 4DR5E 1BBGA 4NXME 2EPAA 5A6KA 2WBSA 2EPKX 4WPYA 4P78A 4YY3E 2V88A 2DB2A 2JPAA 4R2AA 2HHHE 4R8OA 2LE2A 2EMIA 2DMYA 2EMHA 5AC5A 2A25A 2EOYA 1PJSA 2UXCE 2EL4A 1RC7A 1UBDC 1MEYC 2EM5A 4DV6E 2WBTA 3J7AG 2R76A 2EMXA 2E1MA 2EPOA 2L3JA 2PRTA 4LF6E 1KJKA 1XMOE 5AASA 1IBME 1FKAE 1A1JA 2EM8A 3LLHA 4DV7E 2YPNA 4DR1E 2V86A 4BC9A 2F4VE 2EMBA 2RQLA 2EQ0A 1IBLE 5IT9C 2BBGA 1IQSA 4LF5E 4LF9E 5LLQA 2MDRA 4R2QA 2MC6A 2EM0A 1X3CA 5A6AA 2JXPA 1QU6A 2NABA 4B3ME 1TF3A 4F9CB 4BS9A 5KL7A 4WSGA 2YT4A 4HEIA 2YTQA 2K4VA 2EL5A 4DUYE 2IHR1 2LUQA 1HNXE 4FK5C 5IV8B 4JI2E 4LFBE 2YU8A 3ADIA 2RSIA 1UN6B 3HPSA 3T1YE 2DRPA 1KYQA 5AE3A 3VYYA 3VK6A 4X62E 4BHCA 1N36E 1YSAC 2VRDA 4O4KA 3ADGA 2EL6A 2WZOA 4DR2E 1AAYA 3EPJA 1ZAAC 2EP3A 2UXDE 1N3GA 3KZZA 4JI6E 5F3WA 2VE7C 4X9JA 4F2JC 4JV5E 2N8XA 1X6HA 1LLMC 5T6JA 4HTGA 5TSEA 2EJ4A 3HQ1A 1YPNA 2EZ6A 1TF6A 1RQ0A 5A69A 1X49A 2ELZA 2JVAA 2LV2A 3JU0A 2V83A 2EPUA 1ZU1A 2EN3A 3MHSC 4O43A 4WX9A 4DR3E 2JYAA 2EPLX 3J81C 2EWLA 1X6EA 4OX9E 2JP9A 2V87A 1YZ9A 2EPRA 2MKNA 1T38A 2LO3A 2EOZA 4KZSA 4JI5E 3C6KA 5A6BD 4ZYGA 3MSWA 1XMQE 3BGHA 3P1XA 1GQEA 4IS1C 1B69A 2G7HA 4IJDA 2N3HA 3QG5C 2YTPA 4GKJE 2EOIA 4DV4E 2EM7A 2LMZA 1WHNA 3HXLA 2CTDA 1PKPA 3FIGA 4F9BB 4J8ZA 4N4RB 1T4OA 3LMLA 2ENCA 3TQMA 1NCSA 1YYKA 3HTXA 4DUZE 1IMUA 1ZR9A 2EPPA 2LT7A 2YTGA 1ZBQA 3BIDA 1A1FA 4Q35B 3J80C 2M9AA 2EQ1A 4X66E 4DV5E 2LVHA 4NZVA 3THNA 4DV1E 1WRJA 3HPZA 3C6MA 4ZYDA 2L2MA 2FV4B 2JWOA 2EPCA 1PJQA 2YTDA 3BBGA 2EMKA 3AUZA 3BF2A 4R2PA 4MLVA 4BC7A 2EPXA 5AE1A 5IXMB 5LMNE 3IWDA 4JI3E 3ADJA 2EMZA 4R03A 1YUJA 4TUGA 2F8BA 1UHZA 4BHBA 5CFFE 2LCEA 2ENAA 2MKDA 4ZYEA 2YRMA 2VQEE 5DNYA 5A6JA 3UK3C 1A1LA
chains in the Genus database with same CATH topology
