2FV4B

Nmr solution structure of the yeast kinetochore spc24/spc25 globular domain
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
58
structure length
58
Chain Sequence
NENILKLKLYRSLGVILDLENDQVLINRKNDGNIDILPLDNNLSDFYKTKYIWERLGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein, protein binding
molecule keywords Hypothetical 25.2 kDa protein in AFG3-SEB2 intergenic region
publication title Structure of a central component of the yeast kinetochore: the spc24p/spc25p globular domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 16
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2006-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.430 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2fv4B00
4GEQB 2FTXB 2FV4B 5T6JA
chains in the Genus database with same CATH superfamily
4DKKA 3EQ1A 3HPSA 4N4RB 5AASA 3HQ1A 2EM3A 2L2MA 2V85A 4JI2E 4X9JA 2EPOA 2WBSA 4JI4E 2GLIA 2LTRA 2ADRA 3DF6A 3J80C 4HTGA 2EMFA 4RH8A 1KYQA 2EOQA 2FTXB 3C6KA 2YTEA 1UILA 5DNYA 2EORA 3BF2A 3ADLA 3J7AG 2YTGA 4R2QA 2LT7A 3ADGA 4DR1E 2EN3A 4JI6E 2L8TA 4R03A 4F6NA 1J26A 2R76A 4L5NC 4F9AB 2EN6A 2FGGA 2E72A 2UUBE 1MGTA 5A6KA 3JAMC 1UHZA 2GPIA 3DJWA 2NA2A 3F6HA 4B3TE 4M9VC 4OX9E 2DIXA 2EPLX 4B3RE 5AE2A 5KL4A 1NEIA 4JV5E 2EOXA 5IV8B 4BBYA 2RQLA 1GZ6A 3FIGA 2LE2A 4LF9E 2E5LE 4KWYA 4F9BB 2EMWA 2J7JA 3C6MA 2EM7A 1QU6A 4JI5E 4DR6E 5ADZA 2YU8A 2JOXA 4P7DA 4R2RA 2IHR1 1PJSA 1BBOA 2CTDA 2EQ1A 2EPZA 2WZOA 3JU0A 2YTPA 2YSPA 4WXDA 5KL3A 4R2DA 2WBTA 2EM5A 1T39A 1YYWA 4DV7E 4JI8E 1X49A 1GQEA 1T4OA 2L33A 4WXCA 3M99B 2VQFE 4MLVA 3VHTB 1EH6A 1A1HA 3BGHA 4X62E 2KONA 4WYQB 2LUPB 2JP9A 1N3GA 1YZ9A 4LF7E 2EPNA 1XNRE 1G2FC 1YUIA 1J5EE 1YYOA 1XMOE 1IBME 2L3CA 4R2EA 4J8ZA 2V86A 1FKAE 2JPAA 2JOBA 2YRKA 2EN1A 4NHRA 2NUEA 1HNXE 1N33E 1TF3A 1NCSA 1WXRA 4DV4E 1N32E 2JY9A 3ADJA 5T6JA 2ODRD 4DR3E 2EM4A 2JVAA 2EL5A 1EH8A 1PDAA 1A1GA 2LBSB 2VE7C 4R2PA 2BBGA 4KHPE 2UUAE 4GEQB 1IBKE 2YT4A 3EPHA 3BBGA 4BCAA 5A6JA 3RMPA 5FLXC 3KZYA 1YSAC 2DGCA 3VYYA 2VQEE 2CT1A 1SR9A 2MC5A 2Q8UA 3IWDA 2MKNA 4AQYE 3HXLA 2EOJA 4GZNC 1XMQE 4F9CB 3ADIA 2V8QB 2EMCA 