5LL6R 2VQFE 4LFAE 2M7QA 1STUA 2UXDE 4K0KE 1GZ6A 2NUFA 3ZOQB 4JI6E 2FGGA 2B3TB 5F3WA 5FLXC 5ADZA 2VE7C 2MC5A 4JV5E 2DSYA 4M0VA 2UUAE 4DR7E 1EKZA 5T6JA 2UUBE 4P7DA 4X65E 2FTXB 3HQ1A 1IBKE 3J7Yp 2EZ6A 1DI2A 4LU9A 4JI7E 1RQ0A 2LRSA 1X49A 1WHQA 2CPNA 2L33A 4BCAA 2JVAA 4JI4E 3IWBA 3T1HE 3JU0A 4DMIA 1J5EE 1N34E 2V83A 1HR0E 1HNWE 3K6QA 2JY9A 2RSMA 2B9DA 2KONA 4L8NA 4DR3E 4B3RE 3J81C 2UU9E 4X8WA 2EWLA 3OMLA 4DR5E 3ADLA 4OX9E 2NUEA 4B3TE 2DIXA 1XNRE 2V87A 4NXME 1YZ9A 2RTXA 4X64E 4WFTA 4WPYA 4P78A 4YY3E 1WXRA 4KZSA 5IWAE 2V88A 4JI5E 2DB2A 3RMPA 4B3SE 3DJWA 1O0WA 2L3CA 2HHHE 4R8OA 4DV0E 2LE2A 4GKKE 3MSWA 2DMYA 1XMQE 2NA2A 3P1XA 1GQEA 1T4NA 3AV0A 3JAMC 2UXCE 3C4BA 2LJHA 2G7HA 1RC7A 2JOBA 4DKKA 4M30A 2N3HA 2ZM6E 4LF7E 1SR9A 1N33E 4JI1E 4DV6E 3J7AG 4GKJE 2E1MA 2L3JA 4DV4E 3F6GA 4LF6E 2LMZA 1WHNA 3HXLA 5AASA 1XMOE 1IBME 1FKAE 1UILA 1PKPA 3C4TA 3JTZA 3LLHA 4F9AB 3FIGA 4DV7E 3KWRA 4F9BB 4DR1E 2LUPB 4J8ZA 2JR1A 2UUCE 4Q28A 2L92A 1T4OA 2V86A 4BC9A 3LMLA 2F4VE 2RS6A 2V89A 4JI8E 5AE2A 1YYKA 5A2QC 1IBLE 3HTXA 4DR4E 2B7VA 3H09A 1X48A 5IT9C 4DUZE 4LF5E 4GEQB 4LF9E 4F54A 3OTOE 2N3GA 2E5LE 3IWCA 4DV2E 2V8QB 1HNZE 5BR8E 5LMUE 2MDRA 2ODRC 1ZBQA 2MC6A 4I8OA 1ZBTA 3J80C 4X66E 2LTSA 4DV5E 2L2KB 1XNQE 2LTRA 1QU6A 4DV3E 4DV1E 4YHHE 4DR6E 3HPZA 1I94E 3F6HA 4B3ME 2M1SA 2L2MA 2FV4B 2JWOA 4BS9A 4F9CB 1YYOA 4BBYA 4LF8E 3VYXA 4JYAE 2M4IA 2YT4A 2L6MA 2VF1A 2L8TA 1YYWA 1N32E 3DF6A 1T4LB 2K4VA 4TUIA 3AUZA 2UXBE 4DUYE 2IHR1 2LUQA 4WSPA 2NUGA 4M2ZA 4OOGC 4BC7A 5AE1A 2KHXA 5LMNE 1HNXE 3IWDA 4LFCE 1DQ3A 2LBSB 4JI2E 2JOXA 2H36X 2RS7A 3ADJA 4L5NC 2V85A 2YZTA 4LTYA 4JI3E 4LFBE 1J26A 4JI0E 4R03A 3ADIA 4LF4E 2L2NA 3HPSA 2F8BA 4WYQB 4TUGA 4AQYE 3T1YE 4NXNE 1UHZA 5AE3A 3VK6A 4X62E 5CFFE 1X47A 4BMJA 3VYYA 1N36E 4KHPE 1FJGE 2B7TA 2KOUA 2ODRD 2VQEE 5DNYA 3ADGA 2WZOA 4DR2E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FTX B;  5T6J A;  4GEQ B;  2FV4 B; 
#chains in the Genus database with same CATH topology
 2VQF E;  2GLI A;  2M7Q A;  2BB8 A;  1STU A;  3KZY A;  2CSH A;  2EOR A;  1L4S A;  5ADZ A;  2MC5 A;  3M99 B;  4M0V A;  2RPC A;  2WCC 3;  2UUB E;  1WJP A;  1T39 A;  2EMC A;  2EN4 A;  2EM6 A;  1DI2 A;  4LU9 A;  2LRS A;  5KL5 A;  2HGH A;  3MHH C;  4JI4 E;  1RMD A;  5A6B A;  1J5E E;  2EOH A;  2JY9 A;  3K6Q A;  1Z1B A;  1A1I A;  3OML A;  3ADL A;  2EPN A;  4B3T E;  1XNR E;  4MLQ A;  1A1K A;  3EQ1 A;  4X64 E;  2D9H A;  1AH5 A;  4B3S E;  2L3C A;  4ZYH A;  2NA2 A;  1T4N A;  3AV0 A;  3C4B A;  4GZN C;  1GTK A;  1G2F C;  4DKK A;  2EMG A;  1SR9 A;  1N33 E;  2EPZ A;  3F6G A;  3VHT B;  4O5G A;  1BB8 A;  2EMA A;  4F9A B;  3JTZ A;  3ECR A;  3KWR A;  2LUP B;  2JR1 A;  2EOF A;  4Q28 A;  1EH6 A;  2V89 A;  4JI8 E;  2YSP A;  1JK2 A;  2B7V A;  1X48 A;  4GEQ B;  4F54 A;  2ENH A;  2YTJ A;  3IWC A;  2GHF A;  2V8Q B;  4DV2 E;  2EN7 A;  5BR8 E;  1SFE A;  2EM4 A;  1PJT A;  2LTR A;  2EOO A;  4DV3 E;  4YHH E;  1I94 E;  3F6H A;  5AC4 A;  4JYA E;  2VF1 A;  2EE8 A;  1N32 E;  3DF6 A;  2UXB E;  4TUI A;  2DGC A;  4WSP A;  4OOG C;  1BBO A;  4LFC E;  1DQ3 A;  2EN2 A;  2JOX A;  2H36 X;  2RS7 A;  4M9V C;  2Q8U A;  2V85 A;  2YZT A;  3THO B;  4JI0 E;  4LF4 E;  4WYQ B;  4AQY E;  2EML A;  1X47 A;  2E72 A;  2EOM A;  1FJG E;  2B7T A;  2EM3 A;  2ODR D;  4O24 A;  3EPK A;  1X6F A;  2EN1 A;  4NHR A;  5LL6 R;  5KL3 A;  4K0K E;  1GZ6 A;  5KL2 A;  2FGG A;  2B3T B;  2WBU A;  2YRH A;  2HC5 A;  4F6M A;  4WXC A;  2UUA E;  4F6N A;  2EMW A;  2J7J A;  2EN8 A;  2FTX B;  1IBK E;  4BCA A;  1WHQ A;  2I9I A;  4R2C A;  4DMI A;  2RSM A;  2KON A;  4L8N A;  1TN9 A;  2EQ3 A;  2EOX A;  2NUE A;  1A1H A;  2DIX A;  4RH8 A;  2RTX A;  5KL4 A;  1MGT A;  1NEI A;  4WFT A;  2YRK A;  1WXR A;  5IWA E;  3RMP A;  3DJW A;  1O0W A;  4GKK E;  4DV0 E;  1YUI A;  2YWQ A;  2R1F A;  3L00 A;  4RHB B;  3JAM C;  2LJH A;  1A1G A;  2JOB A;  4M30 A;  2I13 A;  4LF7 E;  2ZM6 E;  4JI1 E;  4R2R A;  1UIL A;  2YTI A;  3C4T A;  2DLQ A;  2UUC E;  1X5W A;  2EOJ A;  2EM2 A;  1IQO A;  2L92 A;  2HJJ A;  2RS6 A;  2CT1 A;  5AE2 A;  5A2Q C;  5KL6 A;  4DR4 E;  3H09 A;  3OTO E;  2N3G A;  2E5L E;  1HNZ E;  1YFH A;  1QNT A;  4R2D A;  5LMU E;  2ODR C;  4I8O A;  2ELY A;  2YTE A;  1ZBT A;  2LTS A;  2L2K B;  1XNQ E;  2LJU A;  4DR6 E;  2K7I A;  2M1S A;  2EOE A;  1DGC A;  4LF8 E;  1YYO A;  4BBY