1AAYA 4M2ZA 2WCC3 2YRMA 2DSYA 4O43A 2V83A 2KOUA 3EPLA 1JK2A 3QG5C 1IBLE 4LF5E 2EZ6A 4JI1E 2CPNA 2EM6A 2H36X 1I94E 4NXNE 2EJ4A 2YTJA 2E1MA 3LMLA 1ZAAC 2EPKX 4ZYGA 2EOMA 2CSHA 2YTOA 2HGHA 2D9HA 1XNQE 2EOZA 2LJHA 4DMIA 2EMHA 5LL6R 2BB8A 1WJPA 4R8OA 1PJTA 4R2SA 3L00A 3P1XA 5AE1A 2I13A 3LLHA 2YTFA 1GTKA 2ENHA 2L6MA 4MLQA 2RPCA 4ZYEA 4ZYDA 1T4NA 1P47A 5LMNE 1X3CA 2UU9E 2MDRA 2MKDA 2EQ3A 1EH7A 4K0KE 1PJQA 2EPMX 2HJJA 2M4IA 1X6HA 4OOGC 2YTIA 2GHFA 4DV0E 2L2KB 2MDGA 2LMZA 3C4TA 4DR5E 3J7Yp 3UK3C 2EOOA 1YYKA 4DV6E 4WX9A 2R1FA 3ECRA 2HHHE 4WSPA 1T4LB 2UXBE 4B3ME 3MSWA 1STUA 2VF1A 1FJGE 2EM8A 2EOHA 2UXDE 3HPZA 2RS7A 4L8NA 2EPCA 1IQSA 4R2CA 4LU9A 2EP3A 2DMYA 4O4KA 3C4BA 1X5WA 1T38A 4NZVA 4LFBE 3F6GA 3THNA 4DV2E 2F8BA 2RSIA 2EMZA 4WFTA 3J81C 4DR7E 4B3SE 1LLMC 1DI2A 2EOIA 1ZBTA 2K4VA 1N36E 4FK5C 4DR4E 2YU5A 4X66E 4LF4E 2EM2A 3ZOQB 1UN6B 3H09A 2EMIA 4LFAE 2EE8A 5LMUE 2B7VA 5TSEA 4HEIA 1BB8A 2EM9A 4KZSA 4R2AA 2V89A 1TN9A 1YPNA 4BHCA 3AV0A 5A2QC 4X8WA 4BC7A 1X47A 2B7TA 2N3HA 4JI7E 2B3TB 1AH5A 5KL6A 4DR2E 4BMJA 2DLKA 1JK1A 2DRPA 4BC9A 2V88A 2EL6A 2RS6A 2EMYA 5BR8E 2ENCA 2ZM6E 1YUJA 4RHBB 3IWCA 4M30A 2DLQA 2EPRA 1RQ0A 3T1HE 1A1JA 2ELYA 2MC6A 4O5GA 5A6BA 1Z1BA 4JYAE 4DUZE 2EMBA 2N3GA 3EPJA 2G7HA 2HC5A 4JI0E 4NXME 2I9IA 1ZU1A 3OMLA 5AE3A 2EPXA 5A6AA 2ELZA 4LFCE 4X64E 2EMGA 4YHHE 2EN7A 3AUZA 2WBUA 2ODRC 5LLQA 2LCEA 4TUGA 2M1SA 2JR1A 2RTXA 4LTYA 1X6EA 2YRHA 1KJKA 2JXPA 2YTDA 2YSOA 4ZYHA 2FV4B 1F2IG 3K6QA 5AC4A 2YZTA 3OTOE 1RMDA 1X6FA 2F4VE 2KHXA 2UUCE 5F3WA 3KWRA 2NABA 5IXMB 5AC5A 2A25A 1HR0E 2YTQA 2DB2A 4YY3E 2UXCE 4GKJE 2EPAA 4TUIA 2EOYA 2JYAA 2NUFA 1X48A 1YFHA 4Q28A 1BBGA 1DQ3A 3KZZA 3EPKA 3BIDA 2LV2A 2EN2A 1N34E 1MEYC 3T1YE 4JI3E 1B69A 2V87A 2K7IA 2L92A 2YTNA 1A1FA 2L2NA 2LJUA 4DV3E 1IQOA 4IJDA 2EN4A 4DV1E 2DMIA 1A1KA 4X65E 2LO3A 3HTXA 2EMXA 2EMAA 2EOEA 1DGCA 4LF6E 2L3JA 2EOFA 2LRSA 5A69A 3JTZA 1WHNA 3IWBA 2M9AA 4Q35B 2EMKA 1IMUA 2B9DA 4F54A 2PRTA 2EOSA 2EPPA 3VK6A 1QNTA 3THOB 4DV5E 5IT9C 1SFEA 3MHSC 2EMLA 4WPYA 2EWLA 2YPNA 1HNZE 2N8XA 2EQ0A 5KL7A 2JWOA 4P78A 1ZR9A 1G2DC 1WHQA 2ENAA 1UBDC 2YWQA 3TQMA 2EM0A 5A6BD 2EL4A 5KL5A 5KL2A 1RC7A 1L4SA 1A1IA 2RSMA 4O24A 1EKZA 3VYXA 2EPUA 4F2JC 4BHBA 1TF6A 2LVHA 1O0WA 4BS9A 4IS1C 4LF8E 2EN8A 1A1LA 2NUGA 1WRJA 5CFFE 4I8OA 2LUQA 2M7QA 2LTSA 3MHHC 5IWAE 1HNWE 4WSGA 1PKPA 2VRDA 4M0VA 4DUYE 1ZBQA 4GKKE 4F6MA
chains in the Genus database with same CATH topology
4DKKA 4J8ZA 2KHXA 2L2KB 2LMZA 3HPSA 5F3WA 3KWRA 2UUCE 3C4TA 2V86A 5AASA 3HQ1A 2JOBA 2L2MA 3J7Yp 4DR5E 1FKAE 2V85A 1YYKA 2NUEA 1HNXE 4JI2E 1N33E 4DV6E 1HR0E 1WXRA 2DB2A 4YY3E 4DV4E 2UXCE 1N32E 2JY9A 3ADJA 4GKJE 4TUIA 2HHHE 2NUFA 4JI4E 1X48A 2LTRA 2ODRD 3DF6A 4WSPA 5T6JA 3J80C 4DR3E 1T4LB 4Q28A 2JVAA 4B3ME 2UXBE 1STUA 2VF1A 3MSWA 1DQ3A 2FTXB 1FJGE 1UILA 5DNYA 3HPZA 2RS7A 2VE7C 4L8NA 2LBSB 1N34E 3ADLA 2UXDE 4LU9A 3J7AG 3T1YE 4KHPE 4JI3E 2DMYA 3C4BA 2V87A 2UUAE 2L92A 4LFBE 2L2NA 3F6GA 4GEQB 4DV2E 2YT4A 3ADGA 4DR1E 1IBKE 4JI6E 2L8TA 4R03A 2F8BA 4BCAA 4DV3E 4L5NC 3RMPA 1J26A 4DR7E 4WFTA 5FLXC 3J81C 4F9AB 4B3SE 2FGGA 1DI2A 2UUBE 4DV1E 1ZBTA 2K4VA 3VYYA 3JAMC 1UHZA 3DJWA 2VQEE 1N36E 2NA2A 3F6HA 4DR4E 1SR9A 2MC5A 4X65E 4X66E 4LF4E 4B3TE 3HTXA 2F4VE 3IWDA 4OX9E 2DIXA 3ZOQB 4AQYE 3H09A 3HXLA 4LFAE 4B3RE 5AE2A 1XMQE 4LF6E 4F9CB 5LMUE 3ADIA 2V8QB 4JV5E 2L3JA 4GKKE 2B7VA 2LRSA 4BBYA 3JTZA 4M2ZA 4KZSA 2V89A 1WHNA 2DSYA 3IWBA 1GZ6A 2V83A 5A2QC 3AV0A 2KOUA 3FIGA 2LE2A 4LF9E 4X8WA 4BC7A 2E5LE 2B9DA 4F54A 1X47A 4F9BB 1IBLE 2B7TA 4LF5E 2EZ6A 4JI1E 1QU6A 2N3HA 4JI7E 2B3TB 2CPNA 2H36X 3VK6A 1I94E 4JI5E 4NXNE 4DR6E 5ADZA 3LMLA 2E1MA 2JOXA 4P7DA 4DV5E 4BMJA 4DR2E 2IHR1 5IT9C 4BC9A 2V88A 4WPYA 2EWLA 2WZOA 2RS6A 1XNQE 5BR8E 2ZM6E 1HNZE 2LJHA 4DMIA 3IWCA 3JU0A 4M30A 2JWOA 4P78A 5LL6R 1RQ0A 1WHQA 3T1HE 2MC6A 4R8OA 4JYAE 3P1XA 5AE1A 4DUZE 2N3GA 1YYWA 4DV7E 2G7HA 4NXME 4JI0E 4JI8E 3LLHA 2L6MA 3OMLA 1RC7A 5AE3A 1X49A 1GQEA 2RSMA 1T4OA 2L33A 4LFCE 1EKZA 4X64E 3VYXA 4YHHE 2VQFE 1O0WA 1T4NA 3AUZA 4BS9A 4LF8E 2ODRC 5LMNE 2NUGA 4X62E 2UU9E 2KONA 2MDRA 4WYQB 4TUGA 2LUPB 5CFFE 2M1SA 2JR1A 2RTXA 4I8OA 2LUQA 4LTYA 2M7QA 2LTSA 1YZ9A 4LF7E 5IWAE 1XNRE 1HNWE 4K0KE 1PKPA 2FV4B 3K6QA 2M4IA 2YZTA 4M0VA 4DUYE 4OOGC 3OTOE 1J5EE 1YYOA 1ZBQA 1XMOE 1IBME 4DV0E 2L3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GEQ B;  2FTX B;  2FV4 B;  5T6J A; 