A;  2EMY A;  2DMI A;  3VYX A;  2M4I A;  2L6M A;  2DLK A;  2EN6 A;  2L8T A;  1YYW A;  1T4L B;  2NUG A;  4M2Z A;  2KHX A;  2YTF A;  2LBS B;  4LTY A;  4L5N C;  1J26 A;  2YU5 A;  2L2N A;  2ADR A;  2EPM X;  4NXN E;  2GPI A;  4KHP E;  4BMJ A;  1EH7 A;  2KOU A;  2YSO A;  4WXD A;  4KWY A;  2EOS A;  4LFA E;  1JK1 A;  2NUF A;  3ZOQ B;  2MDG A;  5FLX C;  1F2I G;  1G2D C;  3EPH A;  2DSY A;  4R2E A;  4DR7 E;  1EKZ A;  4P7D A;  4X65 E;  2YTO A;  2EOQ A;  2YTN A;  3J7Y p;  4JI7 E;  3EPL A;  1PDA A;  2CPN A;  1EH8 A;  2L33 A;  1P47 A;  3IWB A;  3T1H E;  1HNW E;  1HR0 E;  2EMF A;  2EM9 A;  1N34 E;  2B9D A;  4B3R E;  4R2S A;  2UU9 E;  4X8W A;  4DR5 E;  1BBG A;  4NXM E;  2EPA A;  5A6K A;  2WBS A;  2EPK X;  4WPY A;  4P78 A;  4YY3 E;  2V88 A;  2DB2 A;  2JPA A;  4R2A A;  2HHH E;  4R8O A;  2LE2 A;  2EMI A;  2DMY A;  2EMH A;  5AC5 A;  2A25 A;  2EOY A;  1PJS A;  2UXC E;  2EL4 A;  1RC7 A;  1UBD C;  1MEY C;  2EM5 A;  4DV6 E;  2WBT A;  3J7A G;  2R76 A;  2EMX A;  2E1M A;  2EPO A;  2L3J A;  2PRT A;  4LF6 E;  1KJK A;  1XMO E;  5AAS A;  1IBM E;  1FKA E;  1A1J A;  2EM8 A;  3LLH A;  4DV7 E;  2YPN A;  4DR1 E;  2V86 A;  4BC9 A;  2F4V E;  2EMB A;  2RQL A;  2EQ0 A;  1IBL E;  5IT9 C;  2BBG A;  1IQS A;  4LF5 E;  4LF9 E;  5LLQ A;  2MDR A;  4R2Q A;  2MC6 A;  2EM0 A;  1X3C A;  5A6A A;  2JXP A;  1QU6 A;  2NAB A;  4B3M E;  1TF3 A;  4F9C B;  4BS9 A;  5KL7 A;  4WSG A;  2YT4 A;  4HEI A;  2YTQ A;  2K4V A;  2EL5 A;  4DUY E;  2IHR 1;  2LUQ A;  1HNX E;  4FK5 C;  5IV8 B;  4JI2 E;  4LFB E;  2YU8 A;  3ADI A;  2RSI A;  1UN6 B;  3HPS A;  3T1Y E;  2DRP A;  1KYQ A;  5AE3 A;  3VYY A;  3VK6 A;  4X62 E;  4BHC A;  1N36 E;  1YSA C;  2VRD A;  4O4K A;  3ADG A;  2EL6 A;  2WZO A;  4DR2 E;  1AAY A;  3EPJ A;  1ZAA C;  2EP3 A;  2UXD E;  1N3G A;  3KZZ A;  4JI6 E;  5F3W A;  2VE7 C;  4X9J A;  4F2J C;  4JV5 E;  2N8X A;  1X6H A;  1LLM C;  5T6J A;  4HTG A;  5TSE A;  2EJ4 A;  3HQ1 A;  1YPN A;  2EZ6 A;  1TF6 A;  1RQ0 A;  5A69 A;  1X49 A;  2ELZ A;  2JVA A;  