#chains in the Genus database with same CATH topology
 4DKK A;  3EQ1 A;  3HPS A;  4N4R B;  5AAS A;  3HQ1 A;  2EM3 A;  2L2M A;  2V85 A;  4JI2 E;  4X9J A;  2EPO A;  2WBS A;  4JI4 E;  2GLI A;  2LTR A;  2ADR A;  3DF6 A;  3J80 C;  4HTG A;  2EMF A;  4RH8 A;  1KYQ A;  2EOQ A;  2FTX B;  3C6K A;  2YTE A;  1UIL A;  5DNY A;  2EOR A;  3BF2 A;  3ADL A;  3J7A G;  2YTG A;  4R2Q A;  2LT7 A;  3ADG A;  4DR1 E;  2EN3 A;  4JI6 E;  2L8T A;  4R03 A;  4F6N A;  1J26 A;  2R76 A;  4L5N C;  4F9A B;  2EN6 A;  2FGG A;  2E72 A;  2UUB E;  1MGT A;  5A6K A;  3JAM C;  1UHZ A;  2GPI A;  3DJW A;  2NA2 A;  3F6H A;  4B3T E;  4M9V C;  4OX9 E;  2DIX A;  2EPL X;  4B3R E;  5AE2 A;  5KL4 A;  1NEI A;  4JV5 E;  2EOX A;  5IV8 B;  4BBY A;  2RQL A;  1GZ6 A;  3FIG A;  2LE2 A;  4LF9 E;  2E5L E;  4KWY A;  4F9B B;  2EMW A;  2J7J A;  3C6M A;  2EM7 A;  1QU6 A;  4JI5 E;  4DR6 E;  5ADZ A;  2YU8 A;  2JOX A;  4P7D A;  4R2R A;  2IHR 1;  1PJS A;  1BBO A;  2CTD A;  2EQ1 A;  2EPZ A;  2WZO A;  3JU0 A;  2YTP A;  2YSP A;  4WXD A;  5KL3 A;  4R2D A;  2WBT A;  2EM5 A;  1T39 A;  1YYW A;  4DV7 E;  4JI8 E;  1X49 A;  1GQE A;  1T4O A;  2L33 A;  4WXC A;  3M99 B;  2VQF E;  4MLV A;  3VHT B;  1EH6 A;  1A1H A;  3BGH A;  4X62 E;  2KON A;  4WYQ B;  2LUP B;  2JP9 A;  1N3G A;  1YZ9 A;  4LF7 E;  2EPN A;  1XNR E;  1G2F C;  1YUI A;  1J5E E;  1YYO A;  1XMO E;  1IBM E;  2L3C A;  4R2E A;  4J8Z A;  2V86 A;  1FKA E;  2JPA A;  2JOB A;  2YRK A;  2EN1 A;  4NHR A;  2NUE A;  1HNX E;  1N33 E;  1TF3 A;  1NCS A;  1WXR A;  4DV4 E;  1N32 E;  2JY9 A;  3ADJ A;  5T6J A;  2ODR D;  4DR3 E;  2EM4 A;  2JVA A;  2EL5 A;  1EH8 A;  1PDA A;  1A1G A;  2LBS B;  2VE7 C;  4R2P A;  2BBG A;  4KHP E;  2UUA E;  4GEQ B;  1IBK E;  2YT4 A;  3EPH A;  3BBG A;  4BCA A;  5A6J A;  3RMP A;  5FLX C;  3KZY A;  1YSA C;  2DGC A;  3VYY A;  2VQE E;  2CT1 A;  1SR9 A;  2MC5 A;  2Q8U A;  3IWD A;  2MKN A;  4AQY E;  3HXL A;  2EOJ A;  4GZN C;  1XMQ E;  4F9C B;  3ADI A;  2V8Q B;  2EMC A;  1AAY A;  4M2Z A;  2WCC 3;  2YRM A;  2DSY A;  4O43 A;  2V83 A;  2KOU A;  3EPL A;  1JK2 A;  3QG5 C;  1IBL E;  4LF5 E;  2EZ6 A;  4JI1 E;  2CPN A;  2EM6 A;  2H36 X;  1I94 E;  4NXN E;  2EJ4 A;  2YTJ A;  2E1M A;  3LML A;  1ZAA C;  2EPK X;  4ZYG A;  2EOM A;  2CSH A;  2YTO A;  2HGH A;  2D9H A;  1XNQ E;  2EOZ A;  2LJH A;  4DMI A;  2EMH A;  5LL6 R;  2BB8 A;  1WJP A;  4R8O A;  1PJT A;  4R2S A;  3L00 A;  3P1X A;  5AE1 A;  2I13 A;  3LLH A;  2YTF A;  1GTK A;  2ENH A;  2L6M A;  4MLQ A;  2RPC A;  4ZYE A;  4ZYD A;  1T4N A;  1P47 A;  5LMN E;  1X3C A;  2UU9 E;  2MDR A;  2MKD A;  2EQ3 A;  1EH7 A;  4K0K E;  1PJQ A;  2EPM X;  2HJJ A;  2M4I A;  1X6H A;  4OOG C;  2YTI A;  2GHF A;  4DV0 E;  2L2K B;  2MDG A;  2LMZ A;  3C4T A;  4DR5 E;  3J7Y p;  3UK3 C;  2EOO A;  1YYK A;  4DV6 E;  4WX9 A;  2R1F A;  3ECR A;  2HHH E;  4WSP A;  1T4L B;  2UXB E;  4B3M E;  3MSW A;  1STU A;  2VF1 A;  1FJG E;  2EM8 A;  2EOH A;  2UXD E;  3HPZ A;  2RS7 A;  4L8N A;  2EPC A;  1IQS A;  4R2C A;  4LU9 A;  2EP3 A;  2DMY A;  4O4K A;  3C4B A;  1X5W A;  1T38 A;  4NZV A;  4LFB E;  3F6G A;  3THN A;  4DV2 E;  2F8B A;  2RSI A;  2EMZ A;  4WFT A;  3J81 C;  4DR7 E;  4B3S E;  1LLM C;  1DI2 A;  2EOI A;  1ZBT A;  2K4V A;  1N36 E;  4FK5 C;  4DR4 E;  2YU5 A;  4X66 E;  4LF4 E;  2EM2 A;  3ZOQ B;  1UN6 B;  3H09 A;  2EMI A;  4LFA E;  2EE8 A;  5LMU E;  2B7V A;  5TSE A;  4HEI A;  1BB8 A;  2EM9 A;  4KZS A;  4R2A A;  2V89 A;  1TN9 A;  1YPN A;  4BHC A;  3AV0 A;  5A2Q C;  4X8W A;  4BC7 A;  1X47 A;  2B7T A;  2N3H A;  4JI7 E;  2B3T B;  1AH5 A;  5KL6 A;  4DR2 E;  4BMJ A;  2DLK A;  1JK1 A;  2DRP A;  4BC9 A;  2V88 A;  2EL6 A;  2RS6 A;  2EMY A;  5BR8 E;  2ENC A;  2ZM6 E;  1YUJ A;  4RHB B;  3IWC A;  4M30 A;  2DLQ A;  2EPR A;  1RQ0 A;  3T1H E;  1A1J A;  2ELY A;  2MC6 A;  4O5G A;  5A6B A;  1Z1B A;  4JYA E;  4DUZ E;  2EMB A;  2N3G A;  3EPJ A;  2G7H A;  2HC5 A;  4JI0 E;  4NXM E;  2I9I A;  1ZU1 A;  3OML A;  5AE3 A;  2EPX A;  5A6A A;  2ELZ A;  4LFC E;  4X64 E;  2EMG A;  4YHH E;  2EN7 A;  3AUZ A;  2WBU A;  2ODR C;  5LLQ A;  2LCE A;  4TUG A;  2M1S A;  2JR1 A;  2RTX A;  4LTY A;  1X6E A;  2YRH A;  1KJK A;  2JXP A;  2YTD A;  2YSO A;  