2LV2 A;  3JU0 A;  2V83 A;  2EPU A;  1ZU1 A;  2EN3 A;  3MHS C;  4O43 A;  4WX9 A;  4DR3 E;  2JYA A;  2EPL X;  3J81 C;  2EWL A;  1X6E A;  4OX9 E;  2JP9 A;  2V87 A;  1YZ9 A;  2EPR A;  2MKN A;  1T38 A;  2LO3 A;  2EOZ A;  4KZS A;  4JI5 E;  3C6K A;  5A6B D;  4ZYG A;  3MSW A;  1XMQ E;  3BGH A;  3P1X A;  1GQE A;  4IS1 C;  1B69 A;  2G7H A;  4IJD A;  2N3H A;  3QG5 C;  2YTP A;  4GKJ E;  2EOI A;  4DV4 E;  2EM7 A;  2LMZ A;  1WHN A;  3HXL A;  2CTD A;  1PKP A;  3FIG A;  4F9B B;  4J8Z A;  4N4R B;  1T4O A;  3LML A;  2ENC A;  3TQM A;  1NCS A;  1YYK A;  3HTX A;  4DUZ E;  1IMU A;  1ZR9 A;  2EPP A;  2LT7 A;  2YTG A;  1ZBQ A;  3BID A;  1A1F A;  4Q35 B;  3J80 C;  2M9A A;  2EQ1 A;  4X66 E;  4DV5 E;  2LVH A;  4NZV A;  3THN A;  4DV1 E;  1WRJ A;  3HPZ A;  3C6M A;  4ZYD A;  2L2M A;  2FV4 B;  2JWO A;  2EPC A;  1PJQ A;  2YTD A;  3BBG A;  2EMK A;  3AUZ A;  3BF2 A;  4R2P A;  4MLV A;  4BC7 A;  2EPX A;  5AE1 A;  5IXM B;  5LMN E;  3IWD A;  4JI3 E;  3ADJ A;  2EMZ A;  4R03 A;  1YUJ A;  4TUG A;  2F8B A;  1UHZ A;  4BHB A;  5CFF E;  2LCE A;  2ENA A;  2MKD A;  4ZYE A;  2YRM A;  2VQE E;  5DNY A;  5A6J A;  3UK3 C;  1A1L A; 
#chains in the Genus database with same CATH homology
 5LL6 R;  2VQF E;  4LFA E;  2M7Q A;  1STU A;  2UXD E;  4K0K E;  1GZ6 A;  2NUF A;  3ZOQ B;  4JI6 E;  2FGG A;  2B3T B;  5F3W A;  5FLX C;  5ADZ A;  2VE7 C;  2MC5 A;  4JV5 E;  2DSY A;  4M0V A;  2UUA E;  4DR7 E;  1EKZ A;  5T6J A;  2UUB E;  4P7D A;  4X65 E;  2FTX B;  3HQ1 A;  1IBK E;  3J7Y p;  2EZ6 A;  1DI2 A;  4LU9 A;  4JI7 E;  1RQ0 A;  2LRS A;  1X49 A;  1WHQ A;  2CPN A;  2L33 A;  4BCA A;  2JVA A;  4JI4 E;  3IWB A;  3T1H E;  3JU0 A;  4DMI A;  1J5E E;  1N34 E;  2V83 A;  1HR0 E;  1HNW E;  3K6Q A;  2JY9 A;  2RSM A;  2B9D A;  2KON A;  4L8N A;  4DR3 E;  4B3R E;  3J81 C;  2UU9 E;  4X8W A;  2EWL A;  3OML A;  4DR5 E;  3ADL A;  4OX9 E;  2NUE A;  4B3T E;  2DIX A;  1XNR E;  2V87 A;  4NXM E;  1YZ9 A;  2RTX A;  4X64 E;  4WFT A;  4WPY A;  4P78 A;  4YY3 E;  1WXR A;  4KZS A;  5IWA E;  2V88 A;  4JI5 E;  2DB2 A;  3RMP A;  4B3S E;  3DJW A;  1O0W A;  2L3C A;  2HHH E;  4R8O A;  4DV0 E;  2LE2 A;  4GKK E;  3MSW A;  2DMY A;  1XMQ E;  2NA2 A;  3P1X A;  1GQE A;  1T4N A;  3AV0 A;  3JAM C;  2UXC E;  3C4B A;  2LJH A;  2G7H A;  1RC7 A;  2JOB A;  4DKK A;  4M30 A;  2N3H A;  2ZM6 E;  4LF7 E;  1SR9 A;  1N33 E;  4JI1 E;  4DV6 E;  3J7A G;  4GKJ E;  2E1M A;  2L3J A;  4DV4 E;  3F6G A;  4LF6 E;  2LMZ A;  1WHN A;  3HXL A;  5AAS A;  1XMO E;  1IBM E;  1FKA E;  1UIL A;  1PKP A;  3C4T A;  3JTZ A;  3LLH A;  4F9A B;  3FIG A;  4DV7 E;  3KWR A;  4F9B B;  4DR1 E;  2LUP B;  4J8Z A;  2JR1 A;  2UUC E;  4Q28 A;  2L92 A;  1T4O A;  2V86 A;  4BC9 A;  3LML A;  2F4V E;  2RS6 A;  2V89 A;  4JI8 E;  5AE2 A;  1YYK A;  5A2Q C;  1IBL E;  3HTX A;  4DR4 E;  2B7V A;  3H09 A;  1X48 A;  5IT9 C;  4DUZ E;  4LF5 E;  4GEQ B;  4LF9 E;  4F54 A;  3OTO E;  2N3G A;  2E5L E;  3IWC A;  4DV2 E;  2V8Q B;  1HNZ E;  5BR8 E;  5LMU E;  2MDR A;  2ODR C;  1ZBQ A;  2MC6 A;  4I8O A;  1ZBT A;  3J80 C;  4X66 E;  2LTS A;  4DV5 E;  2L2K B;  1XNQ E;  2LTR A;  1QU6 A;  4DV3 E;  4DV1 E;  4YHH E;  4DR6 E;  3HPZ A;  1I94 E;  3F6H A;  4B3M E;  2M1S A;  2L2M A;  2FV4 B;  2JWO A;  4BS9 A;  4F9C B;  1YYO A;  4BBY A;  4LF8 E;  3VYX A;  4JYA E;  2M4I A;  2YT4 A;  2L6M A;  2VF1 A;  2L8T A;  1YYW A;  1N32 E;  3DF6 A;  1T4L B;  2K4V A;  4TUI A;  3AUZ A;  2UXB E;  4DUY E;  2IHR 1;  2LUQ A;  4WSP A;  2NUG A;  4M2Z A;  4OOG C;  4BC7 A;  5AE1 A;  2KHX A;  5LMN E;  1HNX E;  3IWD A;  4LFC E;  1DQ3 A;  2LBS B;  4JI2 E;  2JOX A;  2H36 X;  2RS7 A;  3ADJ A;  4L5N C;  2V85 A;  2YZT A;  4LTY A;  4JI3 E;  4LFB E;  1J26 A;  4JI0 E;  4R03 A;  3ADI A;  4LF4 E;  2L2N A;  3HPS A;  2F8B A;  4WYQ B;  4TUG A;  4AQY E;  3T1Y E;  4NXN E;  1UHZ A;  5AE3 A;  3VK6 A;  4X62 E;  5CFF E;  1X47 A;  4BMJ A;  3VYY A;  1N36 E;  4KHP E;  1FJG E;  2B7T A;  2KOU A;  2ODR D;  2VQE E;  5DNY A;  3ADG A;  2WZO A;  4DR2 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...