4ZYH A;  2FV4 B;  1F2I G;  3K6Q A;  5AC4 A;  2YZT A;  3OTO E;  1RMD A;  1X6F A;  2F4V E;  2KHX A;  2UUC E;  5F3W A;  3KWR A;  2NAB A;  5IXM B;  5AC5 A;  2A25 A;  1HR0 E;  2YTQ A;  2DB2 A;  4YY3 E;  2UXC E;  4GKJ E;  2EPA A;  4TUI A;  2EOY A;  2JYA A;  2NUF A;  1X48 A;  1YFH A;  4Q28 A;  1BBG A;  1DQ3 A;  3KZZ A;  3EPK A;  3BID A;  2LV2 A;  2EN2 A;  1N34 E;  1MEY C;  3T1Y E;  4JI3 E;  1B69 A;  2V87 A;  2K7I A;  2L92 A;  2YTN A;  1A1F A;  2L2N A;  2LJU A;  4DV3 E;  1IQO A;  4IJD A;  2EN4 A;  4DV1 E;  2DMI A;  1A1K A;  4X65 E;  2LO3 A;  3HTX A;  2EMX A;  2EMA A;  2EOE A;  1DGC A;  4LF6 E;  2L3J A;  2EOF A;  2LRS A;  5A69 A;  3JTZ A;  1WHN A;  3IWB A;  2M9A A;  4Q35 B;  2EMK A;  1IMU A;  2B9D A;  4F54 A;  2PRT A;  2EOS A;  2EPP A;  3VK6 A;  1QNT A;  3THO B;  4DV5 E;  5IT9 C;  1SFE A;  3MHS C;  2EML A;  4WPY A;  2EWL A;  2YPN A;  1HNZ E;  2N8X A;  2EQ0 A;  5KL7 A;  2JWO A;  4P78 A;  1ZR9 A;  1G2D C;  1WHQ A;  2ENA A;  1UBD C;  2YWQ A;  3TQM A;  2EM0 A;  5A6B D;  2EL4 A;  5KL5 A;  5KL2 A;  1RC7 A;  1L4S A;  1A1I A;  2RSM A;  4O24 A;  1EKZ A;  3VYX A;  2EPU A;  4F2J C;  4BHB A;  1TF6 A;  2LVH A;  1O0W A;  4BS9 A;  4IS1 C;  4LF8 E;  2EN8 A;  1A1L A;  2NUG A;  1WRJ A;  5CFF E;  4I8O A;  2LUQ A;  2M7Q A;  2LTS A;  3MHH C;  5IWA E;  1HNW E;  4WSG A;  1PKP A;  2VRD A;  4M0V A;  4DUY E;  1ZBQ A;  4GKK E;  4F6M A; 
#chains in the Genus database with same CATH homology
 4DKK A;  4J8Z A;  2KHX A;  2L2K B;  2LMZ A;  3HPS A;  5F3W A;  3KWR A;  2UUC E;  3C4T A;  2V86 A;  5AAS A;  3HQ1 A;  2JOB A;  2L2M A;  3J7Y p;  4DR5 E;  1FKA E;  2V85 A;  1YYK A;  2NUE A;  1HNX E;  4JI2 E;  1N33 E;  4DV6 E;  1HR0 E;  1WXR A;  2DB2 A;  4YY3 E;  4DV4 E;  2UXC E;  1N32 E;  2JY9 A;  3ADJ A;  4GKJ E;  4TUI A;  2HHH E;  2NUF A;  4JI4 E;  1X48 A;  2LTR A;  2ODR D;  3DF6 A;  4WSP A;  5T6J A;  3J80 C;  4DR3 E;  1T4L B;  4Q28 A;  2JVA A;  4B3M E;  2UXB E;  1STU A;  2VF1 A;  3MSW A;  1DQ3 A;  2FTX B;  1FJG E;  1UIL A;  5DNY A;  3HPZ A;  2RS7 A;  2VE7 C;  4L8N A;  2LBS B;  1N34 E;  3ADL A;  2UXD E;  4LU9 A;  3J7A G;  3T1Y E;  4KHP E;  4JI3 E;  2DMY A;  3C4B A;  2V87 A;  2UUA E;  2L92 A;  4LFB E;  2L2N A;  3F6G A;  4GEQ B;  4DV2 E;  2YT4 A;  3ADG A;  4DR1 E;  1IBK E;  4JI6 E;  2L8T A;  4R03 A;  2F8B A;  4BCA A;  4DV3 E;  4L5N C;  3RMP A;  1J26 A;  4DR7 E;  4WFT A;  5FLX C;  3J81 C;  4F9A B;  4B3S E;  2FGG A;  1DI2 A;  2UUB E;  4DV1 E;  1ZBT A;  2K4V A;  3VYY A;  3JAM C;  1UHZ A;  3DJW A;  2VQE E;  1N36 E;  2NA2 A;  3F6H A;  4DR4 E;  1SR9 A;  2MC5 A;  4X65 E;  4X66 E;  4LF4 E;  4B3T E;  3HTX A;  2F4V E;  3IWD A;  4OX9 E;  2DIX A;  3ZOQ B;  4AQY E;  3H09 A;  3HXL A;  4LFA E;  4B3R E;  5AE2 A;  1XMQ E;  4LF6 E;  4F9C B;  5LMU E;  3ADI A;  2V8Q B;  4JV5 E;  2L3J A;  4GKK E;  2B7V A;  2LRS A;  4BBY A;  3JTZ A;  4M2Z A;  4KZS A;  2V89 A;  1WHN A;  2DSY A;  3IWB A;  1GZ6 A;  2V83 A;  5A2Q C;  3AV0 A;  2KOU A;  3FIG A;  2LE2 A;  4LF9 E;  4X8W A;  4BC7 A;  2E5L E;  2B9D A;  4F54 A;  1X47 A;  4F9B B;  1IBL E;  2B7T A;  4LF5 E;  2EZ6 A;  4JI1 E;  1QU6 A;  2N3H A;  4JI7 E;  2B3T B;  2CPN A;  2H36 X;  3VK6 A;  1I94 E;  4JI5 E;  4NXN E;  4DR6 E;  5ADZ A;  3LML A;  2E1M A;  2JOX A;  4P7D A;  4DV5 E;  4BMJ A;  4DR2 E;  2IHR 1;  5IT9 C;  4BC9 A;  2V88 A;  4WPY A;  2EWL A;  2WZO A;  2RS6 A;  1XNQ E;  5BR8 E;  2ZM6 E;  1HNZ E;  2LJH A;  4DMI A;  3IWC A;  3JU0 A;  4M30 A;  2JWO A;  4P78 A;  5LL6 R;  1RQ0 A;  1WHQ A;  3T1H E;  2MC6 A;  4R8O A;  4JYA E;  3P1X A;  5AE1 A;  4DUZ E;  2N3G A;  1YYW A;  4DV7 E;  2G7H A;  4NXM E;  4JI0 E;  4JI8 E;  3LLH A;  2L6M A;  3OML A;  1RC7 A;  5AE3 A;  1X49 A;  1GQE A;  2RSM A;  1T4O A;  2L33 A;  4LFC E;  1EKZ A;  4X64 E;  3VYX A;  4YHH E;  2VQF E;  1O0W A;  1T4N A;  3AUZ A;  4BS9 A;  4LF8 E;  2ODR C;  5LMN E;  2NUG A;  4X62 E;  2UU9 E;  2KON A;  2MDR A;  4WYQ B;  4TUG A;  2LUP B;  5CFF E;  2M1S A;  2JR1 A;  2RTX A;  4I8O A;  2LUQ A;  4LTY A;  2M7Q A;  2LTS A;  1YZ9 A;  4LF7 E;  5IWA E;  1XNR E;  1HNW E;  4K0K E;  1PKP A;  2FV4 B;  3K6Q A;  2M4I A;  2YZT A;  4M0V A;  4DUY E;  4OOG C;  3OTO E;  1J5E E;  1YYO A;  1ZBQ A;  1XMO E;  1IBM E;  4DV0 E;  2L3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...